--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:54:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2630/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -793.58 -804.17
2 -793.50 -802.53
--------------------------------------
TOTAL -793.54 -803.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.487624 0.021391 0.250237 0.784408 0.462857 1012.61 1033.21 1.000
r(A<->C){all} 0.196741 0.007553 0.038111 0.374036 0.189678 345.86 366.64 1.006
r(A<->G){all} 0.154648 0.007222 0.003059 0.313911 0.145565 387.79 395.13 1.001
r(A<->T){all} 0.148796 0.008933 0.000078 0.324711 0.132040 293.44 303.84 1.003
r(C<->G){all} 0.154041 0.005491 0.016580 0.301218 0.144143 414.43 527.32 1.002
r(C<->T){all} 0.163000 0.007786 0.001919 0.320482 0.151843 299.81 301.99 1.000
r(G<->T){all} 0.182775 0.008911 0.012579 0.365232 0.170372 346.91 376.68 1.000
pi(A){all} 0.212980 0.000358 0.172903 0.247616 0.212722 1135.90 1158.40 1.000
pi(C){all} 0.341704 0.000494 0.301100 0.386449 0.341501 918.66 1135.63 1.000
pi(G){all} 0.264377 0.000421 0.222608 0.304003 0.263726 781.97 964.21 1.000
pi(T){all} 0.180938 0.000322 0.145360 0.215894 0.180304 1253.87 1377.43 1.001
alpha{1,2} 0.429927 0.130436 0.000215 1.168301 0.328636 798.06 962.37 1.000
alpha{3} 0.752371 0.274558 0.003497 1.772511 0.628114 1094.00 1219.19 1.000
pinvar{all} 0.246029 0.029140 0.000213 0.560261 0.222741 859.75 952.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -660.011673
Model 2: PositiveSelection -638.427906
Model 0: one-ratio -665.138711
Model 7: beta -660.066027
Model 8: beta&w>1 -638.428287
Model 0 vs 1 10.254075999999941
Model 2 vs 1 43.16753399999993
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 1.000** 998.675
2 L 0.978* 976.552
3 T 0.981* 979.555
4 D 1.000** 998.509
5 G 0.953* 951.860
9 P 0.971* 970.062
11 L 0.969* 967.656
13 F 0.978* 977.024
14 A 0.963* 962.509
17 T 0.952* 951.223
18 S 0.988* 987.042
20 G 0.968* 967.058
21 V 1.000** 998.762
22 T 0.999** 998.252
23 S 1.000** 998.737
24 P 0.958* 956.921
26 E 0.963* 961.724
27 S 0.986* 985.103
29 A 0.959* 958.101
31 A 0.950* 949.078
34 D 1.000** 998.595
35 L 0.979* 977.537
36 I 1.000** 998.891
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 0.989* 9.976 +- 1.193
2 L 0.979* 9.881 +- 1.501
3 T 0.955* 9.657 +- 2.043
4 D 0.984* 9.929 +- 1.356
5 G 0.802 8.244 +- 3.735
7 L 0.813 8.348 +- 3.655
9 P 0.844 8.633 +- 3.415
10 E 0.760 7.853 +- 3.993
11 L 0.882 8.983 +- 3.059
12 L 0.790 8.130 +- 3.815
13 F 0.863 8.806 +- 3.250
14 A 0.825 8.458 +- 3.568
16 N 0.763 7.875 +- 3.979
17 T 0.808 8.302 +- 3.692
18 S 0.984* 9.929 +- 1.353
20 G 0.804 8.259 +- 3.724
21 V 0.996** 10.038 +- 0.927
22 T 0.986* 9.943 +- 1.309
23 S 0.995** 10.033 +- 0.953
24 P 0.854 8.725 +- 3.330
25 N 0.743 7.692 +- 4.083
26 E 0.899 9.144 +- 2.866
27 S 0.960* 9.704 +- 1.945
29 A 0.808 8.302 +- 3.692
30 N 0.743 7.690 +- 4.085
31 A 0.833 8.530 +- 3.509
32 A 0.784 8.070 +- 3.857
33 D 0.703 7.319 +- 4.263
34 D 0.995** 10.028 +- 0.976
35 L 0.939 9.514 +- 2.313
36 I 0.998** 10.053 +- 0.852
Model 8 vs 7 43.275480000000016
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 1.000** 998.673
2 L 0.977* 976.464
3 T 0.981* 979.534
4 D 1.000** 998.507
5 G 0.953* 951.871
9 P 0.971* 970.066
11 L 0.969* 967.662
13 F 0.978* 977.029
14 A 0.963* 962.517
17 T 0.952* 951.235
18 S 0.988* 986.993
20 G 0.968* 967.066
21 V 1.000** 998.760
22 T 0.999** 998.250
23 S 1.000** 998.736
24 P 0.958* 956.931
26 E 0.963* 961.733
27 S 0.986* 985.087
29 A 0.959* 958.110
31 A 0.950* 949.091
34 D 1.000** 998.592
35 L 0.978* 977.524
36 I 1.000** 998.890
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 0.995** 10.009 +- 0.994
2 L 0.990* 9.962 +- 1.187
3 T 0.975* 9.821 +- 1.638
4 D 0.992** 9.986 +- 1.095
5 G 0.872 8.849 +- 3.216
7 L 0.880 8.927 +- 3.129
9 P 0.901 9.129 +- 2.886
10 E 0.841 8.557 +- 3.501
11 L 0.926 9.365 +- 2.555
12 L 0.863 8.767 +- 3.300
13 F 0.914 9.244 +- 2.733
14 A 0.888 9.005 +- 3.040
16 N 0.843 8.574 +- 3.486
17 T 0.876 8.891 +- 3.170
18 S 0.992** 9.986 +- 1.092
20 G 0.873 8.861 +- 3.203
21 V 0.998** 10.040 +- 0.838
22 T 0.993** 9.992 +- 1.071
23 S 0.998** 10.037 +- 0.854
24 P 0.908 9.187 +- 2.811
25 N 0.828 8.433 +- 3.609
26 E 0.937 9.468 +- 2.388
27 S 0.978* 9.849 +- 1.560
29 A 0.876 8.891 +- 3.170
30 N 0.828 8.431 +- 3.611
31 A 0.893 9.050 +- 2.987
32 A 0.858 8.720 +- 3.347
33 D 0.797 8.138 +- 3.838
34 D 0.998** 10.035 +- 0.865
35 L 0.965* 9.729 +- 1.868
36 I 0.999** 10.047 +- 0.799
>C1
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
>C2
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
>C3
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
>C4
AHRRRTATRTAVRLSQQMLSITPAVRYRDQHQCRGDVTERIEGLQRGRRP
DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYR
PSDPLTTTRQSNPAPGANVRooo
>C5
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=139
C1 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
C2 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
C3 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
C4 AHRRRTATRTAVRLSQQML---------------SITPAVRYRDQHQCRG
C5 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
.* *.: :: :*..:* . ::.*.
C1 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C2 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C3 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C4 -DVTERIEGLQRGRRPDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C5 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
:.:: : * **********************************
C1 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
C2 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
C3 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
C4 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVRooo
C5 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 123 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 123 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5412]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5412]--->[3390]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.412 Mb, Max= 30.647 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
C2 LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
C3 LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
C4 ATRTAVRLSQQMLSITPAVRYRDQHQCRGDVTERIEGDGSVERAGLHRAT
C5 LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
.* *.: :::*..:* . ::.*.:.:: : **************
C1 SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C2 SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C3 SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C4 SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C5 SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
**************************************************
C1 APGANVR
C2 APGANVR
C3 APGANVR
C4 APGANVR
C5 APGANVR
*******
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:88 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 71.03 C1 C4 71.03
TOP 3 0 71.03 C4 C1 71.03
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 71.03 C2 C4 71.03
TOP 3 1 71.03 C4 C2 71.03
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 2 3 71.03 C3 C4 71.03
TOP 3 2 71.03 C4 C3 71.03
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 3 4 71.03 C4 C5 71.03
TOP 4 3 71.03 C5 C4 71.03
AVG 0 C1 * 92.76
AVG 1 C2 * 92.76
AVG 2 C3 * 92.76
AVG 3 C4 * 71.03
AVG 4 C5 * 92.76
TOT TOT * 88.41
CLUSTAL W (1.83) multiple sequence alignment
C1 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
C2 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
C3 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
C4 GCTCACCGACGGCGTACTGCTACCAGAACTGCTGTTCGGCTATCTCAACA
C5 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
. ** ... * **:* **** *: ***:
C1 GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
C2 GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
C3 GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
C4 AATGCTG-------------------------------------------
C5 GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
..** *
C1 CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
C2 CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
C3 CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
C4 --TCTATTACCCCAGCTGTTCGATACCGCGATCAACACCAGTGTCGGGGT
C5 CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
* ** *.*.*.. *** *. : . .:*...** *.* .***
C1 TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
C2 TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
C3 TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
C4 ---GACGTCACCGAACGAATCGAGGGCCTTCAACGCGGCCGACGACCTGA
C5 TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
.*** .****. ...* .: ** **
C1 TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C2 TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C3 TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C4 TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C5 TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
**************************************************
C1 AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C2 AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C3 AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C4 AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C5 AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
**************************************************
C1 CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C2 CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C3 CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C4 CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C5 CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
**************************************************
C1 GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C2 GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C3 GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C4 GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C5 GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
**************************************************
C1 ACGTCCGA---------
C2 ACGTCCGA---------
C3 ACGTCCGA---------
C4 ACGTCCGA---------
C5 ACGTCCGA---------
********
>C1
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C2
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C3
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C4
GCTCACCGACGGCGTACTGCTACCAGAACTGCTGTTCGGCTATCTCAACA
AATGCTG-------------------------------------------
--TCTATTACCCCAGCTGTTCGATACCGCGATCAACACCAGTGTCGGGGT
---GACGTCACCGAACGAATCGAGGGCCTTCAACGCGGCCGACGACCTGA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C5
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C1
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C2
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C3
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C4
AHRRRTATRTAVRLSQQMLoooooooooooooooSITPAVRYRDQHQCRG
oDVTERIEGLQRGRRPDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C5
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 417 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859508
Setting output file names to "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1782400282
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5257532557
Seed = 988282617
Swapseed = 1579859508
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 21 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 22 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1030.806956 -- -25.624409
Chain 2 -- -1030.699121 -- -25.624409
Chain 3 -- -1030.806970 -- -25.624409
Chain 4 -- -1030.806951 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1030.699121 -- -25.624409
Chain 2 -- -1030.806951 -- -25.624409
Chain 3 -- -1030.699121 -- -25.624409
Chain 4 -- -1030.806951 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1030.807] (-1030.699) (-1030.807) (-1030.807) * [-1030.699] (-1030.807) (-1030.699) (-1030.807)
500 -- (-798.902) (-811.517) (-803.965) [-799.850] * (-806.277) [-799.975] (-808.882) (-802.673) -- 0:00:00
1000 -- (-796.384) (-806.220) [-800.180] (-792.956) * (-793.931) (-798.382) [-792.822] (-803.503) -- 0:00:00
1500 -- (-797.090) (-800.892) (-801.258) [-795.846] * (-800.019) (-799.359) [-793.260] (-798.243) -- 0:00:00
2000 -- (-806.065) [-796.032] (-799.939) (-800.192) * (-801.272) (-793.697) (-791.896) [-794.034] -- 0:00:00
2500 -- (-799.809) [-794.952] (-803.089) (-797.681) * [-798.623] (-793.044) (-797.957) (-801.779) -- 0:00:00
3000 -- (-797.412) (-801.619) (-799.252) [-800.281] * (-794.927) (-797.401) [-791.675] (-795.627) -- 0:05:32
3500 -- (-796.119) (-797.997) (-796.583) [-797.342] * (-796.108) (-790.773) (-792.000) [-797.017] -- 0:04:44
4000 -- (-801.442) (-795.725) [-797.245] (-793.514) * (-798.508) [-797.703] (-795.738) (-803.620) -- 0:04:09
4500 -- (-812.939) (-795.632) (-796.582) [-798.223] * (-801.033) (-796.301) [-794.910] (-801.313) -- 0:03:41
5000 -- (-795.443) (-798.733) (-797.380) [-792.815] * (-794.932) [-792.222] (-795.201) (-791.871) -- 0:03:19
Average standard deviation of split frequencies: 0.087297
5500 -- (-796.858) (-797.547) (-799.961) [-792.906] * (-795.183) [-796.276] (-793.367) (-799.652) -- 0:03:00
6000 -- (-797.929) [-795.745] (-797.048) (-804.903) * (-795.996) [-798.814] (-795.763) (-805.170) -- 0:02:45
6500 -- (-799.840) (-792.128) [-797.880] (-807.965) * [-791.778] (-802.103) (-800.762) (-799.575) -- 0:02:32
7000 -- (-797.848) (-793.646) [-798.610] (-806.911) * [-795.477] (-794.572) (-804.908) (-793.583) -- 0:02:21
7500 -- (-796.995) (-796.121) [-796.980] (-805.225) * [-798.238] (-795.979) (-799.416) (-795.766) -- 0:02:12
8000 -- [-795.751] (-797.992) (-799.950) (-800.826) * [-791.412] (-793.307) (-799.178) (-802.299) -- 0:02:04
8500 -- (-798.409) [-796.490] (-793.516) (-796.996) * (-797.122) (-795.292) (-799.681) [-798.778] -- 0:01:56
9000 -- (-793.875) [-794.493] (-797.160) (-799.334) * [-794.002] (-796.331) (-806.188) (-795.414) -- 0:01:50
9500 -- (-796.338) (-797.416) [-791.481] (-796.484) * [-798.220] (-799.071) (-797.582) (-802.934) -- 0:01:44
10000 -- (-793.396) (-796.754) [-791.426] (-796.784) * (-794.245) [-797.386] (-794.850) (-796.666) -- 0:01:39
Average standard deviation of split frequencies: 0.123744
10500 -- [-797.607] (-797.086) (-797.873) (-794.049) * (-792.081) (-801.508) (-795.554) [-795.628] -- 0:01:34
11000 -- [-799.975] (-802.182) (-799.500) (-793.109) * (-798.479) (-792.560) [-796.198] (-795.722) -- 0:01:29
11500 -- [-797.358] (-793.739) (-803.167) (-794.389) * (-792.572) (-791.003) (-798.923) [-795.176] -- 0:02:51
12000 -- (-797.059) (-796.476) [-800.548] (-796.200) * (-794.309) (-796.141) [-793.448] (-796.761) -- 0:02:44
12500 -- [-795.607] (-794.518) (-799.612) (-801.699) * (-797.832) (-793.859) (-796.445) [-792.457] -- 0:02:38
13000 -- (-790.151) (-796.448) (-797.995) [-799.326] * (-802.007) [-796.224] (-800.607) (-796.241) -- 0:02:31
13500 -- [-794.747] (-794.276) (-801.398) (-806.361) * [-793.259] (-802.946) (-801.692) (-804.130) -- 0:02:26
14000 -- (-794.753) [-797.703] (-809.980) (-794.001) * (-797.425) (-799.141) [-806.264] (-800.386) -- 0:02:20
14500 -- (-792.802) [-802.367] (-799.603) (-795.825) * (-800.506) (-807.800) [-793.557] (-794.713) -- 0:02:15
15000 -- (-798.378) [-795.303] (-795.810) (-799.761) * (-797.771) [-802.660] (-793.887) (-799.867) -- 0:02:11
Average standard deviation of split frequencies: 0.094281
15500 -- (-796.192) (-795.874) [-797.374] (-800.466) * (-804.229) (-807.529) (-794.720) [-794.261] -- 0:02:07
16000 -- (-798.352) [-804.535] (-796.482) (-802.951) * [-792.234] (-798.043) (-799.382) (-794.594) -- 0:02:03
16500 -- (-792.709) (-793.200) (-804.586) [-794.528] * (-802.126) [-801.542] (-800.521) (-803.916) -- 0:01:59
17000 -- (-798.607) (-796.390) (-799.105) [-801.335] * (-799.890) [-795.581] (-800.337) (-802.607) -- 0:01:55
17500 -- (-804.370) (-795.399) [-794.271] (-797.983) * (-799.100) (-804.109) [-798.829] (-804.051) -- 0:01:52
18000 -- [-798.839] (-797.065) (-801.317) (-799.019) * [-794.376] (-796.995) (-794.504) (-806.306) -- 0:01:49
18500 -- [-794.486] (-800.296) (-799.166) (-798.340) * (-798.757) (-792.675) [-797.740] (-801.953) -- 0:01:46
19000 -- (-798.522) (-797.558) [-795.835] (-801.380) * (-799.280) [-796.474] (-796.250) (-793.281) -- 0:01:43
19500 -- (-797.343) (-802.792) [-798.105] (-798.032) * (-794.354) (-795.371) (-798.162) [-792.357] -- 0:01:40
20000 -- (-791.527) [-793.156] (-795.159) (-798.751) * [-797.737] (-799.541) (-799.812) (-797.966) -- 0:01:38
Average standard deviation of split frequencies: 0.054744
20500 -- (-798.497) (-797.858) (-795.595) [-793.546] * (-792.943) [-800.092] (-805.103) (-797.979) -- 0:02:23
21000 -- [-794.908] (-793.533) (-795.553) (-792.386) * (-801.144) (-809.018) (-803.292) [-800.380] -- 0:02:19
21500 -- [-796.703] (-803.580) (-805.975) (-801.697) * [-794.719] (-794.771) (-808.940) (-794.101) -- 0:02:16
22000 -- [-794.100] (-795.489) (-802.098) (-797.706) * (-796.375) [-797.838] (-798.247) (-801.970) -- 0:02:13
22500 -- (-796.955) [-802.829] (-796.254) (-803.932) * (-794.818) (-795.791) (-796.143) [-794.506] -- 0:02:10
23000 -- (-795.705) [-794.700] (-799.448) (-802.876) * (-797.836) [-797.377] (-796.942) (-793.177) -- 0:02:07
23500 -- (-792.403) (-797.852) [-793.815] (-800.197) * (-802.009) [-794.719] (-795.011) (-795.826) -- 0:02:04
24000 -- [-793.452] (-794.028) (-796.744) (-806.157) * [-802.369] (-800.007) (-793.303) (-795.190) -- 0:02:02
24500 -- (-803.157) (-798.929) [-798.906] (-796.856) * (-797.876) (-798.428) [-792.909] (-800.705) -- 0:01:59
25000 -- [-803.468] (-803.156) (-800.722) (-799.694) * [-800.587] (-793.115) (-793.905) (-791.520) -- 0:01:57
Average standard deviation of split frequencies: 0.050767
25500 -- [-799.921] (-803.799) (-798.166) (-801.401) * (-802.969) [-793.181] (-801.122) (-803.786) -- 0:01:54
26000 -- (-794.088) (-797.130) [-798.668] (-794.280) * (-799.202) [-796.667] (-802.834) (-801.833) -- 0:01:52
26500 -- (-799.747) [-797.713] (-795.497) (-794.944) * (-800.270) [-792.539] (-800.748) (-795.592) -- 0:01:50
27000 -- (-795.625) (-794.533) (-797.448) [-794.713] * (-797.516) [-802.232] (-795.880) (-795.619) -- 0:01:48
27500 -- (-793.692) (-799.628) (-803.090) [-793.223] * (-804.410) (-801.094) (-796.298) [-796.679] -- 0:01:46
28000 -- (-795.345) [-799.409] (-797.483) (-794.419) * [-801.338] (-793.659) (-798.767) (-796.058) -- 0:01:44
28500 -- (-801.016) [-793.421] (-791.848) (-794.438) * (-807.337) [-801.599] (-796.502) (-800.388) -- 0:01:42
29000 -- (-795.114) (-795.503) (-791.745) [-798.045] * [-792.037] (-805.818) (-799.734) (-794.283) -- 0:01:40
29500 -- (-795.026) (-804.035) (-801.452) [-792.647] * (-803.498) (-797.587) [-794.469] (-794.610) -- 0:02:11
30000 -- (-795.437) (-796.768) [-797.083] (-798.381) * (-802.128) [-799.501] (-803.793) (-798.664) -- 0:02:09
Average standard deviation of split frequencies: 0.052264
30500 -- (-799.498) (-797.335) (-797.855) [-797.549] * (-803.390) (-801.430) (-798.934) [-801.412] -- 0:02:07
31000 -- (-798.130) (-798.822) [-794.165] (-793.462) * [-800.960] (-796.625) (-796.235) (-803.283) -- 0:02:05
31500 -- (-802.193) (-798.172) [-793.958] (-796.487) * (-801.944) (-794.108) (-799.107) [-794.770] -- 0:02:02
32000 -- (-800.279) [-794.895] (-801.958) (-795.436) * [-801.591] (-806.256) (-806.655) (-802.393) -- 0:02:01
32500 -- (-798.209) (-795.336) [-791.894] (-801.523) * (-799.272) [-794.704] (-793.851) (-799.005) -- 0:01:59
33000 -- (-793.461) [-797.905] (-798.058) (-800.627) * (-803.953) [-793.363] (-797.628) (-802.276) -- 0:01:57
33500 -- (-798.258) (-808.360) (-796.244) [-793.808] * (-805.068) (-791.106) (-798.135) [-793.453] -- 0:01:55
34000 -- (-799.076) (-800.292) [-797.735] (-805.227) * (-800.291) (-797.686) [-799.424] (-793.539) -- 0:01:53
34500 -- (-796.647) (-802.282) (-796.040) [-792.822] * (-798.949) (-803.212) (-796.701) [-804.013] -- 0:01:51
35000 -- (-801.740) (-797.828) (-798.425) [-793.561] * (-797.845) (-794.531) [-798.907] (-795.203) -- 0:01:50
Average standard deviation of split frequencies: 0.049759
35500 -- (-798.103) (-798.731) [-791.788] (-799.458) * (-795.378) (-800.374) (-805.803) [-793.826] -- 0:01:48
36000 -- (-797.037) (-792.059) [-794.228] (-796.759) * (-791.534) (-794.243) [-802.458] (-796.621) -- 0:01:47
36500 -- (-799.589) (-798.031) [-793.871] (-796.204) * (-798.916) (-796.452) (-803.873) [-801.889] -- 0:01:45
37000 -- (-793.255) (-794.426) (-794.931) [-792.501] * (-797.868) (-803.869) (-799.974) [-792.234] -- 0:01:44
37500 -- (-799.671) (-792.608) (-798.526) [-798.264] * (-798.519) (-797.635) [-791.803] (-792.605) -- 0:01:42
38000 -- (-803.066) [-798.527] (-794.118) (-797.162) * (-797.479) (-801.466) (-798.080) [-796.204] -- 0:02:06
38500 -- [-796.935] (-794.757) (-801.705) (-798.293) * (-795.612) (-799.376) (-794.077) [-798.583] -- 0:02:04
39000 -- (-808.414) (-797.500) (-794.314) [-795.238] * [-794.825] (-797.430) (-798.438) (-795.546) -- 0:02:03
39500 -- (-794.024) [-794.886] (-799.338) (-801.221) * [-799.543] (-798.225) (-796.382) (-794.696) -- 0:02:01
40000 -- (-798.226) (-799.881) [-791.128] (-795.163) * (-801.086) (-800.504) (-794.642) [-803.252] -- 0:02:00
Average standard deviation of split frequencies: 0.027821
40500 -- (-796.887) (-793.101) [-794.928] (-796.946) * (-802.601) (-796.977) [-796.880] (-799.561) -- 0:01:58
41000 -- (-797.396) (-795.150) [-792.293] (-795.619) * (-795.485) (-797.451) (-803.504) [-795.435] -- 0:01:56
41500 -- [-797.179] (-793.033) (-797.574) (-793.191) * (-799.431) [-793.794] (-802.485) (-796.761) -- 0:01:55
42000 -- [-793.776] (-797.481) (-798.084) (-796.691) * (-797.562) [-794.035] (-798.212) (-794.520) -- 0:01:54
42500 -- (-793.400) [-796.508] (-805.779) (-796.695) * (-799.616) (-800.455) [-796.853] (-803.022) -- 0:01:52
43000 -- (-797.346) (-797.847) (-795.798) [-794.844] * [-798.472] (-799.457) (-800.153) (-795.580) -- 0:01:51
43500 -- [-796.517] (-798.323) (-795.432) (-799.087) * (-792.416) [-797.741] (-794.955) (-805.283) -- 0:01:49
44000 -- (-795.286) [-794.354] (-793.423) (-800.334) * (-799.887) (-794.635) [-797.165] (-799.519) -- 0:01:48
44500 -- [-796.785] (-795.886) (-797.717) (-794.610) * (-796.082) (-803.589) (-797.245) [-801.001] -- 0:01:47
45000 -- (-794.582) (-794.207) [-793.218] (-797.688) * (-802.926) (-804.385) (-798.186) [-793.357] -- 0:01:46
Average standard deviation of split frequencies: 0.032793
45500 -- (-801.779) (-792.886) [-796.740] (-799.309) * (-801.312) (-793.987) [-795.978] (-803.775) -- 0:01:44
46000 -- (-795.552) (-797.087) (-794.294) [-793.959] * (-793.819) (-806.286) (-797.781) [-795.183] -- 0:01:43
46500 -- (-797.218) (-803.173) (-797.348) [-797.993] * (-794.330) (-799.047) (-802.312) [-797.913] -- 0:01:42
47000 -- [-793.525] (-795.278) (-797.740) (-799.868) * (-804.263) (-796.496) (-793.709) [-800.193] -- 0:02:01
47500 -- (-802.173) [-796.008] (-796.481) (-794.561) * (-795.574) [-798.742] (-791.969) (-796.034) -- 0:02:00
48000 -- (-797.061) (-795.295) (-797.738) [-795.882] * (-803.420) (-796.414) [-792.957] (-802.742) -- 0:01:59
48500 -- (-793.370) (-794.218) [-802.455] (-799.138) * (-792.763) [-795.592] (-792.856) (-797.743) -- 0:01:57
49000 -- [-794.348] (-796.746) (-797.419) (-796.443) * [-796.078] (-793.252) (-807.936) (-798.587) -- 0:01:56
49500 -- [-797.591] (-798.917) (-794.216) (-801.153) * [-794.915] (-800.230) (-797.127) (-793.778) -- 0:01:55
50000 -- (-797.720) [-793.153] (-804.098) (-794.797) * (-801.190) [-792.082] (-793.875) (-796.980) -- 0:01:54
Average standard deviation of split frequencies: 0.035355
50500 -- (-797.578) (-796.402) [-800.167] (-800.544) * [-800.565] (-795.223) (-795.966) (-804.386) -- 0:01:52
51000 -- (-801.096) (-794.464) (-801.551) [-795.754] * (-794.578) [-794.143] (-797.246) (-797.801) -- 0:01:51
51500 -- (-798.237) (-799.784) (-799.199) [-795.132] * [-792.648] (-797.454) (-803.995) (-802.434) -- 0:01:50
52000 -- (-802.480) (-796.541) [-792.391] (-802.195) * (-795.010) [-794.707] (-794.115) (-798.501) -- 0:01:49
52500 -- (-796.798) [-793.441] (-806.560) (-798.174) * (-802.498) [-799.577] (-795.803) (-795.926) -- 0:01:48
53000 -- (-799.669) [-794.326] (-798.369) (-798.103) * (-797.202) (-796.307) (-797.852) [-794.176] -- 0:01:47
53500 -- [-804.167] (-803.394) (-798.130) (-796.175) * (-793.662) [-794.384] (-795.738) (-793.234) -- 0:01:46
54000 -- (-798.329) (-804.937) (-798.517) [-798.642] * (-797.966) [-795.906] (-798.047) (-793.810) -- 0:01:45
54500 -- [-798.957] (-798.866) (-799.968) (-794.179) * (-802.597) [-793.193] (-796.306) (-799.059) -- 0:01:44
55000 -- (-801.728) [-794.469] (-803.162) (-803.384) * [-798.231] (-791.985) (-797.035) (-798.597) -- 0:01:43
Average standard deviation of split frequencies: 0.040406
55500 -- (-797.738) (-799.775) (-804.761) [-797.572] * [-799.616] (-801.153) (-792.443) (-802.709) -- 0:01:42
56000 -- (-797.062) (-794.315) [-796.821] (-803.534) * (-804.141) (-792.124) (-794.064) [-798.770] -- 0:01:58
56500 -- (-806.048) (-795.742) [-796.308] (-800.315) * (-792.211) [-796.947] (-796.404) (-798.879) -- 0:01:56
57000 -- (-795.943) (-797.191) [-797.473] (-810.471) * (-793.854) (-797.911) [-798.430] (-794.915) -- 0:01:55
57500 -- (-793.668) (-793.054) [-793.628] (-795.736) * (-795.247) (-797.551) (-801.792) [-794.333] -- 0:01:54
58000 -- (-798.535) (-794.853) [-793.595] (-793.115) * (-803.449) (-799.811) (-799.935) [-796.155] -- 0:01:53
58500 -- [-793.494] (-805.958) (-795.454) (-799.351) * (-797.889) (-797.405) [-798.340] (-797.204) -- 0:01:52
59000 -- [-795.666] (-790.822) (-799.048) (-801.002) * (-796.260) (-792.713) (-801.233) [-795.923] -- 0:01:51
59500 -- (-799.752) [-795.597] (-799.442) (-793.720) * (-799.289) [-789.873] (-796.156) (-800.260) -- 0:01:50
60000 -- (-799.226) [-794.253] (-803.504) (-791.991) * (-806.531) [-797.588] (-793.799) (-798.875) -- 0:01:49
Average standard deviation of split frequencies: 0.032636
60500 -- (-799.067) (-797.958) [-799.536] (-797.619) * (-799.445) (-793.070) [-791.159] (-800.165) -- 0:01:48
61000 -- [-792.505] (-800.554) (-796.744) (-797.014) * (-795.764) (-797.108) [-799.830] (-794.603) -- 0:01:47
61500 -- (-800.376) (-798.015) [-799.290] (-798.376) * [-797.052] (-799.959) (-795.921) (-804.595) -- 0:01:46
62000 -- (-804.828) (-799.294) [-799.230] (-796.026) * (-794.411) (-796.977) [-796.185] (-803.416) -- 0:01:45
62500 -- (-801.842) (-794.750) (-799.391) [-795.600] * (-792.552) (-795.195) [-795.069] (-796.171) -- 0:01:45
63000 -- (-806.656) (-794.299) (-801.949) [-798.981] * [-796.158] (-800.759) (-794.317) (-797.076) -- 0:01:44
63500 -- (-799.787) [-797.321] (-798.070) (-804.412) * (-796.209) (-801.897) [-794.859] (-801.683) -- 0:01:43
64000 -- (-803.978) (-800.119) [-797.853] (-797.748) * (-797.268) (-805.636) (-798.933) [-797.251] -- 0:01:42
64500 -- (-805.440) [-792.385] (-797.357) (-798.315) * (-800.619) (-799.378) (-794.504) [-794.145] -- 0:01:41
65000 -- (-793.568) (-799.061) [-797.188] (-799.621) * (-799.846) (-806.057) [-796.333] (-794.666) -- 0:01:40
Average standard deviation of split frequencies: 0.021427
65500 -- (-793.029) (-798.298) (-807.198) [-799.200] * [-796.373] (-794.129) (-798.251) (-798.222) -- 0:01:54
66000 -- (-793.794) [-795.032] (-797.471) (-797.454) * (-794.231) (-809.440) [-799.163] (-795.129) -- 0:01:53
66500 -- [-795.231] (-793.570) (-799.978) (-796.923) * [-795.029] (-801.844) (-805.271) (-801.064) -- 0:01:52
67000 -- [-796.108] (-802.578) (-800.955) (-797.083) * [-795.984] (-799.471) (-799.347) (-795.014) -- 0:01:51
67500 -- (-798.371) [-792.631] (-794.177) (-801.386) * (-797.888) (-795.291) (-797.259) [-792.871] -- 0:01:50
68000 -- (-796.244) [-793.894] (-797.120) (-797.487) * [-791.124] (-804.023) (-801.288) (-796.044) -- 0:01:49
68500 -- (-793.914) (-798.352) (-799.812) [-799.313] * [-798.543] (-794.853) (-801.048) (-799.867) -- 0:01:48
69000 -- (-795.615) (-800.509) (-803.143) [-793.564] * [-792.334] (-800.719) (-801.276) (-799.514) -- 0:01:47
69500 -- (-800.353) [-796.828] (-799.489) (-802.903) * (-792.440) (-795.885) [-803.307] (-801.904) -- 0:01:47
70000 -- (-796.636) [-805.096] (-807.695) (-805.791) * (-801.658) (-796.238) [-797.858] (-802.124) -- 0:01:46
Average standard deviation of split frequencies: 0.024015
70500 -- (-798.246) [-796.686] (-806.019) (-803.943) * (-805.837) (-797.722) (-815.699) [-802.217] -- 0:01:45
71000 -- [-798.784] (-796.036) (-802.118) (-795.713) * (-791.068) [-793.702] (-802.617) (-797.490) -- 0:01:44
71500 -- (-800.564) (-801.659) (-797.697) [-798.083] * (-792.140) [-796.478] (-808.094) (-805.098) -- 0:01:43
72000 -- (-802.206) (-794.495) [-801.132] (-804.429) * [-794.686] (-812.123) (-802.856) (-799.267) -- 0:01:43
72500 -- (-796.247) (-797.122) (-808.051) [-798.725] * (-796.941) (-794.512) (-800.390) [-797.083] -- 0:01:42
73000 -- (-803.336) (-797.677) (-796.377) [-793.789] * [-796.623] (-795.424) (-794.816) (-796.547) -- 0:01:41
73500 -- (-796.112) (-796.612) (-799.648) [-796.594] * (-797.538) (-798.998) (-804.299) [-793.881] -- 0:01:40
74000 -- (-800.458) [-795.538] (-796.759) (-798.723) * (-801.561) (-794.014) [-794.742] (-798.229) -- 0:01:40
74500 -- (-801.429) (-797.684) (-800.499) [-798.167] * (-798.989) (-807.211) (-800.303) [-800.554] -- 0:01:51
75000 -- (-800.962) (-795.925) [-802.267] (-801.225) * [-794.363] (-796.866) (-800.334) (-798.821) -- 0:01:51
Average standard deviation of split frequencies: 0.013646
75500 -- (-797.770) (-796.156) (-802.418) [-797.582] * (-794.281) [-806.507] (-799.672) (-805.453) -- 0:01:50
76000 -- (-798.804) (-793.663) [-799.349] (-797.756) * (-793.859) (-796.268) (-796.386) [-795.151] -- 0:01:49
76500 -- (-797.257) [-792.848] (-798.745) (-799.165) * [-796.810] (-796.969) (-798.025) (-798.143) -- 0:01:48
77000 -- (-810.387) (-798.780) [-804.012] (-797.050) * (-794.251) [-795.703] (-794.443) (-797.614) -- 0:01:47
77500 -- [-805.033] (-793.644) (-798.074) (-803.514) * (-795.439) [-802.149] (-807.897) (-796.119) -- 0:01:47
78000 -- (-798.019) (-794.136) [-794.892] (-792.480) * (-793.397) (-800.031) [-797.213] (-796.557) -- 0:01:46
78500 -- [-797.381] (-797.579) (-795.074) (-796.526) * [-791.129] (-806.105) (-795.452) (-792.675) -- 0:01:45
79000 -- (-795.361) [-794.504] (-793.783) (-801.213) * [-798.316] (-800.320) (-793.846) (-795.777) -- 0:01:44
79500 -- (-795.473) (-794.289) (-795.338) [-792.964] * (-797.898) (-794.192) (-795.666) [-795.147] -- 0:01:44
80000 -- [-791.922] (-790.005) (-795.807) (-801.681) * (-796.982) (-796.994) (-795.657) [-799.717] -- 0:01:43
Average standard deviation of split frequencies: 0.017532
80500 -- (-803.271) [-794.822] (-798.729) (-800.515) * (-802.203) (-797.638) (-806.083) [-802.164] -- 0:01:42
81000 -- (-801.696) [-795.906] (-797.183) (-792.926) * (-799.158) (-807.175) [-798.834] (-795.287) -- 0:01:42
81500 -- (-792.237) (-794.325) [-792.110] (-801.746) * (-798.268) [-792.341] (-798.565) (-798.034) -- 0:01:41
82000 -- [-794.327] (-805.718) (-793.632) (-800.224) * (-810.793) [-792.905] (-797.331) (-802.975) -- 0:01:40
82500 -- (-796.905) (-803.077) [-800.191] (-804.468) * (-798.940) (-796.147) (-797.006) [-796.389] -- 0:01:40
83000 -- (-797.993) [-793.880] (-803.728) (-798.885) * (-796.263) (-796.557) (-804.731) [-795.671] -- 0:01:39
83500 -- [-796.422] (-797.118) (-799.916) (-803.689) * (-801.473) [-798.246] (-801.434) (-801.559) -- 0:01:49
84000 -- (-798.089) (-799.934) [-795.726] (-799.270) * (-794.063) (-793.589) (-792.968) [-794.048] -- 0:01:49
84500 -- (-798.932) (-792.373) [-800.876] (-799.307) * (-813.938) (-797.957) (-805.651) [-793.143] -- 0:01:48
85000 -- [-795.984] (-795.305) (-797.289) (-797.278) * (-797.168) (-801.658) (-814.625) [-797.860] -- 0:01:47
Average standard deviation of split frequencies: 0.013155
85500 -- [-805.000] (-798.191) (-796.424) (-796.078) * [-799.889] (-797.417) (-797.262) (-795.916) -- 0:01:46
86000 -- (-793.370) [-796.870] (-794.948) (-795.096) * (-811.687) [-794.848] (-800.457) (-798.797) -- 0:01:46
86500 -- [-795.004] (-800.858) (-791.911) (-799.565) * (-807.714) (-800.750) [-795.924] (-792.700) -- 0:01:45
87000 -- (-797.474) (-799.929) [-792.491] (-803.669) * [-796.594] (-798.242) (-795.358) (-799.319) -- 0:01:44
87500 -- (-797.281) (-800.800) [-795.142] (-794.709) * (-794.772) [-800.392] (-803.480) (-798.809) -- 0:01:44
88000 -- (-808.902) [-795.186] (-796.202) (-795.937) * (-803.198) (-794.730) (-795.680) [-796.654] -- 0:01:43
88500 -- (-792.721) [-795.061] (-791.579) (-793.012) * (-792.119) (-792.229) [-796.257] (-798.468) -- 0:01:42
89000 -- (-798.697) (-799.454) [-799.795] (-795.416) * (-794.934) (-795.382) [-792.676] (-798.449) -- 0:01:42
89500 -- (-802.640) (-800.822) [-796.498] (-794.978) * (-799.900) (-794.557) [-798.486] (-793.200) -- 0:01:41
90000 -- (-801.636) [-802.914] (-797.047) (-797.943) * (-799.909) (-797.452) [-795.741] (-796.215) -- 0:01:41
Average standard deviation of split frequencies: 0.010399
90500 -- (-802.858) (-798.202) (-797.820) [-790.178] * (-797.347) [-793.490] (-805.338) (-792.746) -- 0:01:40
91000 -- (-799.947) (-800.250) (-795.627) [-793.852] * (-797.097) (-796.653) (-799.571) [-795.811] -- 0:01:39
91500 -- [-793.431] (-801.182) (-798.107) (-803.835) * (-796.177) (-793.595) (-798.256) [-801.092] -- 0:01:39
92000 -- (-796.696) [-798.074] (-796.936) (-796.539) * (-793.988) (-796.110) (-795.854) [-795.550] -- 0:01:38
92500 -- (-792.068) (-797.724) (-797.232) [-795.110] * (-799.790) [-797.189] (-802.642) (-792.626) -- 0:01:47
93000 -- (-793.995) (-806.213) [-792.672] (-796.976) * (-794.373) (-801.024) [-801.735] (-795.436) -- 0:01:47
93500 -- (-793.579) [-798.629] (-800.130) (-797.036) * [-795.319] (-800.346) (-802.191) (-798.144) -- 0:01:46
94000 -- (-796.474) (-797.796) [-792.342] (-795.528) * [-791.984] (-798.541) (-799.135) (-799.365) -- 0:01:46
94500 -- (-801.845) [-795.246] (-794.317) (-804.119) * (-794.232) [-796.792] (-799.963) (-803.956) -- 0:01:45
95000 -- (-797.107) (-798.800) [-791.327] (-796.644) * (-795.416) (-794.951) (-799.880) [-796.668] -- 0:01:44
Average standard deviation of split frequencies: 0.013749
95500 -- (-801.170) (-805.005) (-793.883) [-797.499] * (-793.302) (-793.936) [-794.263] (-798.729) -- 0:01:44
96000 -- (-800.681) (-796.336) [-793.898] (-799.673) * (-791.474) (-806.717) [-799.329] (-804.039) -- 0:01:43
96500 -- (-798.517) (-797.151) [-799.965] (-796.812) * (-791.042) (-802.559) [-795.200] (-797.832) -- 0:01:42
97000 -- (-792.423) [-797.064] (-796.931) (-797.540) * (-793.741) [-801.725] (-796.885) (-793.463) -- 0:01:42
97500 -- (-799.125) (-798.420) [-791.516] (-793.052) * [-796.546] (-802.129) (-804.120) (-804.159) -- 0:01:41
98000 -- (-796.785) (-805.744) (-794.035) [-796.405] * [-797.743] (-801.368) (-804.266) (-798.988) -- 0:01:41
98500 -- [-792.472] (-793.047) (-798.572) (-798.200) * (-797.586) (-799.816) (-803.426) [-794.941] -- 0:01:40
99000 -- [-794.880] (-798.449) (-798.238) (-795.971) * (-795.320) (-803.586) [-793.894] (-800.919) -- 0:01:40
99500 -- (-795.786) (-794.664) [-801.326] (-797.554) * (-802.232) [-796.183] (-793.904) (-797.867) -- 0:01:39
100000 -- (-793.093) [-803.178] (-803.142) (-804.139) * (-794.700) (-799.053) (-794.376) [-798.471] -- 0:01:39
Average standard deviation of split frequencies: 0.009366
100500 -- (-795.721) [-794.899] (-798.525) (-799.347) * (-797.945) [-798.712] (-793.830) (-798.759) -- 0:01:38
101000 -- [-794.179] (-795.009) (-799.274) (-802.228) * [-792.285] (-800.395) (-798.918) (-797.560) -- 0:01:37
101500 -- [-797.147] (-802.141) (-794.199) (-793.452) * (-798.828) [-794.405] (-796.719) (-795.076) -- 0:01:46
102000 -- (-797.412) [-801.759] (-795.394) (-798.769) * [-799.706] (-801.910) (-797.658) (-795.489) -- 0:01:45
102500 -- (-801.839) [-801.013] (-793.838) (-798.958) * [-793.464] (-802.581) (-796.113) (-794.381) -- 0:01:45
103000 -- [-797.920] (-793.767) (-796.221) (-794.506) * [-793.530] (-800.986) (-801.862) (-801.030) -- 0:01:44
103500 -- (-802.475) (-801.855) [-797.572] (-798.348) * (-800.254) (-801.863) (-800.009) [-789.509] -- 0:01:43
104000 -- (-804.724) (-800.903) [-795.408] (-798.257) * (-799.258) [-792.418] (-800.817) (-794.163) -- 0:01:43
104500 -- (-798.258) (-796.274) [-794.266] (-804.087) * [-801.471] (-802.631) (-806.000) (-798.010) -- 0:01:42
105000 -- (-795.363) [-795.422] (-799.999) (-798.761) * (-794.106) (-813.359) [-794.801] (-798.875) -- 0:01:42
Average standard deviation of split frequencies: 0.011563
105500 -- (-797.580) [-795.582] (-801.490) (-796.375) * (-797.849) (-800.934) [-792.046] (-800.138) -- 0:01:41
106000 -- (-797.055) (-804.741) [-801.549] (-797.420) * (-804.117) (-800.230) [-792.820] (-801.334) -- 0:01:41
106500 -- (-796.245) (-799.736) (-796.411) [-799.726] * [-796.843] (-797.893) (-795.442) (-796.437) -- 0:01:40
107000 -- (-797.190) (-799.248) (-799.730) [-792.860] * (-794.645) [-797.102] (-795.988) (-802.152) -- 0:01:40
107500 -- (-794.956) (-796.298) [-799.707] (-800.256) * (-796.901) [-802.544] (-792.986) (-798.431) -- 0:01:39
108000 -- (-793.270) (-799.476) (-802.414) [-796.648] * (-815.862) (-795.264) (-793.893) [-798.765] -- 0:01:39
108500 -- (-795.942) [-793.787] (-803.534) (-797.755) * [-792.801] (-797.301) (-806.914) (-798.400) -- 0:01:38
109000 -- (-795.344) (-793.006) [-797.002] (-799.459) * (-795.322) (-800.986) (-802.539) [-794.229] -- 0:01:38
109500 -- (-795.760) (-800.980) [-794.696] (-795.777) * (-795.893) [-796.887] (-799.357) (-795.259) -- 0:01:37
110000 -- (-796.417) [-791.626] (-792.174) (-796.377) * [-798.999] (-797.391) (-807.904) (-796.867) -- 0:01:37
Average standard deviation of split frequencies: 0.011075
110500 -- (-799.846) (-797.718) [-793.524] (-796.159) * (-799.122) (-793.974) [-796.065] (-795.245) -- 0:01:44
111000 -- (-801.408) [-797.157] (-801.205) (-799.466) * (-794.243) (-799.499) [-795.283] (-803.748) -- 0:01:44
111500 -- (-800.693) (-799.662) (-796.392) [-795.373] * (-805.111) (-802.603) [-793.666] (-797.029) -- 0:01:43
112000 -- (-793.456) (-806.165) (-791.648) [-792.988] * (-793.858) [-791.703] (-801.587) (-793.968) -- 0:01:43
112500 -- (-796.184) (-801.377) [-796.901] (-795.630) * (-796.899) (-794.033) (-798.091) [-800.242] -- 0:01:42
113000 -- [-800.180] (-798.973) (-793.470) (-797.432) * (-807.711) (-798.036) [-795.899] (-796.310) -- 0:01:42
113500 -- (-796.814) (-801.649) (-796.463) [-801.440] * [-794.143] (-793.307) (-797.524) (-804.448) -- 0:01:41
114000 -- (-797.326) (-796.085) (-797.177) [-791.583] * (-801.036) (-797.554) (-804.375) [-800.569] -- 0:01:41
114500 -- (-799.687) [-794.448] (-794.108) (-791.803) * (-796.659) (-799.686) (-802.059) [-801.467] -- 0:01:40
115000 -- (-797.522) (-803.147) [-791.516] (-791.755) * (-801.536) [-796.062] (-801.726) (-798.310) -- 0:01:40
Average standard deviation of split frequencies: 0.008128
115500 -- (-796.649) (-793.880) [-793.921] (-795.558) * (-801.641) [-797.169] (-794.723) (-796.423) -- 0:01:39
116000 -- (-800.709) (-796.219) (-795.176) [-794.414] * [-796.025] (-797.296) (-799.829) (-800.742) -- 0:01:39
116500 -- [-797.602] (-793.550) (-793.970) (-795.905) * (-799.198) [-794.236] (-799.652) (-797.956) -- 0:01:38
117000 -- (-798.753) [-795.865] (-799.329) (-795.662) * (-796.002) [-792.936] (-800.276) (-800.042) -- 0:01:38
117500 -- (-801.573) (-800.271) (-802.550) [-801.711] * (-810.933) (-800.727) (-803.215) [-799.103] -- 0:01:37
118000 -- [-798.291] (-797.721) (-801.006) (-802.043) * [-796.327] (-798.169) (-794.027) (-797.129) -- 0:01:37
118500 -- (-790.078) (-795.458) [-795.783] (-795.551) * [-796.304] (-793.952) (-796.138) (-805.161) -- 0:01:36
119000 -- [-797.306] (-796.560) (-794.954) (-796.585) * (-795.836) (-795.677) [-799.399] (-797.458) -- 0:01:36
119500 -- [-803.593] (-799.332) (-799.986) (-797.066) * (-790.771) [-793.221] (-794.182) (-793.615) -- 0:01:43
120000 -- (-796.335) (-802.152) (-796.242) [-796.318] * (-794.208) (-797.357) [-796.858] (-800.591) -- 0:01:42
Average standard deviation of split frequencies: 0.009376
120500 -- (-797.564) (-798.723) [-797.980] (-803.634) * (-795.745) (-799.565) [-801.080] (-797.599) -- 0:01:42
121000 -- [-798.428] (-794.638) (-798.688) (-791.354) * [-796.728] (-798.995) (-797.333) (-801.068) -- 0:01:41
121500 -- (-799.735) [-797.386] (-795.100) (-795.078) * (-796.792) [-797.748] (-794.679) (-797.263) -- 0:01:41
122000 -- (-793.922) [-795.088] (-795.794) (-799.228) * (-797.562) (-795.832) [-797.368] (-796.215) -- 0:01:40
122500 -- [-800.448] (-801.327) (-794.965) (-799.288) * (-799.685) (-798.674) [-796.109] (-805.851) -- 0:01:40
123000 -- (-796.983) [-792.090] (-794.435) (-799.685) * (-795.426) (-801.971) [-794.094] (-798.426) -- 0:01:39
123500 -- [-798.620] (-796.971) (-794.717) (-800.108) * [-794.628] (-800.455) (-797.574) (-795.343) -- 0:01:39
124000 -- [-795.689] (-794.286) (-795.825) (-800.321) * (-795.763) [-797.733] (-802.338) (-794.745) -- 0:01:38
124500 -- [-799.729] (-801.362) (-798.996) (-799.424) * (-794.995) (-795.547) (-804.600) [-795.705] -- 0:01:38
125000 -- (-800.031) (-795.387) [-795.307] (-799.450) * (-793.437) [-796.563] (-799.841) (-799.137) -- 0:01:38
Average standard deviation of split frequencies: 0.011224
125500 -- (-794.865) (-792.412) [-794.117] (-806.001) * (-794.074) [-793.810] (-794.750) (-811.254) -- 0:01:37
126000 -- [-795.546] (-798.492) (-793.786) (-801.330) * (-793.136) (-795.497) (-800.770) [-801.018] -- 0:01:37
126500 -- (-797.806) (-800.216) [-793.624] (-802.051) * (-799.595) (-801.007) (-801.133) [-796.875] -- 0:01:36
127000 -- (-798.158) [-798.482] (-798.083) (-799.884) * (-797.779) (-793.974) [-793.870] (-798.299) -- 0:01:36
127500 -- (-803.402) (-800.912) [-801.292] (-794.786) * (-802.098) (-799.968) (-801.957) [-803.603] -- 0:01:35
128000 -- (-796.856) [-794.869] (-799.655) (-798.105) * [-799.307] (-800.589) (-798.838) (-796.200) -- 0:01:35
128500 -- (-798.255) (-802.300) (-802.842) [-794.801] * [-796.111] (-799.902) (-802.146) (-801.751) -- 0:01:41
129000 -- (-794.514) (-796.843) (-797.831) [-792.524] * (-796.674) (-796.889) [-802.265] (-798.995) -- 0:01:41
129500 -- (-797.928) [-797.377] (-796.409) (-796.711) * (-794.613) (-791.551) (-799.263) [-801.119] -- 0:01:40
130000 -- (-809.703) [-788.702] (-806.623) (-796.648) * (-797.302) [-793.177] (-797.360) (-797.381) -- 0:01:40
Average standard deviation of split frequencies: 0.010823
130500 -- (-802.377) (-797.274) [-797.171] (-797.528) * [-795.447] (-799.265) (-802.053) (-799.124) -- 0:01:39
131000 -- (-794.699) (-793.556) (-796.851) [-797.043] * (-797.910) (-799.338) [-798.497] (-800.869) -- 0:01:39
131500 -- [-793.212] (-806.198) (-802.713) (-805.956) * (-802.227) [-799.381] (-798.180) (-802.157) -- 0:01:39
132000 -- (-795.760) [-796.409] (-802.117) (-790.740) * (-799.372) (-805.492) (-799.111) [-797.977] -- 0:01:38
132500 -- (-797.962) (-801.831) [-798.326] (-793.284) * (-806.896) [-795.054] (-802.983) (-803.711) -- 0:01:38
133000 -- [-796.275] (-797.587) (-802.325) (-798.055) * (-802.460) (-795.128) (-801.322) [-792.410] -- 0:01:37
133500 -- (-804.168) [-799.449] (-792.542) (-798.017) * (-796.736) [-795.516] (-805.909) (-796.202) -- 0:01:37
134000 -- [-797.121] (-800.090) (-800.813) (-793.989) * (-800.901) (-802.540) [-808.581] (-797.360) -- 0:01:36
134500 -- [-791.830] (-794.946) (-800.557) (-796.858) * (-797.698) [-793.308] (-804.700) (-797.549) -- 0:01:36
135000 -- (-795.847) (-794.119) (-797.209) [-801.561] * (-795.752) [-798.970] (-794.753) (-798.362) -- 0:01:36
Average standard deviation of split frequencies: 0.009705
135500 -- [-800.723] (-795.028) (-800.498) (-802.259) * [-796.489] (-797.818) (-807.750) (-800.330) -- 0:01:35
136000 -- (-795.296) [-799.370] (-800.731) (-789.595) * [-794.495] (-796.139) (-799.238) (-795.111) -- 0:01:35
136500 -- [-797.408] (-802.281) (-790.342) (-801.251) * (-795.826) [-796.120] (-807.953) (-795.072) -- 0:01:34
137000 -- (-795.125) (-797.737) [-793.260] (-794.461) * [-800.155] (-797.856) (-798.640) (-803.571) -- 0:01:34
137500 -- (-802.654) (-804.136) [-796.074] (-793.255) * [-792.465] (-795.150) (-795.200) (-796.504) -- 0:01:40
138000 -- [-797.105] (-795.740) (-798.018) (-803.275) * [-797.393] (-795.500) (-801.871) (-795.065) -- 0:01:39
138500 -- (-798.540) (-800.045) (-804.402) [-798.450] * (-796.266) [-791.106] (-799.668) (-797.772) -- 0:01:39
139000 -- (-798.654) (-799.808) [-796.368] (-796.927) * (-802.457) [-794.450] (-800.207) (-801.880) -- 0:01:39
139500 -- [-794.960] (-801.659) (-794.345) (-794.127) * (-802.483) [-795.162] (-803.892) (-794.819) -- 0:01:38
140000 -- [-798.421] (-799.363) (-792.735) (-802.355) * (-796.989) [-794.775] (-800.545) (-798.164) -- 0:01:38
Average standard deviation of split frequencies: 0.007373
140500 -- (-796.492) (-798.800) [-793.575] (-804.952) * [-793.922] (-805.950) (-806.023) (-800.974) -- 0:01:37
141000 -- (-793.318) (-800.496) (-800.759) [-798.800] * (-798.276) [-797.407] (-806.152) (-793.518) -- 0:01:37
141500 -- (-799.669) (-797.299) [-797.754] (-795.488) * (-797.359) (-799.432) [-797.000] (-799.838) -- 0:01:37
142000 -- [-799.741] (-800.322) (-798.523) (-795.706) * (-792.309) (-801.992) (-797.323) [-793.727] -- 0:01:36
142500 -- (-798.790) (-798.160) [-795.016] (-797.911) * (-795.224) (-795.090) [-797.042] (-795.737) -- 0:01:36
143000 -- (-804.656) [-797.026] (-793.899) (-800.521) * (-800.025) (-795.105) [-797.100] (-802.702) -- 0:01:35
143500 -- (-793.628) [-796.182] (-795.558) (-797.995) * (-805.245) (-798.646) (-794.638) [-792.008] -- 0:01:35
144000 -- (-793.772) (-797.270) [-794.699] (-799.540) * (-797.965) [-801.648] (-793.677) (-799.526) -- 0:01:35
144500 -- (-802.084) (-796.910) (-790.886) [-794.760] * (-794.762) (-801.769) [-793.846] (-800.149) -- 0:01:34
145000 -- [-795.351] (-798.183) (-798.819) (-796.023) * (-793.243) [-802.626] (-798.273) (-794.878) -- 0:01:34
Average standard deviation of split frequencies: 0.008395
145500 -- (-802.172) [-802.832] (-796.178) (-800.228) * [-799.135] (-796.856) (-798.958) (-797.001) -- 0:01:33
146000 -- (-796.576) (-794.818) [-793.404] (-794.699) * (-796.441) (-798.137) (-801.607) [-793.343] -- 0:01:39
146500 -- [-798.862] (-798.894) (-797.484) (-797.089) * (-796.531) [-801.373] (-794.281) (-796.834) -- 0:01:39
147000 -- [-799.729] (-803.691) (-798.844) (-795.676) * [-794.653] (-801.010) (-798.800) (-797.388) -- 0:01:38
147500 -- (-798.990) [-793.852] (-802.606) (-799.038) * (-802.622) [-793.655] (-801.262) (-801.602) -- 0:01:38
148000 -- [-797.268] (-793.047) (-802.193) (-799.928) * [-794.618] (-801.366) (-797.333) (-802.461) -- 0:01:37
148500 -- [-803.352] (-803.948) (-795.890) (-800.970) * (-797.496) [-792.458] (-799.917) (-801.332) -- 0:01:37
149000 -- (-797.707) (-798.752) [-795.198] (-801.415) * (-798.893) (-790.907) (-796.526) [-795.017] -- 0:01:37
149500 -- (-800.132) [-800.162] (-802.057) (-792.828) * (-798.705) (-797.397) (-804.199) [-797.092] -- 0:01:36
150000 -- [-795.791] (-800.816) (-801.748) (-797.541) * [-794.171] (-795.290) (-805.649) (-794.420) -- 0:01:36
Average standard deviation of split frequencies: 0.012515
150500 -- (-792.790) [-798.332] (-802.995) (-799.647) * (-794.364) (-794.878) (-810.662) [-794.198] -- 0:01:35
151000 -- [-793.978] (-794.650) (-799.988) (-802.468) * (-797.880) [-800.838] (-798.483) (-792.975) -- 0:01:35
151500 -- (-797.380) [-805.059] (-794.512) (-800.380) * (-793.768) (-797.739) [-798.155] (-800.350) -- 0:01:35
152000 -- (-799.843) [-801.045] (-804.051) (-803.392) * (-799.046) [-791.593] (-800.215) (-790.583) -- 0:01:34
152500 -- (-798.575) (-800.268) [-793.667] (-802.515) * (-804.138) (-801.726) (-807.304) [-798.667] -- 0:01:34
153000 -- (-798.215) [-796.814] (-796.706) (-797.978) * (-797.379) (-799.398) (-802.293) [-794.135] -- 0:01:34
153500 -- (-800.158) (-800.924) (-806.330) [-795.211] * (-795.006) (-797.816) [-798.830] (-800.916) -- 0:01:33
154000 -- (-793.588) (-805.382) [-798.385] (-794.622) * (-794.342) (-794.171) [-795.436] (-799.246) -- 0:01:33
154500 -- (-796.625) (-793.112) [-799.218] (-802.362) * (-798.633) (-793.413) [-798.138] (-792.539) -- 0:01:33
155000 -- (-791.751) [-793.579] (-800.584) (-800.847) * [-804.578] (-803.338) (-796.753) (-797.775) -- 0:01:38
Average standard deviation of split frequencies: 0.011483
155500 -- (-796.460) (-796.737) [-801.439] (-799.251) * (-797.906) (-803.467) [-795.739] (-810.641) -- 0:01:37
156000 -- (-793.657) [-800.217] (-799.018) (-798.462) * (-804.212) (-797.684) [-799.144] (-801.447) -- 0:01:37
156500 -- [-796.276] (-800.009) (-796.795) (-797.483) * (-800.587) [-800.834] (-805.888) (-800.910) -- 0:01:37
157000 -- (-796.088) (-792.907) (-800.044) [-795.798] * [-800.154] (-800.572) (-806.472) (-798.556) -- 0:01:36
157500 -- (-793.445) (-800.611) (-799.220) [-796.817] * (-799.304) [-793.591] (-793.711) (-798.868) -- 0:01:36
158000 -- (-793.245) (-792.935) [-793.987] (-793.834) * (-795.494) (-797.847) [-791.927] (-795.178) -- 0:01:35
158500 -- (-795.623) (-798.830) [-795.807] (-798.957) * [-794.365] (-800.801) (-795.300) (-795.821) -- 0:01:35
159000 -- (-794.112) [-797.885] (-797.767) (-794.815) * (-797.640) (-795.305) [-795.837] (-794.953) -- 0:01:35
159500 -- [-803.467] (-797.830) (-794.140) (-806.846) * (-793.704) (-798.392) [-800.090] (-796.998) -- 0:01:34
160000 -- (-800.410) (-799.398) [-796.963] (-793.686) * (-800.432) [-808.365] (-797.140) (-793.511) -- 0:01:34
Average standard deviation of split frequencies: 0.012910
160500 -- (-793.359) [-803.025] (-804.938) (-796.666) * (-798.443) (-803.192) (-801.882) [-792.730] -- 0:01:34
161000 -- [-795.433] (-798.396) (-795.172) (-801.023) * (-805.832) [-799.356] (-794.125) (-792.969) -- 0:01:33
161500 -- [-801.328] (-796.243) (-806.362) (-797.718) * (-798.894) (-798.267) [-797.049] (-796.654) -- 0:01:33
162000 -- (-793.962) (-798.302) [-796.401] (-799.036) * [-793.078] (-798.713) (-794.646) (-794.620) -- 0:01:33
162500 -- (-797.266) (-806.884) [-796.067] (-795.152) * (-794.232) [-797.533] (-798.947) (-794.526) -- 0:01:32
163000 -- (-800.275) [-796.555] (-791.743) (-798.007) * (-798.104) (-795.598) (-798.091) [-798.604] -- 0:01:32
163500 -- [-800.766] (-800.214) (-801.707) (-799.985) * (-803.442) (-802.339) [-795.931] (-795.531) -- 0:01:32
164000 -- (-796.752) (-799.500) [-801.587] (-796.677) * (-797.387) (-797.719) (-802.608) [-794.750] -- 0:01:36
164500 -- (-791.440) (-799.129) (-799.153) [-799.009] * (-804.866) (-810.704) [-801.067] (-797.870) -- 0:01:36
165000 -- (-793.542) (-814.226) [-795.860] (-802.325) * (-799.835) (-800.758) [-796.768] (-798.314) -- 0:01:36
Average standard deviation of split frequencies: 0.011359
165500 -- (-796.376) (-797.445) [-805.160] (-800.581) * (-804.977) (-797.545) (-800.394) [-797.107] -- 0:01:35
166000 -- (-793.777) [-796.475] (-801.398) (-799.742) * (-805.631) (-794.429) (-796.867) [-793.559] -- 0:01:35
166500 -- [-796.706] (-796.583) (-795.633) (-794.144) * (-800.523) (-795.887) (-796.563) [-795.420] -- 0:01:35
167000 -- [-791.693] (-796.173) (-799.920) (-797.893) * (-797.439) (-797.812) (-795.334) [-799.280] -- 0:01:34
167500 -- (-793.462) (-797.812) [-795.459] (-793.665) * (-794.038) [-798.054] (-794.514) (-799.740) -- 0:01:34
168000 -- (-802.888) [-795.598] (-798.383) (-801.822) * (-802.586) [-798.846] (-794.811) (-796.006) -- 0:01:34
168500 -- (-795.035) [-799.710] (-797.880) (-796.180) * [-795.972] (-801.261) (-796.619) (-792.815) -- 0:01:33
169000 -- [-792.168] (-798.766) (-804.585) (-794.490) * (-796.207) [-791.482] (-806.657) (-792.414) -- 0:01:33
169500 -- (-795.155) (-795.925) (-803.169) [-794.653] * (-800.353) [-798.950] (-798.905) (-799.390) -- 0:01:33
170000 -- (-800.541) (-795.871) (-795.559) [-795.351] * (-800.799) (-803.305) (-794.323) [-792.275] -- 0:01:32
Average standard deviation of split frequencies: 0.010496
170500 -- (-790.581) (-798.524) [-801.562] (-796.244) * (-797.391) (-797.941) (-799.008) [-794.815] -- 0:01:32
171000 -- [-792.016] (-793.558) (-802.956) (-795.882) * (-799.422) [-797.907] (-798.660) (-798.991) -- 0:01:32
171500 -- (-803.079) [-795.266] (-794.548) (-798.129) * (-793.259) (-802.044) (-804.750) [-792.728] -- 0:01:31
172000 -- (-794.061) (-799.279) [-794.018] (-793.399) * (-797.746) (-799.763) [-796.511] (-805.811) -- 0:01:31
172500 -- (-795.588) [-798.268] (-805.100) (-799.751) * (-793.982) [-791.064] (-802.707) (-802.690) -- 0:01:31
173000 -- (-795.981) [-798.696] (-803.540) (-793.094) * (-797.021) [-795.096] (-798.050) (-801.467) -- 0:01:35
173500 -- (-797.182) (-791.082) [-794.059] (-802.615) * (-800.933) [-797.748] (-798.599) (-796.493) -- 0:01:35
174000 -- (-798.680) [-794.973] (-794.539) (-800.064) * (-800.190) (-797.740) (-797.086) [-794.660] -- 0:01:34
174500 -- (-807.064) (-799.402) [-798.162] (-794.047) * (-796.151) [-797.459] (-801.417) (-799.649) -- 0:01:34
175000 -- (-794.897) (-803.076) [-793.586] (-794.835) * (-791.619) (-798.408) [-796.700] (-805.311) -- 0:01:34
Average standard deviation of split frequencies: 0.010178
175500 -- (-798.040) [-792.807] (-799.953) (-803.203) * (-801.697) (-793.375) [-793.643] (-805.945) -- 0:01:33
176000 -- (-794.293) [-800.458] (-803.587) (-800.913) * (-796.976) [-797.934] (-797.802) (-800.860) -- 0:01:33
176500 -- (-796.642) (-797.553) [-793.600] (-798.854) * (-795.264) (-802.677) (-799.890) [-796.096] -- 0:01:33
177000 -- (-797.378) (-797.670) (-793.176) [-797.444] * [-797.639] (-795.879) (-801.038) (-798.637) -- 0:01:32
177500 -- (-797.128) [-796.944] (-796.822) (-799.302) * (-808.402) (-798.647) (-798.580) [-797.601] -- 0:01:32
178000 -- [-800.750] (-805.424) (-799.062) (-798.669) * (-800.214) (-794.963) [-794.263] (-797.854) -- 0:01:32
178500 -- [-793.964] (-797.349) (-799.856) (-799.350) * (-797.526) [-800.958] (-798.696) (-804.504) -- 0:01:32
179000 -- (-801.636) (-800.429) (-797.309) [-794.784] * (-797.430) (-802.977) (-795.306) [-794.290] -- 0:01:31
179500 -- (-798.295) [-799.581] (-796.985) (-797.063) * [-804.575] (-801.221) (-804.606) (-795.532) -- 0:01:31
180000 -- [-801.309] (-799.020) (-798.917) (-797.492) * (-804.183) [-794.180] (-795.243) (-810.149) -- 0:01:31
Average standard deviation of split frequencies: 0.009393
180500 -- (-805.246) (-797.254) (-808.042) [-799.554] * (-793.676) (-793.675) (-797.321) [-791.442] -- 0:01:30
181000 -- (-800.272) [-801.336] (-794.299) (-796.831) * (-795.076) [-799.258] (-795.780) (-797.846) -- 0:01:30
181500 -- [-794.076] (-810.213) (-796.541) (-801.131) * [-794.682] (-795.295) (-797.685) (-791.719) -- 0:01:30
182000 -- (-793.425) [-801.018] (-793.909) (-804.408) * (-795.093) [-795.626] (-799.505) (-796.277) -- 0:01:34
182500 -- (-797.792) [-800.377] (-797.148) (-799.814) * [-801.468] (-792.517) (-798.875) (-797.463) -- 0:01:34
183000 -- (-794.752) (-796.518) (-800.833) [-796.651] * (-797.585) (-802.467) (-797.761) [-798.725] -- 0:01:33
183500 -- (-794.095) [-795.151] (-792.244) (-795.410) * (-804.523) (-797.208) (-798.132) [-794.350] -- 0:01:33
184000 -- (-803.045) [-795.064] (-795.272) (-801.374) * [-796.075] (-805.411) (-796.784) (-800.816) -- 0:01:33
184500 -- (-793.907) (-798.160) (-800.611) [-794.329] * (-798.281) (-801.925) (-795.919) [-794.049] -- 0:01:32
185000 -- (-796.539) (-807.942) (-798.992) [-797.676] * (-806.047) (-793.927) (-801.223) [-799.895] -- 0:01:32
Average standard deviation of split frequencies: 0.012165
185500 -- (-797.995) [-797.336] (-796.872) (-802.314) * (-793.269) (-798.037) [-795.002] (-799.794) -- 0:01:32
186000 -- (-794.892) (-799.159) [-794.870] (-795.814) * [-793.777] (-803.335) (-803.950) (-796.022) -- 0:01:31
186500 -- [-794.689] (-803.897) (-794.640) (-804.525) * [-793.686] (-797.594) (-796.346) (-803.957) -- 0:01:31
187000 -- [-791.521] (-804.726) (-796.123) (-800.342) * (-796.439) (-795.390) [-797.232] (-796.736) -- 0:01:31
187500 -- (-804.255) (-797.461) [-801.489] (-802.725) * (-801.792) (-797.502) [-790.712] (-799.818) -- 0:01:31
188000 -- (-797.067) (-800.689) [-798.101] (-800.666) * (-803.350) (-809.838) [-800.224] (-798.840) -- 0:01:30
188500 -- (-790.590) (-799.253) [-792.854] (-795.608) * (-806.013) (-794.912) (-796.747) [-798.261] -- 0:01:30
189000 -- (-796.339) (-805.551) [-795.923] (-800.959) * (-797.649) (-796.430) [-796.486] (-796.400) -- 0:01:34
189500 -- (-799.165) (-794.885) [-794.942] (-796.547) * (-797.560) (-796.416) (-795.525) [-797.702] -- 0:01:34
190000 -- [-797.163] (-798.106) (-799.130) (-800.978) * (-808.193) (-802.853) (-794.935) [-797.175] -- 0:01:33
Average standard deviation of split frequencies: 0.010879
190500 -- (-792.163) (-799.487) [-798.121] (-800.496) * [-798.829] (-802.247) (-794.901) (-797.964) -- 0:01:33
191000 -- (-799.993) (-796.325) [-798.011] (-800.569) * (-795.417) [-797.777] (-798.149) (-803.163) -- 0:01:33
191500 -- (-796.171) (-798.083) [-795.746] (-792.094) * (-792.672) (-795.102) [-804.661] (-802.330) -- 0:01:32
192000 -- [-798.534] (-800.181) (-794.295) (-797.020) * (-793.076) (-799.637) [-792.822] (-795.464) -- 0:01:32
192500 -- (-799.343) [-800.795] (-797.090) (-796.470) * (-791.894) (-797.815) (-797.992) [-797.329] -- 0:01:32
193000 -- (-799.716) (-794.292) [-797.070] (-798.343) * [-797.807] (-799.490) (-796.965) (-793.905) -- 0:01:31
193500 -- (-799.099) [-795.012] (-794.094) (-800.995) * [-794.197] (-799.661) (-796.595) (-795.228) -- 0:01:31
194000 -- (-807.073) (-794.880) (-794.609) [-799.093] * (-798.806) (-808.085) (-804.389) [-797.559] -- 0:01:31
194500 -- (-801.633) (-798.523) [-798.349] (-802.971) * [-793.384] (-800.905) (-799.732) (-795.658) -- 0:01:31
195000 -- (-799.836) [-796.146] (-796.784) (-800.522) * (-800.040) (-801.658) [-799.417] (-792.113) -- 0:01:30
Average standard deviation of split frequencies: 0.008177
195500 -- (-796.016) (-793.061) [-790.662] (-800.200) * (-798.902) (-796.102) [-795.606] (-795.945) -- 0:01:30
196000 -- (-793.405) (-798.304) [-794.342] (-801.827) * (-798.308) [-796.139] (-803.254) (-795.079) -- 0:01:30
196500 -- (-800.839) (-792.524) (-799.366) [-795.317] * (-797.721) (-797.865) (-797.920) [-799.160] -- 0:01:29
197000 -- [-799.122] (-806.781) (-797.038) (-798.815) * [-793.729] (-792.971) (-801.187) (-800.650) -- 0:01:29
197500 -- [-791.689] (-805.430) (-794.695) (-801.756) * (-793.635) [-797.185] (-805.276) (-807.697) -- 0:01:33
198000 -- (-792.708) [-798.443] (-792.734) (-805.125) * (-797.777) (-794.617) (-800.404) [-798.860] -- 0:01:33
198500 -- (-799.860) (-798.029) [-794.018] (-801.218) * (-794.367) [-796.675] (-793.503) (-797.502) -- 0:01:32
199000 -- (-800.659) (-810.615) (-793.253) [-794.664] * (-796.402) (-798.902) [-793.947] (-807.782) -- 0:01:32
199500 -- [-795.652] (-797.652) (-792.699) (-795.250) * (-794.109) (-791.426) [-797.216] (-795.665) -- 0:01:32
200000 -- (-800.077) (-801.545) (-792.072) [-794.694] * [-798.244] (-797.067) (-797.655) (-800.759) -- 0:01:32
Average standard deviation of split frequencies: 0.010806
200500 -- (-798.022) (-792.481) (-797.854) [-793.626] * (-794.864) [-796.012] (-794.441) (-797.209) -- 0:01:31
201000 -- (-804.380) (-800.024) [-798.685] (-800.571) * [-798.816] (-798.212) (-800.387) (-794.689) -- 0:01:31
201500 -- (-797.242) (-801.309) (-797.978) [-796.449] * (-796.163) (-798.130) (-796.263) [-794.972] -- 0:01:31
202000 -- [-795.960] (-808.628) (-796.768) (-799.805) * (-790.747) (-791.573) [-793.521] (-814.513) -- 0:01:30
202500 -- (-802.208) (-799.492) [-791.910] (-795.192) * (-814.866) (-795.729) (-802.334) [-792.729] -- 0:01:30
203000 -- (-799.596) [-798.859] (-796.339) (-810.706) * (-798.666) (-793.338) (-801.504) [-793.115] -- 0:01:30
203500 -- [-798.860] (-794.640) (-791.418) (-801.108) * (-801.651) [-794.432] (-794.673) (-796.401) -- 0:01:30
204000 -- [-798.734] (-797.917) (-795.939) (-800.485) * [-794.659] (-795.299) (-800.945) (-798.339) -- 0:01:29
204500 -- [-800.892] (-797.602) (-800.644) (-796.459) * (-806.356) (-796.969) (-803.279) [-797.440] -- 0:01:29
205000 -- (-797.903) (-805.266) [-793.799] (-796.263) * (-799.276) (-799.862) (-796.586) [-794.286] -- 0:01:29
Average standard deviation of split frequencies: 0.010527
205500 -- (-797.093) (-807.323) (-799.147) [-794.899] * (-800.666) (-796.878) (-801.240) [-794.746] -- 0:01:28
206000 -- (-793.339) (-793.265) (-799.384) [-797.223] * [-794.719] (-799.264) (-797.817) (-797.039) -- 0:01:28
206500 -- (-796.351) [-794.079] (-804.190) (-802.708) * (-795.021) (-801.190) [-801.085] (-801.097) -- 0:01:32
207000 -- (-800.956) [-794.933] (-799.895) (-795.599) * [-798.387] (-800.282) (-803.458) (-798.354) -- 0:01:31
207500 -- (-795.145) (-803.684) [-794.196] (-799.440) * (-792.613) (-799.253) (-794.630) [-802.288] -- 0:01:31
208000 -- (-798.410) (-794.494) (-799.666) [-794.736] * (-795.995) [-800.400] (-797.149) (-809.409) -- 0:01:31
208500 -- [-795.187] (-805.405) (-799.397) (-798.747) * (-801.805) (-797.800) (-800.707) [-801.741] -- 0:01:31
209000 -- [-807.924] (-793.989) (-806.195) (-807.881) * [-797.497] (-801.543) (-808.318) (-794.986) -- 0:01:30
209500 -- (-797.237) (-800.115) [-793.090] (-798.554) * (-794.242) (-802.122) (-806.277) [-791.527] -- 0:01:30
210000 -- (-798.757) (-797.538) (-796.791) [-800.008] * (-795.718) (-799.910) (-800.716) [-795.091] -- 0:01:30
Average standard deviation of split frequencies: 0.012531
210500 -- (-805.204) [-795.269] (-800.514) (-794.245) * (-795.242) (-799.821) (-796.599) [-794.978] -- 0:01:30
211000 -- (-801.429) [-794.503] (-802.650) (-794.175) * [-799.377] (-796.581) (-797.732) (-795.845) -- 0:01:29
211500 -- (-802.610) (-795.129) [-793.931] (-796.514) * (-797.742) (-795.626) (-797.777) [-793.461] -- 0:01:29
212000 -- [-796.559] (-797.531) (-798.731) (-789.641) * (-801.875) (-810.753) (-796.399) [-799.942] -- 0:01:29
212500 -- (-796.288) (-807.236) (-799.437) [-800.939] * [-796.507] (-796.566) (-796.482) (-800.940) -- 0:01:28
213000 -- (-796.140) (-794.623) (-795.841) [-792.656] * (-795.168) (-797.877) [-796.292] (-796.804) -- 0:01:28
213500 -- [-790.465] (-794.292) (-799.072) (-796.235) * [-791.410] (-794.496) (-801.780) (-798.638) -- 0:01:28
214000 -- (-804.143) [-796.962] (-800.022) (-794.630) * (-799.222) (-797.982) [-794.009] (-797.632) -- 0:01:28
214500 -- (-800.119) (-797.779) [-795.154] (-794.485) * (-797.512) (-800.467) (-796.915) [-791.716] -- 0:01:27
215000 -- (-792.161) (-803.292) (-799.048) [-791.810] * (-797.036) (-798.266) (-798.875) [-793.709] -- 0:01:27
Average standard deviation of split frequencies: 0.013095
215500 -- (-793.933) (-799.488) [-794.046] (-798.356) * (-798.194) [-794.458] (-797.816) (-790.366) -- 0:01:27
216000 -- (-799.423) (-802.566) [-790.575] (-799.501) * (-796.851) (-792.272) [-794.877] (-804.329) -- 0:01:30
216500 -- (-799.880) (-799.940) (-799.868) [-793.234] * [-795.236] (-796.820) (-797.498) (-796.703) -- 0:01:30
217000 -- (-797.090) [-794.880] (-795.667) (-795.704) * (-796.007) (-793.711) [-793.817] (-793.977) -- 0:01:30
217500 -- (-799.221) [-800.053] (-795.941) (-799.706) * (-797.766) (-794.286) [-794.760] (-795.350) -- 0:01:29
218000 -- [-795.766] (-802.507) (-799.206) (-797.595) * [-794.410] (-794.476) (-795.594) (-796.570) -- 0:01:29
218500 -- (-804.877) (-797.442) [-797.051] (-797.798) * [-797.533] (-797.525) (-793.020) (-797.329) -- 0:01:29
219000 -- (-797.547) (-801.730) (-801.843) [-794.139] * (-795.091) [-795.519] (-800.442) (-806.805) -- 0:01:29
219500 -- (-801.746) (-799.555) [-798.559] (-801.467) * (-795.747) (-791.314) [-794.618] (-799.807) -- 0:01:28
220000 -- (-807.541) (-800.499) [-793.439] (-796.077) * (-797.270) [-795.423] (-797.188) (-802.760) -- 0:01:28
Average standard deviation of split frequencies: 0.012390
220500 -- (-801.321) (-804.429) [-798.318] (-796.484) * (-798.483) (-796.273) (-790.600) [-800.385] -- 0:01:28
221000 -- (-808.674) (-793.757) [-792.710] (-799.796) * (-800.870) [-791.760] (-802.935) (-802.569) -- 0:01:28
221500 -- (-801.676) (-803.941) (-798.128) [-799.965] * (-796.738) (-796.354) (-800.846) [-795.154] -- 0:01:27
222000 -- (-799.908) (-800.351) [-794.507] (-799.786) * [-797.530] (-802.658) (-798.955) (-802.389) -- 0:01:27
222500 -- [-792.564] (-797.173) (-796.546) (-799.092) * (-797.321) (-803.012) [-796.671] (-798.153) -- 0:01:27
223000 -- [-801.586] (-800.670) (-795.147) (-794.135) * (-803.427) (-796.222) (-794.745) [-801.309] -- 0:01:27
223500 -- (-812.904) [-797.134] (-803.889) (-792.807) * [-794.091] (-800.821) (-792.364) (-801.978) -- 0:01:26
224000 -- (-803.823) (-803.222) (-807.615) [-798.951] * [-796.794] (-797.087) (-793.973) (-795.107) -- 0:01:26
224500 -- (-799.666) [-799.438] (-800.387) (-798.938) * (-804.221) (-805.754) [-799.477] (-794.952) -- 0:01:26
225000 -- [-795.893] (-795.852) (-794.804) (-796.360) * (-803.296) (-800.372) [-797.209] (-794.641) -- 0:01:29
Average standard deviation of split frequencies: 0.011681
225500 -- (-803.103) (-811.553) [-790.810] (-802.394) * (-800.014) (-801.308) (-797.511) [-798.667] -- 0:01:29
226000 -- [-793.445] (-800.218) (-797.490) (-801.968) * (-805.015) (-798.633) (-796.257) [-790.494] -- 0:01:29
226500 -- (-794.876) (-801.846) [-796.980] (-798.674) * (-798.101) [-793.780] (-794.268) (-800.457) -- 0:01:28
227000 -- (-797.599) (-793.011) [-794.576] (-800.035) * (-797.528) (-796.283) (-796.310) [-797.778] -- 0:01:28
227500 -- (-796.975) (-803.889) [-791.524] (-799.292) * (-803.182) (-796.131) [-793.506] (-794.615) -- 0:01:28
228000 -- [-796.260] (-793.741) (-797.034) (-794.960) * (-798.825) (-796.218) (-798.050) [-794.507] -- 0:01:28
228500 -- (-793.896) [-792.705] (-797.058) (-793.202) * (-800.208) (-796.555) (-795.487) [-797.924] -- 0:01:27
229000 -- (-801.534) [-795.673] (-799.106) (-801.005) * (-799.397) [-793.305] (-802.749) (-798.003) -- 0:01:27
229500 -- [-794.747] (-795.311) (-794.726) (-801.823) * (-807.361) (-803.389) [-793.981] (-796.924) -- 0:01:27
230000 -- (-794.642) [-794.359] (-800.866) (-800.152) * [-805.359] (-797.768) (-802.487) (-806.319) -- 0:01:27
Average standard deviation of split frequencies: 0.009401
230500 -- [-795.265] (-792.797) (-800.029) (-794.341) * (-794.189) [-793.788] (-797.268) (-795.137) -- 0:01:26
231000 -- [-798.375] (-796.970) (-796.617) (-797.023) * (-795.661) [-797.267] (-798.276) (-796.503) -- 0:01:26
231500 -- (-792.902) [-795.763] (-798.429) (-793.898) * [-796.274] (-801.463) (-804.192) (-799.458) -- 0:01:26
232000 -- (-794.311) [-794.532] (-798.386) (-798.567) * (-801.019) (-801.041) (-793.973) [-799.116] -- 0:01:26
232500 -- (-796.398) (-801.006) [-799.316] (-799.120) * (-792.434) [-800.671] (-802.461) (-798.707) -- 0:01:25
233000 -- (-795.802) (-794.482) (-798.665) [-797.626] * [-801.281] (-796.519) (-798.821) (-803.512) -- 0:01:25
233500 -- (-797.825) (-793.637) (-804.621) [-803.906] * (-795.738) (-800.730) [-806.587] (-800.460) -- 0:01:25
234000 -- (-800.398) (-799.587) [-796.676] (-797.690) * (-793.457) (-795.442) [-795.376] (-795.245) -- 0:01:28
234500 -- (-799.728) [-801.360] (-795.432) (-795.703) * (-795.494) [-802.409] (-803.484) (-803.287) -- 0:01:28
235000 -- (-795.957) (-796.770) [-797.072] (-797.924) * (-799.848) (-799.566) [-796.798] (-798.442) -- 0:01:27
Average standard deviation of split frequencies: 0.008389
235500 -- (-798.370) (-794.165) [-795.352] (-796.834) * (-793.435) [-795.891] (-807.337) (-794.765) -- 0:01:27
236000 -- (-795.798) (-793.348) [-793.708] (-797.702) * [-797.227] (-795.040) (-795.663) (-795.169) -- 0:01:27
236500 -- (-794.453) (-803.531) [-792.745] (-800.033) * (-792.574) [-793.507] (-799.903) (-797.611) -- 0:01:27
237000 -- [-796.415] (-798.568) (-792.551) (-805.428) * (-799.737) [-792.888] (-803.643) (-797.906) -- 0:01:26
237500 -- (-804.771) (-793.851) (-796.758) [-800.318] * [-795.997] (-799.881) (-799.231) (-796.373) -- 0:01:26
238000 -- (-799.127) (-801.072) [-795.364] (-798.618) * [-794.639] (-803.095) (-802.750) (-797.584) -- 0:01:26
238500 -- (-801.548) (-800.088) (-798.449) [-798.436] * (-792.470) (-795.259) [-799.506] (-800.656) -- 0:01:26
239000 -- (-796.998) (-799.963) (-795.074) [-793.449] * (-795.874) (-794.143) [-794.708] (-800.059) -- 0:01:25
239500 -- [-792.051] (-802.557) (-803.917) (-793.022) * [-797.332] (-800.466) (-802.728) (-802.658) -- 0:01:25
240000 -- (-799.144) [-795.186] (-795.359) (-801.659) * (-794.154) (-801.090) [-797.356] (-801.247) -- 0:01:25
Average standard deviation of split frequencies: 0.009010
240500 -- (-803.084) (-796.331) (-797.945) [-796.650] * [-795.535] (-802.444) (-795.106) (-804.142) -- 0:01:25
241000 -- (-801.432) (-795.034) (-796.586) [-797.820] * (-800.402) [-796.632] (-799.898) (-801.066) -- 0:01:25
241500 -- [-794.735] (-796.481) (-792.977) (-796.825) * (-802.075) [-792.435] (-804.569) (-796.923) -- 0:01:24
242000 -- (-799.106) (-795.734) (-800.666) [-796.779] * (-800.640) (-800.840) [-796.211] (-795.832) -- 0:01:24
242500 -- (-792.108) (-801.616) (-800.914) [-796.386] * (-798.876) [-794.264] (-795.698) (-796.650) -- 0:01:24
243000 -- (-797.018) [-795.819] (-795.236) (-802.514) * (-793.816) (-797.828) [-793.047] (-792.739) -- 0:01:27
243500 -- (-799.307) [-802.796] (-802.623) (-798.022) * (-800.300) (-798.663) [-797.425] (-799.409) -- 0:01:26
244000 -- (-800.701) (-796.134) (-798.083) [-800.277] * (-799.854) (-798.873) [-797.556] (-796.646) -- 0:01:26
244500 -- (-795.107) [-800.167] (-801.779) (-794.029) * (-802.406) (-801.571) [-797.758] (-801.296) -- 0:01:26
245000 -- [-793.837] (-794.608) (-795.216) (-808.422) * (-794.852) [-799.213] (-801.748) (-792.711) -- 0:01:26
Average standard deviation of split frequencies: 0.009965
245500 -- (-800.067) (-796.258) [-792.497] (-798.787) * [-793.704] (-797.745) (-799.569) (-797.730) -- 0:01:26
246000 -- [-792.436] (-798.795) (-800.425) (-796.295) * (-800.578) [-799.667] (-803.220) (-796.354) -- 0:01:25
246500 -- (-799.315) (-799.178) [-795.615] (-795.922) * (-799.683) (-794.969) (-794.157) [-796.272] -- 0:01:25
247000 -- [-799.621] (-796.564) (-804.134) (-800.229) * (-796.477) (-800.019) (-800.893) [-800.279] -- 0:01:25
247500 -- [-798.717] (-798.709) (-800.070) (-807.801) * [-798.663] (-796.975) (-798.179) (-801.198) -- 0:01:25
248000 -- (-799.656) (-795.177) (-796.812) [-800.591] * (-803.314) (-796.648) (-796.242) [-792.003] -- 0:01:24
248500 -- (-797.045) (-793.679) (-796.799) [-807.111] * [-795.167] (-797.466) (-801.906) (-797.607) -- 0:01:24
249000 -- (-798.494) [-792.138] (-796.787) (-800.331) * (-803.540) (-797.919) (-798.287) [-795.977] -- 0:01:24
249500 -- (-803.399) [-801.305] (-803.280) (-798.626) * [-792.535] (-796.898) (-801.380) (-800.162) -- 0:01:24
250000 -- (-796.955) (-795.743) [-795.337] (-808.208) * (-798.660) (-796.927) [-798.886] (-797.861) -- 0:01:24
Average standard deviation of split frequencies: 0.011660
250500 -- (-797.814) (-797.726) [-808.755] (-798.617) * (-800.664) [-793.927] (-794.934) (-797.700) -- 0:01:23
251000 -- (-798.915) [-793.533] (-801.494) (-799.891) * (-800.204) (-795.886) (-792.017) [-800.507] -- 0:01:23
251500 -- (-791.616) (-794.613) (-801.158) [-795.513] * (-799.366) [-796.748] (-797.095) (-799.202) -- 0:01:23
252000 -- (-798.298) (-797.925) (-796.599) [-797.333] * (-796.131) [-795.865] (-802.751) (-803.596) -- 0:01:26
252500 -- (-805.793) (-800.095) (-795.003) [-798.079] * (-804.029) (-798.241) [-798.083] (-795.074) -- 0:01:25
253000 -- (-799.975) (-795.386) (-799.034) [-794.449] * [-797.436] (-802.175) (-802.343) (-802.147) -- 0:01:25
253500 -- (-795.246) [-796.779] (-796.077) (-800.176) * [-796.301] (-806.646) (-805.352) (-795.420) -- 0:01:25
254000 -- (-807.886) [-794.047] (-800.416) (-795.502) * (-800.729) (-798.291) (-805.031) [-792.203] -- 0:01:25
254500 -- (-795.299) (-801.456) (-805.980) [-797.613] * (-801.698) (-794.448) [-799.982] (-804.046) -- 0:01:24
255000 -- [-798.690] (-806.523) (-798.707) (-795.239) * (-799.309) (-796.100) [-800.526] (-796.538) -- 0:01:24
Average standard deviation of split frequencies: 0.011049
255500 -- [-798.288] (-806.135) (-802.110) (-805.063) * (-797.359) (-797.679) [-797.766] (-798.934) -- 0:01:24
256000 -- (-803.256) [-792.811] (-801.046) (-796.639) * [-793.302] (-800.181) (-798.940) (-793.791) -- 0:01:24
256500 -- (-798.418) (-793.952) (-802.024) [-799.896] * (-797.553) [-796.626] (-802.439) (-794.598) -- 0:01:24
257000 -- [-800.411] (-796.038) (-804.043) (-796.253) * (-796.969) [-797.350] (-802.480) (-795.615) -- 0:01:23
257500 -- [-795.360] (-796.582) (-800.892) (-797.607) * (-796.337) (-799.146) [-797.206] (-806.122) -- 0:01:23
258000 -- (-799.263) [-797.210] (-797.230) (-805.467) * [-801.867] (-799.171) (-797.911) (-791.779) -- 0:01:23
258500 -- [-796.547] (-793.229) (-802.375) (-796.570) * [-796.080] (-798.476) (-796.520) (-800.502) -- 0:01:23
259000 -- [-796.739] (-797.289) (-800.224) (-792.727) * (-795.785) (-808.314) (-793.741) [-792.901] -- 0:01:22
259500 -- (-799.678) [-796.853] (-797.482) (-794.885) * (-793.872) (-801.443) [-794.766] (-800.018) -- 0:01:22
260000 -- (-800.515) (-793.505) [-797.585] (-795.083) * (-809.977) (-798.443) [-804.784] (-791.995) -- 0:01:22
Average standard deviation of split frequencies: 0.010851
260500 -- (-797.871) (-794.311) (-800.222) [-803.843] * (-794.743) (-797.438) [-794.561] (-796.036) -- 0:01:22
261000 -- [-794.916] (-800.203) (-801.847) (-798.679) * (-797.279) (-800.710) [-792.736] (-791.667) -- 0:01:24
261500 -- (-803.345) (-795.094) [-792.175] (-795.839) * [-796.176] (-801.669) (-802.926) (-798.039) -- 0:01:24
262000 -- (-800.175) (-800.154) (-792.967) [-792.438] * (-798.517) [-799.703] (-794.494) (-792.799) -- 0:01:24
262500 -- (-796.985) (-800.956) [-793.709] (-796.487) * (-795.334) [-796.990] (-801.300) (-802.982) -- 0:01:24
263000 -- (-797.608) (-801.616) (-795.504) [-795.274] * (-796.464) (-800.424) (-793.224) [-800.281] -- 0:01:24
263500 -- (-803.602) [-797.098] (-793.749) (-793.724) * [-798.324] (-803.375) (-796.371) (-796.143) -- 0:01:23
264000 -- (-799.461) [-793.407] (-802.262) (-800.252) * [-799.078] (-799.948) (-802.569) (-799.188) -- 0:01:23
264500 -- (-794.153) [-797.262] (-793.844) (-797.981) * (-795.799) (-793.781) [-793.394] (-793.459) -- 0:01:23
265000 -- [-797.452] (-793.571) (-795.290) (-803.586) * (-795.105) [-794.081] (-796.491) (-801.505) -- 0:01:23
Average standard deviation of split frequencies: 0.010988
265500 -- (-802.521) [-799.896] (-794.786) (-808.143) * (-800.706) (-799.924) (-800.171) [-791.440] -- 0:01:22
266000 -- (-801.087) [-789.957] (-790.368) (-796.058) * (-810.000) [-794.324] (-801.234) (-800.611) -- 0:01:22
266500 -- (-802.666) (-801.428) [-790.398] (-800.272) * (-805.956) [-795.449] (-808.150) (-791.958) -- 0:01:22
267000 -- (-802.778) [-795.533] (-789.451) (-807.284) * [-794.280] (-793.709) (-802.632) (-798.039) -- 0:01:22
267500 -- (-801.015) (-797.563) (-803.007) [-797.456] * (-795.066) (-803.996) (-799.711) [-802.274] -- 0:01:22
268000 -- (-805.460) [-793.574] (-794.137) (-804.668) * (-800.921) [-799.256] (-803.446) (-799.631) -- 0:01:21
268500 -- [-806.536] (-800.957) (-795.574) (-801.929) * (-794.296) (-796.830) [-797.930] (-793.354) -- 0:01:21
269000 -- (-796.751) [-794.333] (-795.914) (-798.270) * (-802.887) (-796.248) (-793.474) [-796.292] -- 0:01:21
269500 -- (-796.731) [-793.925] (-793.338) (-796.036) * (-794.552) (-804.923) [-796.498] (-807.821) -- 0:01:21
270000 -- (-802.827) (-800.294) (-795.162) [-796.742] * (-798.259) (-796.267) [-795.019] (-799.713) -- 0:01:23
Average standard deviation of split frequencies: 0.009753
270500 -- (-799.385) (-794.686) (-804.753) [-795.267] * (-799.108) (-793.126) [-797.859] (-799.052) -- 0:01:23
271000 -- (-795.140) [-801.863] (-799.637) (-792.538) * [-796.930] (-797.189) (-803.590) (-794.624) -- 0:01:23
271500 -- (-794.957) (-802.974) (-800.886) [-797.923] * (-796.413) (-796.215) [-799.128] (-797.231) -- 0:01:23
272000 -- (-803.246) (-799.015) [-796.231] (-794.316) * (-798.375) [-798.095] (-800.560) (-799.007) -- 0:01:22
272500 -- (-799.687) (-797.175) (-792.858) [-799.714] * (-799.102) (-812.577) (-793.607) [-799.740] -- 0:01:22
273000 -- [-800.681] (-796.800) (-799.333) (-799.756) * [-798.527] (-806.037) (-800.916) (-800.427) -- 0:01:22
273500 -- (-793.573) (-796.305) (-797.458) [-802.145] * [-795.644] (-795.590) (-798.679) (-800.805) -- 0:01:22
274000 -- [-796.561] (-796.334) (-794.344) (-795.670) * (-796.277) [-798.513] (-808.205) (-802.464) -- 0:01:22
274500 -- (-801.069) (-800.948) [-797.725] (-795.874) * (-805.624) (-802.723) (-798.286) [-796.787] -- 0:01:21
275000 -- [-797.559] (-793.306) (-801.287) (-797.032) * (-799.837) [-795.660] (-811.393) (-799.577) -- 0:01:21
Average standard deviation of split frequencies: 0.010248
275500 -- [-801.190] (-800.764) (-797.305) (-794.899) * [-796.103] (-804.609) (-796.836) (-801.201) -- 0:01:21
276000 -- (-800.785) [-798.077] (-797.403) (-803.143) * [-798.921] (-798.333) (-802.289) (-796.333) -- 0:01:21
276500 -- (-798.225) (-805.367) [-795.226] (-797.891) * [-791.158] (-801.808) (-792.692) (-802.082) -- 0:01:21
277000 -- (-796.567) (-799.655) [-796.773] (-797.627) * (-796.588) (-800.509) (-797.552) [-796.916] -- 0:01:20
277500 -- (-798.321) (-801.127) (-794.980) [-793.200] * (-796.407) (-798.275) (-799.718) [-798.311] -- 0:01:20
278000 -- (-798.210) [-796.555] (-795.857) (-799.185) * [-800.588] (-796.759) (-798.016) (-800.712) -- 0:01:20
278500 -- [-793.143] (-803.675) (-801.125) (-792.065) * (-804.495) (-798.376) [-797.709] (-795.155) -- 0:01:22
279000 -- [-792.770] (-801.761) (-798.041) (-799.993) * [-800.618] (-795.202) (-798.337) (-799.732) -- 0:01:22
279500 -- [-795.391] (-793.251) (-796.271) (-795.195) * (-793.218) [-796.948] (-793.330) (-793.416) -- 0:01:22
280000 -- [-795.663] (-798.543) (-797.270) (-799.078) * [-796.008] (-797.750) (-803.988) (-801.102) -- 0:01:22
Average standard deviation of split frequencies: 0.009070
280500 -- (-802.345) (-797.010) [-799.516] (-794.876) * (-797.123) (-799.362) [-796.016] (-795.502) -- 0:01:22
281000 -- (-799.846) [-798.171] (-796.953) (-794.755) * (-795.681) [-798.251] (-800.931) (-799.707) -- 0:01:21
281500 -- (-800.166) (-802.417) (-800.214) [-797.108] * (-808.135) (-805.541) (-795.765) [-798.761] -- 0:01:21
282000 -- [-793.574] (-796.759) (-796.118) (-799.566) * (-800.704) [-800.403] (-795.632) (-800.048) -- 0:01:21
282500 -- (-795.258) [-798.645] (-794.875) (-802.384) * [-790.692] (-795.228) (-804.865) (-797.271) -- 0:01:21
283000 -- (-805.945) (-804.559) [-797.779] (-794.684) * (-799.034) [-797.988] (-804.128) (-799.121) -- 0:01:21
283500 -- (-798.926) (-802.986) [-798.205] (-798.414) * [-805.035] (-800.421) (-799.569) (-808.523) -- 0:01:20
284000 -- [-794.334] (-800.495) (-791.625) (-802.163) * (-799.258) (-800.092) [-803.950] (-801.307) -- 0:01:20
284500 -- (-806.492) (-792.832) [-799.061] (-795.454) * [-796.054] (-796.913) (-798.048) (-805.064) -- 0:01:20
285000 -- (-797.578) (-797.572) [-797.821] (-799.430) * (-796.104) (-800.702) (-799.258) [-794.982] -- 0:01:20
Average standard deviation of split frequencies: 0.009230
285500 -- [-794.868] (-798.674) (-798.457) (-801.645) * [-793.617] (-802.622) (-798.601) (-799.309) -- 0:01:20
286000 -- (-798.442) [-793.867] (-798.480) (-800.374) * (-796.443) (-797.786) (-797.426) [-797.030] -- 0:01:19
286500 -- (-796.922) (-795.686) (-794.720) [-793.779] * (-802.540) (-798.913) [-792.263] (-801.501) -- 0:01:19
287000 -- (-800.076) (-799.287) [-794.113] (-800.388) * (-799.027) [-794.798] (-793.622) (-802.279) -- 0:01:19
287500 -- (-794.573) [-792.911] (-796.601) (-805.024) * [-801.400] (-799.160) (-798.400) (-797.852) -- 0:01:21
288000 -- (-801.893) (-795.689) (-795.353) [-804.661] * (-795.435) (-795.252) (-798.218) [-795.759] -- 0:01:21
288500 -- [-794.834] (-802.587) (-795.214) (-801.390) * (-793.764) (-802.498) (-795.073) [-798.703] -- 0:01:21
289000 -- (-799.213) (-801.699) [-798.445] (-807.023) * (-794.082) [-797.989] (-793.942) (-792.734) -- 0:01:21
289500 -- [-798.900] (-799.693) (-801.585) (-806.608) * (-792.569) (-801.747) (-802.550) [-794.717] -- 0:01:20
290000 -- (-794.584) [-799.062] (-793.506) (-799.281) * [-797.437] (-795.375) (-807.601) (-797.146) -- 0:01:20
Average standard deviation of split frequencies: 0.008758
290500 -- (-797.449) [-795.299] (-798.496) (-796.938) * (-800.787) (-800.111) [-794.509] (-800.172) -- 0:01:20
291000 -- (-799.630) (-793.912) (-805.533) [-791.443] * (-797.292) (-796.242) [-793.858] (-798.557) -- 0:01:20
291500 -- [-797.196] (-794.936) (-799.033) (-796.496) * [-791.859] (-799.945) (-801.724) (-791.526) -- 0:01:20
292000 -- (-795.664) (-794.551) [-799.376] (-807.194) * [-794.554] (-803.478) (-796.910) (-797.155) -- 0:01:20
292500 -- [-794.902] (-797.586) (-796.855) (-806.115) * (-808.537) [-797.065] (-802.312) (-794.029) -- 0:01:19
293000 -- (-794.722) (-802.884) (-791.543) [-794.999] * [-800.694] (-801.853) (-797.685) (-796.852) -- 0:01:19
293500 -- (-798.951) (-801.411) [-794.340] (-797.204) * (-796.247) (-797.678) [-797.458] (-794.689) -- 0:01:19
294000 -- (-793.855) (-802.025) (-796.437) [-792.054] * (-791.508) [-794.828] (-792.949) (-806.373) -- 0:01:19
294500 -- [-798.877] (-795.421) (-803.433) (-794.685) * (-797.829) [-800.337] (-797.553) (-793.247) -- 0:01:19
295000 -- [-795.351] (-798.202) (-803.574) (-792.860) * (-798.597) [-798.057] (-805.057) (-799.037) -- 0:01:18
Average standard deviation of split frequencies: 0.008918
295500 -- (-797.534) [-796.299] (-801.795) (-797.935) * (-797.755) [-796.320] (-797.921) (-796.378) -- 0:01:18
296000 -- (-797.075) (-797.589) [-796.203] (-802.549) * (-797.765) (-799.341) (-804.138) [-793.519] -- 0:01:18
296500 -- (-796.081) (-796.976) (-796.279) [-795.070] * (-795.082) [-797.589] (-798.545) (-799.880) -- 0:01:20
297000 -- [-795.180] (-797.363) (-793.315) (-794.479) * [-796.809] (-797.440) (-796.677) (-798.439) -- 0:01:20
297500 -- (-795.414) (-800.447) [-795.294] (-797.859) * (-799.933) (-801.565) [-792.664] (-796.290) -- 0:01:20
298000 -- (-793.227) (-795.349) [-792.775] (-798.361) * (-796.045) (-801.306) [-795.840] (-791.340) -- 0:01:20
298500 -- [-802.539] (-796.008) (-794.376) (-798.405) * (-798.081) [-793.961] (-806.609) (-802.204) -- 0:01:19
299000 -- [-794.305] (-801.424) (-795.016) (-801.152) * (-799.973) [-795.844] (-799.585) (-798.842) -- 0:01:19
299500 -- [-793.641] (-797.370) (-795.762) (-802.943) * (-797.231) [-796.423] (-795.366) (-800.536) -- 0:01:19
300000 -- (-792.898) (-796.307) [-792.504] (-797.982) * [-791.537] (-795.713) (-799.780) (-807.014) -- 0:01:19
Average standard deviation of split frequencies: 0.009094
300500 -- (-793.963) (-800.387) (-804.694) [-792.783] * [-795.075] (-795.627) (-801.262) (-810.021) -- 0:01:19
301000 -- (-804.096) [-797.211] (-798.525) (-793.247) * (-798.160) (-797.933) (-800.554) [-795.726] -- 0:01:18
301500 -- (-803.971) (-801.660) (-796.247) [-795.953] * (-796.945) (-794.132) [-794.759] (-796.402) -- 0:01:18
302000 -- (-798.413) (-794.719) (-798.584) [-793.163] * (-795.383) [-798.049] (-797.876) (-804.164) -- 0:01:18
302500 -- (-805.188) (-799.543) [-794.926] (-794.081) * (-795.655) [-796.696] (-802.069) (-799.636) -- 0:01:18
303000 -- (-797.541) [-809.064] (-804.079) (-797.735) * [-800.775] (-796.216) (-807.018) (-794.626) -- 0:01:18
303500 -- (-800.661) (-805.683) (-800.414) [-795.533] * [-796.954] (-792.562) (-792.840) (-794.317) -- 0:01:18
304000 -- (-805.025) (-799.207) (-794.547) [-797.594] * (-801.256) (-792.738) [-799.326] (-797.772) -- 0:01:17
304500 -- (-795.645) (-800.892) [-795.177] (-799.539) * [-794.270] (-798.387) (-795.209) (-799.155) -- 0:01:17
305000 -- (-803.692) (-801.307) [-794.630] (-798.811) * [-796.598] (-798.729) (-806.370) (-798.488) -- 0:01:17
Average standard deviation of split frequencies: 0.009859
305500 -- (-799.775) (-800.214) [-793.636] (-797.613) * (-800.384) [-794.104] (-798.266) (-797.552) -- 0:01:19
306000 -- (-797.935) (-798.561) [-800.417] (-797.271) * (-800.388) [-792.366] (-807.328) (-796.094) -- 0:01:19
306500 -- (-799.227) (-803.192) [-798.061] (-797.579) * [-792.873] (-798.408) (-799.945) (-794.799) -- 0:01:19
307000 -- (-797.922) (-794.579) (-798.181) [-801.358] * [-796.299] (-797.450) (-799.923) (-797.114) -- 0:01:19
307500 -- (-794.481) [-795.689] (-795.802) (-796.719) * (-795.781) (-798.565) (-798.247) [-794.790] -- 0:01:18
308000 -- [-796.326] (-801.594) (-805.936) (-798.561) * (-792.909) (-798.045) (-794.252) [-791.918] -- 0:01:18
308500 -- (-801.537) (-795.382) [-800.861] (-796.393) * (-800.494) (-797.310) (-797.572) [-792.005] -- 0:01:18
309000 -- (-799.354) [-794.589] (-796.100) (-799.548) * (-802.725) (-794.633) [-796.504] (-794.386) -- 0:01:18
309500 -- (-803.978) (-799.399) (-800.784) [-793.373] * (-798.155) [-792.011] (-800.792) (-802.686) -- 0:01:18
310000 -- (-800.718) (-802.375) [-800.818] (-800.739) * (-795.196) (-791.547) (-797.114) [-795.242] -- 0:01:17
Average standard deviation of split frequencies: 0.010925
310500 -- [-800.509] (-793.980) (-798.370) (-796.317) * [-794.487] (-797.085) (-794.424) (-804.185) -- 0:01:17
311000 -- (-800.342) (-801.027) [-795.723] (-797.655) * (-798.114) (-800.065) [-795.480] (-797.753) -- 0:01:17
311500 -- (-803.034) (-806.619) [-795.360] (-793.508) * (-804.637) (-806.120) [-795.981] (-795.504) -- 0:01:17
312000 -- (-798.199) (-797.256) (-796.398) [-800.325] * (-797.894) [-793.899] (-796.340) (-798.777) -- 0:01:17
312500 -- (-794.233) (-803.325) (-797.243) [-793.980] * (-806.515) [-790.315] (-798.455) (-794.980) -- 0:01:17
313000 -- (-794.290) (-796.209) [-796.688] (-799.736) * (-800.221) (-798.592) [-794.884] (-794.344) -- 0:01:16
313500 -- (-793.516) (-800.650) [-799.834] (-808.687) * (-796.416) (-803.561) [-798.445] (-795.665) -- 0:01:16
314000 -- (-800.048) [-792.067] (-801.532) (-796.329) * [-798.871] (-796.893) (-796.196) (-795.926) -- 0:01:16
314500 -- (-798.899) (-797.164) [-795.541] (-793.803) * (-797.417) (-798.371) [-797.226] (-798.999) -- 0:01:18
315000 -- [-796.138] (-795.589) (-796.759) (-793.803) * (-799.157) (-796.520) (-791.613) [-797.620] -- 0:01:18
Average standard deviation of split frequencies: 0.012531
315500 -- (-796.103) (-797.287) (-797.803) [-801.597] * [-792.316] (-797.404) (-796.861) (-795.264) -- 0:01:18
316000 -- (-797.180) (-798.115) [-797.499] (-798.562) * (-802.505) (-797.194) (-803.750) [-803.439] -- 0:01:17
316500 -- (-797.906) (-807.766) [-797.694] (-799.316) * [-796.876] (-801.056) (-795.714) (-801.112) -- 0:01:17
317000 -- (-795.891) (-799.132) [-793.984] (-802.681) * (-799.679) (-805.313) (-801.804) [-792.902] -- 0:01:17
317500 -- (-800.398) (-798.497) (-792.608) [-796.225] * (-804.956) (-800.476) (-792.200) [-794.767] -- 0:01:17
318000 -- (-800.439) (-797.294) (-792.354) [-803.612] * (-799.192) (-800.425) [-796.349] (-799.600) -- 0:01:17
318500 -- (-799.639) (-799.942) (-799.709) [-800.152] * (-795.739) [-794.953] (-799.033) (-797.378) -- 0:01:17
319000 -- (-797.553) (-796.361) (-794.973) [-798.353] * [-793.433] (-795.211) (-796.759) (-804.224) -- 0:01:16
319500 -- (-793.159) (-796.008) [-796.894] (-798.702) * (-793.766) [-793.283] (-796.550) (-802.089) -- 0:01:16
320000 -- (-798.022) (-802.855) (-798.469) [-798.643] * (-797.166) (-794.703) [-794.426] (-797.161) -- 0:01:16
Average standard deviation of split frequencies: 0.010585
320500 -- (-803.459) [-792.784] (-797.920) (-800.722) * (-807.855) (-800.746) (-800.326) [-792.656] -- 0:01:16
321000 -- (-797.051) [-794.812] (-797.465) (-800.528) * (-797.631) [-794.193] (-795.310) (-805.475) -- 0:01:16
321500 -- (-799.219) (-798.167) [-796.465] (-795.766) * (-798.215) (-803.723) (-796.013) [-795.722] -- 0:01:15
322000 -- (-796.922) [-795.117] (-795.823) (-797.645) * (-795.044) [-799.633] (-795.652) (-798.289) -- 0:01:15
322500 -- (-795.169) [-794.986] (-799.730) (-795.722) * (-803.198) [-796.452] (-794.416) (-798.150) -- 0:01:15
323000 -- (-791.374) (-795.137) [-798.168] (-801.623) * (-798.833) (-798.383) (-789.710) [-796.553] -- 0:01:15
323500 -- [-795.545] (-795.110) (-799.025) (-798.653) * (-798.653) (-796.083) (-801.931) [-794.015] -- 0:01:17
324000 -- [-790.677] (-797.352) (-800.251) (-799.308) * (-805.093) (-797.009) (-795.128) [-794.063] -- 0:01:17
324500 -- (-798.973) [-808.459] (-804.799) (-800.130) * (-798.346) (-797.206) (-795.855) [-792.889] -- 0:01:17
325000 -- (-805.032) (-795.237) (-804.531) [-795.635] * [-801.285] (-797.945) (-796.792) (-806.630) -- 0:01:16
Average standard deviation of split frequencies: 0.010701
325500 -- (-801.624) [-798.066] (-801.443) (-807.552) * [-797.124] (-792.445) (-800.838) (-806.135) -- 0:01:16
326000 -- [-791.667] (-791.722) (-795.110) (-795.935) * [-799.401] (-798.905) (-802.249) (-805.466) -- 0:01:16
326500 -- (-795.152) (-795.509) (-799.155) [-796.162] * (-801.614) (-794.787) [-795.570] (-797.332) -- 0:01:16
327000 -- [-800.889] (-799.667) (-792.939) (-793.791) * (-797.756) (-791.654) [-794.337] (-803.760) -- 0:01:16
327500 -- (-796.225) (-795.683) (-797.804) [-795.966] * (-794.678) (-801.067) [-794.231] (-798.993) -- 0:01:15
328000 -- (-799.368) (-797.486) (-804.052) [-793.949] * (-794.190) [-805.646] (-798.897) (-797.033) -- 0:01:15
328500 -- [-798.569] (-799.404) (-802.163) (-793.426) * [-795.451] (-804.779) (-803.315) (-801.167) -- 0:01:15
329000 -- (-791.615) (-800.335) [-792.186] (-794.250) * (-793.757) (-800.707) (-794.246) [-800.045] -- 0:01:15
329500 -- [-798.649] (-795.879) (-802.367) (-792.093) * (-799.440) [-803.467] (-802.660) (-795.407) -- 0:01:15
330000 -- (-799.558) (-798.983) (-805.877) [-795.874] * (-795.326) (-796.281) [-797.876] (-799.490) -- 0:01:15
Average standard deviation of split frequencies: 0.012831
330500 -- (-794.076) (-796.583) (-804.540) [-795.492] * (-800.530) (-799.064) (-800.667) [-799.533] -- 0:01:14
331000 -- (-797.164) (-800.943) (-796.951) [-797.968] * (-801.935) (-799.903) [-798.094] (-796.548) -- 0:01:14
331500 -- (-802.721) (-798.864) [-795.072] (-802.711) * (-793.760) [-799.413] (-799.062) (-807.090) -- 0:01:14
332000 -- [-796.824] (-796.464) (-805.036) (-795.003) * (-802.649) [-799.646] (-800.955) (-796.932) -- 0:01:14
332500 -- [-797.862] (-797.496) (-801.607) (-795.967) * (-794.259) [-796.737] (-803.386) (-793.209) -- 0:01:16
333000 -- (-798.702) (-795.890) (-804.333) [-797.362] * (-796.566) (-794.623) [-798.844] (-796.377) -- 0:01:16
333500 -- (-795.823) (-799.403) [-797.116] (-792.510) * (-799.740) (-800.716) (-802.158) [-798.400] -- 0:01:15
334000 -- (-804.075) (-799.880) [-797.052] (-797.330) * (-799.286) (-802.408) [-799.661] (-794.964) -- 0:01:15
334500 -- [-803.195] (-798.147) (-797.147) (-801.455) * (-803.779) (-800.558) [-798.113] (-794.963) -- 0:01:15
335000 -- (-800.507) (-795.498) [-796.932] (-798.235) * (-797.899) (-801.701) [-799.921] (-797.077) -- 0:01:15
Average standard deviation of split frequencies: 0.012627
335500 -- (-797.411) (-799.203) [-799.261] (-796.412) * (-796.075) [-796.166] (-796.124) (-799.915) -- 0:01:15
336000 -- (-800.236) [-795.390] (-801.821) (-800.509) * (-792.981) (-805.737) [-795.360] (-793.763) -- 0:01:15
336500 -- (-801.490) [-800.629] (-798.345) (-794.682) * (-793.668) [-798.251] (-795.157) (-801.029) -- 0:01:14
337000 -- (-798.688) (-799.817) [-801.483] (-801.511) * (-801.386) (-803.972) [-799.082] (-800.021) -- 0:01:14
337500 -- (-800.971) (-795.188) (-802.576) [-800.636] * (-800.584) (-792.497) [-799.973] (-797.807) -- 0:01:14
338000 -- (-799.213) (-796.990) [-802.170] (-793.311) * [-794.495] (-799.566) (-800.450) (-797.070) -- 0:01:14
338500 -- (-798.236) [-795.677] (-793.242) (-796.376) * (-803.693) (-798.274) (-796.561) [-794.764] -- 0:01:14
339000 -- (-802.235) (-801.530) [-793.062] (-793.808) * [-794.472] (-802.772) (-796.179) (-794.741) -- 0:01:14
339500 -- (-797.456) (-796.227) (-797.956) [-795.723] * (-797.249) [-796.543] (-797.972) (-794.268) -- 0:01:13
340000 -- (-804.148) (-795.758) (-804.482) [-790.204] * (-800.100) (-792.346) [-797.615] (-795.821) -- 0:01:13
Average standard deviation of split frequencies: 0.010517
340500 -- (-800.027) (-799.839) (-803.286) [-791.255] * (-795.298) [-801.936] (-800.017) (-796.724) -- 0:01:13
341000 -- (-796.212) (-799.068) (-796.227) [-792.227] * [-791.320] (-794.583) (-797.764) (-797.844) -- 0:01:13
341500 -- [-793.201] (-801.227) (-804.173) (-795.657) * (-795.039) (-802.164) [-801.658] (-795.180) -- 0:01:15
342000 -- (-797.501) (-799.588) (-801.555) [-797.365] * [-796.356] (-794.372) (-798.265) (-794.440) -- 0:01:15
342500 -- (-803.140) (-802.021) [-800.625] (-796.275) * (-794.766) [-803.599] (-796.039) (-797.543) -- 0:01:14
343000 -- (-798.236) (-799.671) [-800.210] (-798.809) * (-792.779) [-799.062] (-795.786) (-802.960) -- 0:01:14
343500 -- [-797.613] (-796.129) (-796.309) (-797.288) * (-792.313) (-798.148) (-798.410) [-798.434] -- 0:01:14
344000 -- [-794.837] (-800.066) (-797.664) (-798.428) * (-806.500) (-802.651) [-795.356] (-795.729) -- 0:01:14
344500 -- (-793.039) [-793.461] (-800.714) (-795.956) * (-798.725) [-792.477] (-795.452) (-794.293) -- 0:01:14
345000 -- (-801.552) (-799.308) (-808.854) [-799.185] * (-796.020) [-798.012] (-798.409) (-796.810) -- 0:01:14
Average standard deviation of split frequencies: 0.011445
345500 -- [-800.278] (-795.532) (-799.501) (-802.171) * (-798.294) [-799.536] (-801.365) (-797.880) -- 0:01:13
346000 -- (-808.649) (-800.034) (-800.795) [-799.152] * (-796.718) (-795.328) (-801.045) [-793.983] -- 0:01:13
346500 -- (-801.432) (-806.087) [-798.382] (-797.784) * [-799.043] (-801.365) (-796.015) (-794.306) -- 0:01:13
347000 -- (-800.065) [-796.691] (-801.763) (-792.141) * (-804.330) (-800.383) [-794.230] (-795.124) -- 0:01:13
347500 -- [-793.525] (-798.547) (-798.245) (-797.265) * (-794.118) [-795.810] (-805.627) (-798.625) -- 0:01:13
348000 -- (-800.621) (-801.728) (-796.393) [-802.139] * (-797.029) (-800.077) (-796.875) [-797.088] -- 0:01:13
348500 -- [-792.778] (-796.935) (-798.017) (-798.357) * [-793.200] (-796.350) (-795.841) (-800.430) -- 0:01:12
349000 -- [-799.563] (-797.467) (-794.011) (-791.439) * (-794.642) [-797.920] (-795.429) (-794.620) -- 0:01:12
349500 -- (-801.454) (-799.965) [-794.594] (-796.462) * (-798.908) [-792.875] (-801.356) (-794.811) -- 0:01:12
350000 -- (-795.289) (-799.557) [-795.847] (-802.338) * (-808.844) (-799.588) (-801.132) [-792.182] -- 0:01:12
Average standard deviation of split frequencies: 0.011830
350500 -- (-799.578) (-802.195) (-801.654) [-801.421] * (-801.866) (-797.786) (-798.926) [-794.662] -- 0:01:14
351000 -- (-799.716) (-805.378) [-796.689] (-806.243) * [-796.824] (-801.064) (-795.763) (-794.753) -- 0:01:13
351500 -- (-798.253) (-801.182) [-794.350] (-800.216) * (-796.049) (-794.872) (-804.389) [-799.098] -- 0:01:13
352000 -- (-797.926) [-794.125] (-794.206) (-797.751) * [-793.069] (-796.805) (-797.703) (-800.154) -- 0:01:13
352500 -- (-804.842) (-802.565) (-799.116) [-793.986] * (-798.104) (-795.145) [-796.311] (-798.915) -- 0:01:13
353000 -- (-799.873) (-801.357) (-803.539) [-797.638] * [-789.845] (-796.356) (-798.325) (-799.840) -- 0:01:13
353500 -- (-801.086) [-803.429] (-803.578) (-795.190) * (-794.472) (-799.125) (-805.107) [-794.615] -- 0:01:13
354000 -- [-799.447] (-800.965) (-796.481) (-796.797) * [-791.119] (-801.054) (-798.694) (-796.259) -- 0:01:12
354500 -- (-796.258) [-795.852] (-804.449) (-792.295) * (-795.721) (-797.458) [-797.671] (-796.405) -- 0:01:12
355000 -- (-799.030) (-802.545) (-795.700) [-797.096] * (-795.293) (-796.359) (-799.032) [-797.459] -- 0:01:12
Average standard deviation of split frequencies: 0.012447
355500 -- [-799.692] (-809.849) (-800.773) (-795.050) * (-797.373) (-794.238) (-799.304) [-795.458] -- 0:01:12
356000 -- [-796.543] (-805.121) (-799.002) (-800.151) * (-798.483) (-795.344) (-800.049) [-795.928] -- 0:01:12
356500 -- (-803.816) [-797.076] (-800.193) (-793.380) * (-801.661) (-793.498) (-797.526) [-795.573] -- 0:01:12
357000 -- (-798.366) (-792.331) (-793.722) [-800.403] * [-794.113] (-799.738) (-797.027) (-795.255) -- 0:01:12
357500 -- (-794.159) (-807.786) (-797.827) [-793.856] * (-798.459) (-793.324) [-793.847] (-799.610) -- 0:01:11
358000 -- (-791.972) [-795.806] (-798.309) (-796.689) * [-797.357] (-796.319) (-799.402) (-794.259) -- 0:01:11
358500 -- [-795.109] (-810.392) (-796.608) (-795.345) * (-800.069) (-801.483) [-797.530] (-803.702) -- 0:01:11
359000 -- [-797.840] (-799.665) (-800.522) (-794.928) * [-792.789] (-798.563) (-797.253) (-797.768) -- 0:01:11
359500 -- [-793.674] (-799.677) (-797.627) (-801.457) * (-794.642) (-806.727) (-796.413) [-794.920] -- 0:01:11
360000 -- (-798.040) [-797.015] (-796.073) (-800.247) * [-795.570] (-800.129) (-794.741) (-793.961) -- 0:01:12
Average standard deviation of split frequencies: 0.013070
360500 -- [-798.945] (-796.028) (-801.888) (-797.931) * [-796.176] (-797.837) (-801.212) (-791.548) -- 0:01:12
361000 -- (-798.681) (-813.042) [-795.939] (-800.050) * (-792.426) (-794.118) [-794.645] (-801.149) -- 0:01:12
361500 -- [-796.962] (-791.309) (-805.347) (-800.220) * (-801.642) [-793.310] (-794.809) (-792.993) -- 0:01:12
362000 -- (-796.246) (-806.104) (-798.698) [-797.569] * (-794.987) (-796.973) [-798.345] (-799.270) -- 0:01:12
362500 -- (-799.730) (-798.497) [-796.580] (-798.767) * (-796.952) (-798.046) [-794.289] (-801.592) -- 0:01:12
363000 -- [-797.681] (-793.288) (-797.591) (-799.833) * (-797.677) [-796.048] (-793.722) (-801.970) -- 0:01:11
363500 -- [-795.942] (-797.020) (-807.269) (-794.032) * [-793.864] (-799.906) (-792.736) (-796.815) -- 0:01:11
364000 -- (-802.528) [-793.813] (-806.390) (-805.405) * (-801.266) [-792.566] (-800.598) (-797.350) -- 0:01:11
364500 -- (-796.412) (-795.682) (-801.754) [-800.951] * (-796.313) (-794.463) (-799.381) [-799.204] -- 0:01:11
365000 -- [-793.455] (-791.277) (-797.099) (-803.280) * (-795.535) [-797.064] (-795.630) (-800.335) -- 0:01:11
Average standard deviation of split frequencies: 0.012622
365500 -- (-797.164) [-793.298] (-797.431) (-797.945) * [-796.843] (-800.751) (-799.269) (-800.575) -- 0:01:11
366000 -- (-799.053) (-800.223) [-797.125] (-796.207) * (-796.902) (-798.389) (-801.066) [-798.561] -- 0:01:11
366500 -- (-796.238) (-800.036) [-794.864] (-801.199) * (-801.641) (-797.797) [-799.573] (-803.554) -- 0:01:10
367000 -- (-796.906) (-798.716) (-797.555) [-796.736] * (-795.789) [-793.189] (-799.964) (-797.285) -- 0:01:10
367500 -- (-796.437) (-810.442) [-799.368] (-798.108) * (-800.331) (-803.678) (-802.153) [-800.117] -- 0:01:10
368000 -- (-795.563) (-794.792) [-793.893] (-801.149) * (-804.337) (-792.998) (-799.350) [-797.820] -- 0:01:10
368500 -- (-797.329) (-796.511) (-797.512) [-796.751] * [-791.062] (-796.633) (-801.286) (-794.050) -- 0:01:10
369000 -- (-800.906) [-794.826] (-797.425) (-796.804) * (-801.759) (-793.140) [-794.585] (-796.177) -- 0:01:11
369500 -- (-799.913) (-794.840) [-799.840] (-799.263) * (-795.314) (-793.625) [-797.023] (-797.836) -- 0:01:11
370000 -- (-796.480) [-794.755] (-794.632) (-796.977) * (-795.931) (-798.013) (-798.460) [-795.917] -- 0:01:11
Average standard deviation of split frequencies: 0.010937
370500 -- (-799.237) (-799.699) [-793.512] (-804.573) * (-799.993) (-799.118) (-799.210) [-800.450] -- 0:01:11
371000 -- (-805.772) [-794.176] (-800.037) (-796.047) * (-793.159) (-801.651) [-796.411] (-797.859) -- 0:01:11
371500 -- (-796.738) (-799.307) [-796.790] (-804.335) * [-792.947] (-795.292) (-796.739) (-804.248) -- 0:01:11
372000 -- (-801.810) (-799.463) (-795.170) [-793.908] * (-801.957) (-794.273) [-798.518] (-803.145) -- 0:01:10
372500 -- (-801.234) (-800.807) [-791.873] (-797.266) * (-803.646) [-796.210] (-794.553) (-808.123) -- 0:01:10
373000 -- (-796.787) (-803.224) (-801.618) [-796.257] * (-807.512) (-795.229) (-799.251) [-795.939] -- 0:01:10
373500 -- (-797.290) [-797.857] (-795.834) (-793.186) * [-796.278] (-798.322) (-796.462) (-796.516) -- 0:01:10
374000 -- (-796.628) (-796.732) [-801.694] (-797.681) * (-797.778) (-796.709) (-796.986) [-793.951] -- 0:01:10
374500 -- (-804.886) (-791.171) [-797.057] (-795.177) * [-796.337] (-801.135) (-797.489) (-793.887) -- 0:01:10
375000 -- (-797.485) (-797.470) (-798.052) [-793.724] * (-802.244) [-794.722] (-795.075) (-798.146) -- 0:01:10
Average standard deviation of split frequencies: 0.010782
375500 -- (-801.742) (-799.144) [-791.730] (-796.270) * (-793.738) [-796.334] (-799.971) (-797.254) -- 0:01:09
376000 -- [-795.428] (-798.513) (-803.774) (-803.920) * (-800.378) [-795.279] (-796.952) (-796.957) -- 0:01:09
376500 -- (-794.790) (-800.079) (-804.034) [-795.059] * (-800.225) (-795.555) [-798.412] (-800.082) -- 0:01:09
377000 -- (-798.098) (-794.434) (-805.855) [-792.239] * (-800.308) [-802.002] (-799.620) (-799.203) -- 0:01:09
377500 -- (-799.975) [-801.356] (-797.079) (-797.956) * [-802.358] (-803.902) (-801.123) (-799.558) -- 0:01:09
378000 -- (-798.199) [-790.422] (-798.062) (-796.854) * (-795.859) (-801.265) (-799.072) [-798.855] -- 0:01:10
378500 -- (-800.057) [-796.231] (-801.286) (-797.128) * (-798.421) (-802.324) [-794.760] (-793.784) -- 0:01:10
379000 -- (-797.403) (-792.770) [-796.493] (-800.435) * (-801.421) [-794.502] (-802.192) (-794.399) -- 0:01:10
379500 -- (-798.601) (-794.807) [-796.263] (-802.915) * [-796.590] (-802.283) (-793.488) (-803.362) -- 0:01:10
380000 -- (-801.147) [-796.820] (-795.566) (-797.978) * (-798.024) (-794.290) (-797.382) [-792.568] -- 0:01:10
Average standard deviation of split frequencies: 0.012136
380500 -- [-794.209] (-798.927) (-804.939) (-796.748) * (-801.631) (-795.184) [-805.998] (-806.768) -- 0:01:10
381000 -- (-798.049) [-796.836] (-795.561) (-792.461) * (-798.640) (-794.075) [-797.279] (-798.414) -- 0:01:09
381500 -- (-794.915) (-799.873) (-792.490) [-794.602] * [-793.440] (-800.915) (-800.274) (-801.413) -- 0:01:09
382000 -- (-795.690) (-799.947) (-795.961) [-801.150] * (-797.685) (-807.040) [-804.716] (-800.192) -- 0:01:09
382500 -- [-798.187] (-801.663) (-798.270) (-793.402) * (-797.185) [-801.023] (-797.983) (-798.211) -- 0:01:09
383000 -- (-795.003) (-802.466) (-801.039) [-796.646] * (-798.502) (-796.676) [-793.630] (-797.517) -- 0:01:09
383500 -- (-793.271) (-805.363) (-796.927) [-800.018] * (-803.618) (-792.957) [-794.200] (-797.919) -- 0:01:09
384000 -- (-792.584) (-798.218) (-801.410) [-796.094] * [-793.248] (-806.657) (-794.753) (-794.039) -- 0:01:08
384500 -- (-790.427) (-796.285) [-798.542] (-796.127) * (-800.557) (-803.952) [-799.022] (-798.167) -- 0:01:08
385000 -- (-797.364) (-801.149) (-801.997) [-793.939] * [-793.654] (-797.562) (-793.473) (-797.026) -- 0:01:08
Average standard deviation of split frequencies: 0.013190
385500 -- (-799.316) (-796.745) [-796.127] (-804.368) * [-799.810] (-803.484) (-799.248) (-799.805) -- 0:01:08
386000 -- (-792.239) (-797.661) (-794.807) [-796.911] * (-800.255) (-794.771) [-797.730] (-795.624) -- 0:01:08
386500 -- (-795.062) (-802.868) [-792.803] (-795.693) * (-799.207) (-793.633) [-797.082] (-802.408) -- 0:01:08
387000 -- (-802.603) (-800.265) [-791.589] (-801.328) * (-795.795) (-801.329) (-798.173) [-800.658] -- 0:01:09
387500 -- [-794.501] (-793.996) (-799.826) (-796.201) * (-796.925) (-797.761) (-799.726) [-793.791] -- 0:01:09
388000 -- (-794.796) (-800.544) [-796.012] (-799.091) * (-797.992) [-795.644] (-797.442) (-800.124) -- 0:01:09
388500 -- (-797.207) [-798.165] (-791.787) (-800.094) * (-797.401) [-794.531] (-791.057) (-807.478) -- 0:01:09
389000 -- (-799.466) (-802.924) (-801.121) [-798.942] * (-796.285) [-799.135] (-799.835) (-795.927) -- 0:01:09
389500 -- (-798.051) (-802.123) (-798.965) [-799.681] * (-800.849) [-798.090] (-802.884) (-795.215) -- 0:01:08
390000 -- (-800.547) (-797.169) (-802.720) [-795.810] * (-798.361) (-797.374) [-799.215] (-794.193) -- 0:01:08
Average standard deviation of split frequencies: 0.011584
390500 -- (-801.022) (-805.479) (-806.052) [-797.133] * [-794.786] (-799.760) (-794.942) (-797.889) -- 0:01:08
391000 -- (-800.985) [-798.713] (-795.522) (-794.990) * (-796.411) (-798.153) [-800.783] (-795.743) -- 0:01:08
391500 -- [-799.730] (-797.394) (-798.687) (-799.539) * [-795.512] (-798.941) (-797.845) (-801.764) -- 0:01:08
392000 -- [-793.253] (-801.117) (-795.167) (-790.787) * (-797.066) [-795.223] (-797.244) (-804.904) -- 0:01:08
392500 -- [-802.350] (-802.256) (-800.801) (-796.937) * (-795.185) [-794.666] (-795.856) (-800.648) -- 0:01:08
393000 -- [-800.387] (-803.657) (-798.147) (-793.273) * (-809.144) (-805.345) [-796.402] (-796.103) -- 0:01:07
393500 -- (-803.833) (-794.072) [-799.906] (-797.045) * (-798.873) (-801.189) [-796.120] (-796.029) -- 0:01:07
394000 -- (-798.183) (-799.328) (-799.960) [-795.993] * (-793.270) (-797.622) (-799.602) [-799.373] -- 0:01:07
394500 -- [-800.276] (-801.850) (-802.368) (-802.188) * [-795.116] (-794.572) (-795.554) (-796.936) -- 0:01:07
395000 -- [-801.691] (-798.478) (-804.737) (-796.817) * (-796.673) [-798.957] (-802.390) (-802.726) -- 0:01:07
Average standard deviation of split frequencies: 0.012380
395500 -- (-803.222) [-800.424] (-797.404) (-797.247) * [-800.573] (-791.783) (-795.915) (-797.297) -- 0:01:07
396000 -- (-800.610) (-795.788) [-797.302] (-799.245) * (-800.072) [-798.157] (-800.191) (-793.360) -- 0:01:08
396500 -- [-794.664] (-808.694) (-796.001) (-791.560) * (-800.132) [-797.460] (-800.137) (-794.962) -- 0:01:08
397000 -- (-799.472) (-800.853) (-790.824) [-797.864] * (-807.320) (-798.977) (-796.957) [-791.091] -- 0:01:08
397500 -- (-797.719) [-800.365] (-793.388) (-799.304) * [-798.060] (-798.064) (-803.494) (-800.770) -- 0:01:08
398000 -- (-801.199) (-797.274) [-794.722] (-805.395) * (-803.854) (-793.484) (-799.107) [-792.544] -- 0:01:08
398500 -- (-795.496) [-793.393] (-799.583) (-796.779) * (-797.683) (-800.742) (-800.841) [-793.471] -- 0:01:07
399000 -- (-802.753) (-799.088) (-796.356) [-796.566] * [-795.820] (-805.757) (-798.124) (-796.703) -- 0:01:07
399500 -- (-799.467) (-801.598) (-794.916) [-795.841] * [-796.038] (-804.532) (-795.740) (-794.015) -- 0:01:07
400000 -- (-800.372) (-806.989) [-799.898] (-790.567) * [-798.665] (-804.787) (-805.057) (-796.921) -- 0:01:07
Average standard deviation of split frequencies: 0.012236
400500 -- (-795.164) [-792.723] (-813.380) (-794.798) * (-799.714) (-795.612) [-797.143] (-794.970) -- 0:01:07
401000 -- (-795.397) (-796.427) [-795.484] (-793.091) * [-794.205] (-803.829) (-795.968) (-799.439) -- 0:01:07
401500 -- (-797.475) (-794.866) (-795.615) [-795.571] * (-801.098) [-802.749] (-797.664) (-791.009) -- 0:01:07
402000 -- (-797.842) (-792.847) (-797.904) [-793.176] * (-803.205) (-802.265) [-793.812] (-797.082) -- 0:01:06
402500 -- (-799.040) [-794.756] (-799.000) (-800.330) * [-796.269] (-802.665) (-800.371) (-803.600) -- 0:01:06
403000 -- (-798.890) (-795.978) (-797.676) [-793.815] * (-797.307) (-800.292) (-795.494) [-799.419] -- 0:01:06
403500 -- [-795.519] (-801.460) (-800.916) (-794.361) * [-799.330] (-801.587) (-797.330) (-799.340) -- 0:01:06
404000 -- [-795.248] (-796.960) (-796.331) (-797.193) * (-803.935) (-797.311) [-797.839] (-798.340) -- 0:01:06
404500 -- [-797.210] (-794.967) (-793.433) (-793.604) * (-802.452) (-799.339) (-803.131) [-794.575] -- 0:01:06
405000 -- (-794.388) (-797.567) [-796.102] (-801.591) * (-801.869) (-794.552) [-797.371] (-798.638) -- 0:01:07
Average standard deviation of split frequencies: 0.012075
405500 -- (-795.375) (-797.673) (-795.656) [-796.679] * [-793.986] (-795.951) (-803.951) (-802.665) -- 0:01:07
406000 -- (-794.888) (-803.752) (-798.115) [-793.544] * [-794.241] (-800.957) (-798.781) (-798.419) -- 0:01:07
406500 -- (-797.903) (-798.020) [-792.846] (-792.745) * (-804.871) (-804.465) (-800.789) [-793.479] -- 0:01:07
407000 -- (-795.461) (-794.725) [-800.570] (-798.398) * (-803.003) (-798.949) [-796.597] (-800.188) -- 0:01:07
407500 -- (-800.698) [-794.750] (-795.960) (-795.248) * (-796.825) [-794.268] (-795.081) (-800.065) -- 0:01:06
408000 -- (-801.616) [-796.852] (-795.577) (-795.038) * (-793.389) (-797.742) [-790.249] (-801.474) -- 0:01:06
408500 -- (-792.853) (-796.684) (-792.084) [-803.754] * (-795.594) [-791.528] (-795.818) (-797.694) -- 0:01:06
409000 -- (-799.689) [-790.368] (-795.160) (-801.488) * (-794.585) (-795.801) [-797.991] (-809.621) -- 0:01:06
409500 -- (-803.536) (-797.084) [-800.684] (-802.135) * [-792.251] (-792.171) (-799.287) (-799.964) -- 0:01:06
410000 -- (-797.696) (-795.251) [-795.062] (-797.053) * (-801.269) [-798.902] (-800.769) (-799.142) -- 0:01:06
Average standard deviation of split frequencies: 0.011938
410500 -- [-800.679] (-804.093) (-793.044) (-796.044) * (-801.615) (-795.352) (-805.043) [-797.155] -- 0:01:06
411000 -- (-795.901) [-794.032] (-796.493) (-798.560) * (-806.468) (-798.472) (-800.105) [-800.061] -- 0:01:05
411500 -- (-795.955) (-795.538) (-792.462) [-799.096] * [-800.400] (-793.062) (-795.629) (-798.800) -- 0:01:05
412000 -- (-804.413) [-796.529] (-803.463) (-797.304) * (-795.578) [-796.417] (-801.184) (-806.797) -- 0:01:05
412500 -- [-796.801] (-799.682) (-797.645) (-800.225) * (-794.818) (-797.658) [-798.517] (-797.610) -- 0:01:05
413000 -- (-801.370) (-805.837) (-798.284) [-794.109] * (-805.584) [-799.706] (-801.027) (-798.865) -- 0:01:05
413500 -- (-808.007) (-804.696) (-798.743) [-804.838] * [-792.365] (-798.616) (-803.614) (-804.066) -- 0:01:05
414000 -- [-805.393] (-799.789) (-794.664) (-796.788) * (-794.043) [-798.493] (-796.096) (-805.649) -- 0:01:06
414500 -- (-793.066) (-797.538) (-792.930) [-799.182] * [-794.227] (-800.493) (-796.860) (-805.221) -- 0:01:06
415000 -- [-794.561] (-797.505) (-794.176) (-803.052) * (-795.952) (-806.196) [-796.997] (-815.181) -- 0:01:06
Average standard deviation of split frequencies: 0.012012
415500 -- [-798.427] (-794.187) (-799.238) (-797.773) * (-798.024) (-801.724) (-797.691) [-794.827] -- 0:01:06
416000 -- [-799.887] (-806.468) (-793.483) (-796.487) * (-795.062) (-799.707) [-794.899] (-798.676) -- 0:01:05
416500 -- [-794.015] (-797.223) (-802.166) (-798.779) * (-793.326) (-802.083) [-800.261] (-804.163) -- 0:01:05
417000 -- (-797.047) [-795.966] (-804.588) (-795.618) * [-797.578] (-799.378) (-798.291) (-793.995) -- 0:01:05
417500 -- [-793.622] (-801.932) (-799.846) (-793.637) * (-802.310) (-798.839) [-797.771] (-795.512) -- 0:01:05
418000 -- (-795.953) (-802.134) [-799.081] (-797.355) * (-794.776) (-804.459) (-793.347) [-794.769] -- 0:01:05
418500 -- (-800.428) (-801.535) [-795.258] (-802.511) * [-801.213] (-796.848) (-805.614) (-798.146) -- 0:01:05
419000 -- (-794.995) (-798.731) (-803.392) [-797.404] * (-799.690) (-797.779) (-799.733) [-807.294] -- 0:01:05
419500 -- (-796.396) [-797.296] (-795.732) (-802.364) * (-795.510) [-795.658] (-794.321) (-797.371) -- 0:01:05
420000 -- (-800.772) (-793.797) [-793.922] (-805.309) * (-795.257) (-795.296) [-799.219] (-798.023) -- 0:01:04
Average standard deviation of split frequencies: 0.011878
420500 -- (-793.297) (-796.082) [-796.052] (-794.131) * (-797.662) (-794.368) (-793.976) [-796.113] -- 0:01:04
421000 -- (-795.844) [-793.056] (-803.057) (-792.771) * (-798.010) (-798.889) (-793.702) [-796.266] -- 0:01:04
421500 -- (-797.249) (-798.121) [-790.103] (-798.351) * (-798.946) [-794.644] (-798.011) (-807.229) -- 0:01:04
422000 -- (-797.241) (-796.727) (-792.234) [-796.161] * (-796.210) (-796.771) (-791.419) [-796.642] -- 0:01:04
422500 -- (-795.365) (-795.098) (-796.980) [-797.764] * [-797.639] (-797.258) (-799.249) (-799.847) -- 0:01:04
423000 -- (-801.525) [-796.602] (-798.015) (-793.650) * (-799.483) (-802.824) [-791.847] (-798.095) -- 0:01:05
423500 -- (-794.844) (-802.769) (-803.899) [-794.361] * (-793.097) (-797.514) [-796.205] (-806.565) -- 0:01:05
424000 -- [-793.378] (-795.003) (-800.323) (-796.055) * (-794.844) (-800.690) (-798.848) [-793.740] -- 0:01:05
424500 -- [-799.669] (-802.694) (-791.893) (-798.647) * (-806.196) [-803.044] (-798.695) (-791.083) -- 0:01:05
425000 -- [-797.080] (-795.749) (-799.366) (-797.113) * (-794.152) (-797.996) [-791.780] (-795.777) -- 0:01:04
Average standard deviation of split frequencies: 0.011287
425500 -- [-795.956] (-794.377) (-801.005) (-799.769) * (-792.833) (-797.711) [-796.225] (-798.487) -- 0:01:04
426000 -- [-802.882] (-796.524) (-798.529) (-796.917) * (-802.818) [-794.969] (-795.278) (-798.813) -- 0:01:04
426500 -- [-801.022] (-799.300) (-796.310) (-797.586) * (-797.661) (-795.710) (-799.945) [-795.490] -- 0:01:04
427000 -- [-798.630] (-793.470) (-798.901) (-802.597) * (-806.267) (-800.530) (-794.066) [-796.897] -- 0:01:04
427500 -- (-796.897) (-801.124) [-795.072] (-794.404) * (-795.277) (-805.796) [-797.770] (-798.407) -- 0:01:04
428000 -- (-799.012) (-795.646) (-797.996) [-792.961] * (-800.032) [-794.028] (-792.272) (-800.781) -- 0:01:04
428500 -- [-795.460] (-797.872) (-803.644) (-793.269) * (-797.160) [-793.042] (-801.729) (-802.843) -- 0:01:04
429000 -- (-802.057) [-797.718] (-798.722) (-797.576) * (-806.556) (-793.469) (-800.809) [-799.901] -- 0:01:03
429500 -- [-793.841] (-808.272) (-792.485) (-792.873) * (-797.823) (-796.943) (-798.341) [-793.745] -- 0:01:03
430000 -- (-797.856) (-798.009) [-800.799] (-798.129) * (-802.977) (-802.263) [-798.321] (-795.929) -- 0:01:03
Average standard deviation of split frequencies: 0.010727
430500 -- (-796.455) [-794.418] (-796.785) (-799.765) * (-792.049) [-790.792] (-795.667) (-797.388) -- 0:01:03
431000 -- [-796.760] (-799.672) (-798.930) (-799.101) * (-796.042) (-798.780) (-794.560) [-795.055] -- 0:01:03
431500 -- (-793.385) (-797.200) (-798.351) [-795.972] * (-797.759) [-797.021] (-799.233) (-799.587) -- 0:01:03
432000 -- (-793.223) (-796.925) [-796.781] (-796.143) * (-792.692) (-798.014) [-795.459] (-795.671) -- 0:01:04
432500 -- [-798.194] (-796.524) (-800.484) (-803.464) * [-798.892] (-797.852) (-798.927) (-794.197) -- 0:01:04
433000 -- (-798.285) (-804.503) [-795.109] (-802.623) * (-796.961) (-800.206) [-798.172] (-796.718) -- 0:01:04
433500 -- [-793.342] (-793.801) (-794.736) (-799.391) * [-792.899] (-796.709) (-803.195) (-808.617) -- 0:01:04
434000 -- (-794.695) (-803.772) (-800.693) [-796.632] * (-794.480) [-800.883] (-803.383) (-800.063) -- 0:01:03
434500 -- (-797.536) (-799.146) [-796.649] (-797.014) * (-796.754) [-795.238] (-802.111) (-801.683) -- 0:01:03
435000 -- [-800.762] (-803.883) (-800.157) (-799.998) * [-794.918] (-802.223) (-800.449) (-798.373) -- 0:01:03
Average standard deviation of split frequencies: 0.010596
435500 -- (-797.515) [-797.692] (-795.868) (-801.864) * [-795.194] (-795.387) (-801.176) (-797.292) -- 0:01:03
436000 -- (-794.645) (-796.856) (-801.974) [-795.593] * [-796.020] (-795.694) (-794.261) (-804.917) -- 0:01:03
436500 -- (-799.645) (-798.908) [-792.374] (-797.121) * (-795.357) [-795.935] (-799.062) (-794.986) -- 0:01:03
437000 -- (-792.887) (-793.777) (-797.074) [-798.206] * (-796.176) (-796.302) (-796.161) [-793.940] -- 0:01:03
437500 -- (-794.142) [-790.783] (-801.746) (-802.610) * (-796.173) (-797.535) [-799.156] (-793.405) -- 0:01:03
438000 -- (-806.398) (-796.138) [-802.051] (-799.703) * (-791.242) (-799.221) [-795.706] (-804.483) -- 0:01:02
438500 -- (-803.281) [-794.301] (-802.131) (-795.261) * (-792.407) [-796.899] (-798.259) (-794.200) -- 0:01:02
439000 -- (-798.742) (-793.803) [-798.195] (-799.278) * (-795.469) (-804.156) (-796.756) [-798.516] -- 0:01:02
439500 -- (-794.706) (-795.171) [-805.507] (-796.246) * [-804.524] (-798.696) (-797.322) (-801.424) -- 0:01:02
440000 -- [-802.878] (-795.606) (-798.443) (-802.543) * (-802.959) (-800.694) (-793.938) [-791.211] -- 0:01:02
Average standard deviation of split frequencies: 0.010056
440500 -- (-794.489) (-797.267) [-794.110] (-794.854) * (-800.879) [-799.088] (-801.244) (-795.836) -- 0:01:02
441000 -- (-794.499) (-795.354) (-799.783) [-793.712] * (-796.804) (-798.825) [-790.531] (-795.320) -- 0:01:03
441500 -- (-799.059) (-796.993) [-799.549] (-797.221) * (-793.140) (-801.372) (-800.445) [-795.614] -- 0:01:03
442000 -- (-790.988) (-797.943) [-798.580] (-795.709) * [-801.762] (-800.854) (-796.990) (-796.902) -- 0:01:03
442500 -- [-790.485] (-801.331) (-803.155) (-796.448) * (-795.041) [-796.382] (-803.645) (-797.453) -- 0:01:02
443000 -- (-799.567) (-797.743) (-796.071) [-797.838] * (-799.922) (-804.480) [-799.093] (-802.895) -- 0:01:02
443500 -- (-801.045) (-796.381) (-796.597) [-792.057] * (-794.362) [-794.491] (-804.375) (-796.509) -- 0:01:02
444000 -- (-794.232) (-796.327) [-791.633] (-798.095) * [-797.031] (-802.236) (-801.083) (-797.125) -- 0:01:02
444500 -- (-795.789) (-795.767) (-796.498) [-791.080] * (-798.425) [-798.479] (-802.601) (-797.713) -- 0:01:02
445000 -- (-790.146) [-800.208] (-792.526) (-801.113) * (-801.512) (-796.000) [-798.485] (-797.767) -- 0:01:02
Average standard deviation of split frequencies: 0.010992
445500 -- (-800.963) (-795.254) [-795.242] (-797.137) * (-804.052) (-795.400) [-797.165] (-792.855) -- 0:01:02
446000 -- (-798.991) (-796.976) (-796.234) [-793.087] * (-799.954) (-799.436) (-793.100) [-792.756] -- 0:01:02
446500 -- (-804.377) (-794.639) (-804.550) [-795.906] * [-793.278] (-795.253) (-797.175) (-800.277) -- 0:01:01
447000 -- (-804.340) (-795.642) (-801.365) [-794.757] * [-801.033] (-795.140) (-803.104) (-797.781) -- 0:01:01
447500 -- (-798.291) [-798.350] (-801.544) (-811.614) * [-794.806] (-794.940) (-798.065) (-794.735) -- 0:01:01
448000 -- (-799.842) (-801.319) [-794.176] (-803.128) * (-792.572) (-794.915) [-797.353] (-795.910) -- 0:01:01
448500 -- (-799.672) (-796.032) (-798.436) [-796.046] * (-800.628) (-798.864) (-801.759) [-795.164] -- 0:01:01
449000 -- (-797.893) [-795.080] (-795.825) (-791.405) * [-799.368] (-796.098) (-799.077) (-801.407) -- 0:01:01
449500 -- (-804.549) [-796.406] (-801.643) (-798.111) * (-798.137) (-799.240) (-796.208) [-798.367] -- 0:01:01
450000 -- [-792.467] (-799.807) (-800.213) (-798.483) * [-794.349] (-802.709) (-793.264) (-794.297) -- 0:01:02
Average standard deviation of split frequencies: 0.011506
450500 -- (-798.144) (-793.233) [-802.274] (-803.239) * (-805.257) (-800.722) [-799.453] (-794.701) -- 0:01:02
451000 -- [-794.679] (-797.963) (-807.018) (-804.569) * (-799.498) (-798.462) [-794.478] (-795.383) -- 0:01:02
451500 -- (-796.633) [-792.629] (-796.176) (-795.838) * (-794.726) (-795.486) [-798.665] (-798.182) -- 0:01:01
452000 -- (-801.404) [-797.765] (-797.360) (-802.570) * (-796.671) (-799.276) [-796.576] (-798.895) -- 0:01:01
452500 -- (-796.720) (-793.361) [-794.460] (-801.986) * [-796.684] (-798.454) (-796.093) (-800.640) -- 0:01:01
453000 -- [-796.053] (-798.856) (-797.726) (-790.714) * (-797.960) (-793.142) [-795.306] (-796.249) -- 0:01:01
453500 -- (-800.890) (-791.102) (-795.134) [-793.535] * (-801.369) [-794.669] (-800.795) (-801.175) -- 0:01:01
454000 -- (-797.318) (-800.961) (-798.562) [-797.734] * (-800.608) (-798.540) [-796.455] (-797.129) -- 0:01:01
454500 -- (-798.475) [-798.676] (-809.851) (-799.557) * (-797.242) (-793.713) [-795.725] (-804.701) -- 0:01:01
455000 -- (-793.495) (-800.340) [-801.394] (-797.192) * (-799.049) [-798.958] (-797.997) (-799.385) -- 0:01:01
Average standard deviation of split frequencies: 0.009718
455500 -- (-796.141) [-803.653] (-799.300) (-795.195) * (-792.401) (-800.097) [-802.597] (-794.054) -- 0:01:00
456000 -- [-795.715] (-796.416) (-800.952) (-800.131) * [-792.654] (-800.973) (-792.746) (-797.916) -- 0:01:00
456500 -- (-796.303) [-800.042] (-801.623) (-804.335) * (-800.244) (-793.148) [-793.672] (-795.171) -- 0:01:00
457000 -- [-798.249] (-797.653) (-796.659) (-801.749) * (-794.344) [-795.491] (-795.686) (-799.784) -- 0:01:00
457500 -- (-796.639) (-799.417) (-795.535) [-797.515] * (-792.638) (-794.034) [-792.946] (-799.309) -- 0:01:00
458000 -- (-801.585) (-797.353) (-796.458) [-794.606] * [-804.020] (-800.808) (-802.047) (-798.588) -- 0:01:00
458500 -- (-798.737) (-808.012) (-793.888) [-792.710] * [-795.358] (-796.269) (-797.905) (-798.017) -- 0:01:00
459000 -- (-795.358) (-794.430) [-797.607] (-795.553) * (-797.139) [-792.820] (-794.223) (-797.859) -- 0:01:01
459500 -- (-796.598) [-794.238] (-798.004) (-795.118) * (-799.888) (-800.050) (-796.040) [-798.870] -- 0:01:01
460000 -- (-796.568) (-795.571) [-795.883] (-797.009) * (-805.418) (-797.813) [-796.129] (-799.386) -- 0:01:01
Average standard deviation of split frequencies: 0.008391
460500 -- (-802.589) [-794.917] (-801.742) (-798.609) * (-803.408) [-800.000] (-802.355) (-804.525) -- 0:01:00
461000 -- (-794.955) [-795.073] (-793.837) (-796.145) * (-799.521) [-796.454] (-797.481) (-802.687) -- 0:01:00
461500 -- (-804.409) (-798.915) [-795.567] (-795.328) * (-797.578) (-799.816) (-801.984) [-794.586] -- 0:01:00
462000 -- [-795.026] (-793.939) (-797.575) (-796.718) * (-797.315) (-800.711) [-792.542] (-796.875) -- 0:01:00
462500 -- (-802.437) (-795.387) (-797.781) [-795.306] * [-794.455] (-799.734) (-801.202) (-794.064) -- 0:01:00
463000 -- (-797.679) (-799.856) (-795.530) [-799.318] * (-798.439) [-795.487] (-793.933) (-800.777) -- 0:01:00
463500 -- (-796.567) [-796.653] (-793.862) (-795.043) * (-792.932) (-794.812) [-800.634] (-800.304) -- 0:01:00
464000 -- (-797.812) (-797.352) [-795.804] (-793.716) * (-795.481) (-799.475) [-798.172] (-799.231) -- 0:01:00
464500 -- (-802.020) [-795.736] (-801.119) (-800.167) * (-799.104) (-798.179) [-800.688] (-800.288) -- 0:00:59
465000 -- [-799.566] (-798.237) (-799.215) (-791.060) * (-799.176) (-800.705) (-802.135) [-793.097] -- 0:00:59
Average standard deviation of split frequencies: 0.009307
465500 -- (-796.184) [-795.182] (-798.595) (-798.828) * (-795.857) [-797.537] (-793.814) (-806.199) -- 0:00:59
466000 -- (-794.788) [-795.053] (-797.278) (-794.665) * (-802.278) (-797.386) [-793.786] (-799.075) -- 0:00:59
466500 -- (-799.453) (-798.767) (-798.788) [-798.082] * (-802.206) [-795.725] (-806.189) (-795.350) -- 0:00:59
467000 -- (-802.508) (-794.050) (-795.888) [-795.072] * (-795.661) (-804.504) [-802.484] (-799.157) -- 0:00:59
467500 -- (-797.567) (-791.794) (-799.062) [-796.009] * (-796.992) [-799.292] (-802.487) (-802.622) -- 0:00:59
468000 -- [-792.166] (-797.550) (-798.553) (-794.997) * (-799.908) (-805.850) (-797.736) [-799.189] -- 0:01:00
468500 -- (-796.970) (-801.332) (-798.214) [-795.343] * (-797.959) (-797.757) [-792.354] (-797.332) -- 0:01:00
469000 -- [-801.301] (-793.339) (-794.254) (-803.563) * [-796.911] (-801.050) (-799.725) (-797.979) -- 0:01:00
469500 -- (-802.922) (-796.530) (-792.963) [-798.028] * (-794.759) (-791.830) [-801.418] (-798.992) -- 0:00:59
470000 -- (-800.711) (-801.306) [-797.376] (-797.889) * [-797.329] (-795.590) (-802.317) (-799.584) -- 0:00:59
Average standard deviation of split frequencies: 0.008814
470500 -- [-789.870] (-796.309) (-806.882) (-796.024) * (-795.414) (-795.487) (-800.735) [-797.808] -- 0:00:59
471000 -- (-792.041) (-796.128) [-794.428] (-798.317) * (-802.177) [-795.357] (-795.096) (-800.157) -- 0:00:59
471500 -- [-799.072] (-794.509) (-792.286) (-798.880) * (-797.065) [-798.200] (-794.665) (-800.719) -- 0:00:59
472000 -- [-795.382] (-798.227) (-802.103) (-799.100) * (-797.766) [-793.553] (-796.442) (-800.109) -- 0:00:59
472500 -- (-808.131) (-793.409) [-796.991] (-800.225) * (-800.969) (-798.135) (-793.038) [-797.853] -- 0:00:59
473000 -- (-804.157) (-805.601) (-802.023) [-796.125] * (-798.912) (-800.762) [-795.181] (-794.131) -- 0:00:59
473500 -- (-804.718) (-797.266) [-792.122] (-792.884) * (-800.392) [-795.459] (-794.127) (-798.391) -- 0:00:58
474000 -- (-799.426) (-794.000) (-795.507) [-797.453] * [-795.294] (-806.799) (-796.005) (-799.751) -- 0:00:58
474500 -- (-798.958) [-795.788] (-796.961) (-797.773) * [-795.868] (-792.665) (-800.283) (-798.559) -- 0:00:58
475000 -- (-804.355) (-798.168) [-795.861] (-794.871) * (-793.718) [-792.818] (-804.301) (-801.185) -- 0:00:58
Average standard deviation of split frequencies: 0.008121
475500 -- (-800.539) (-795.547) [-796.351] (-793.397) * (-793.788) (-794.682) [-794.475] (-800.231) -- 0:00:58
476000 -- (-803.049) (-800.940) (-799.281) [-791.799] * (-800.436) (-793.586) [-794.443] (-796.522) -- 0:00:58
476500 -- (-791.443) (-796.835) (-797.960) [-796.401] * [-794.724] (-802.686) (-792.965) (-799.425) -- 0:00:58
477000 -- (-798.561) (-800.714) [-790.498] (-796.646) * (-800.036) (-801.039) [-800.126] (-796.134) -- 0:00:59
477500 -- [-797.690] (-799.823) (-792.098) (-795.188) * [-798.275] (-798.890) (-806.676) (-795.662) -- 0:00:59
478000 -- (-804.067) (-795.972) (-800.420) [-800.328] * (-801.174) (-795.054) (-795.745) [-798.032] -- 0:00:58
478500 -- [-797.164] (-804.510) (-802.877) (-795.728) * (-796.436) [-795.988] (-796.500) (-796.274) -- 0:00:58
479000 -- [-795.606] (-801.029) (-797.664) (-805.195) * (-791.794) (-797.213) (-796.274) [-797.205] -- 0:00:58
479500 -- [-799.602] (-796.901) (-799.876) (-794.874) * [-794.675] (-797.071) (-795.797) (-796.219) -- 0:00:58
480000 -- (-798.372) (-793.919) [-798.218] (-792.560) * [-794.855] (-794.908) (-801.205) (-797.682) -- 0:00:58
Average standard deviation of split frequencies: 0.007454
480500 -- [-801.512] (-804.805) (-799.914) (-796.640) * (-801.456) (-797.051) [-796.812] (-800.324) -- 0:00:58
481000 -- (-798.078) [-791.765] (-800.573) (-798.330) * (-800.133) [-791.186] (-795.141) (-794.771) -- 0:00:58
481500 -- (-801.475) [-800.288] (-796.604) (-799.344) * (-795.968) (-795.371) [-791.801] (-798.833) -- 0:00:58
482000 -- (-803.927) (-791.956) [-795.217] (-806.677) * [-793.003] (-795.990) (-800.508) (-797.151) -- 0:00:58
482500 -- (-806.362) (-794.475) (-799.290) [-797.492] * (-796.514) (-796.083) [-794.175] (-802.121) -- 0:00:57
483000 -- (-795.533) (-798.096) [-791.533] (-798.995) * (-795.137) (-798.705) [-801.395] (-803.481) -- 0:00:57
483500 -- (-794.998) (-807.161) [-798.400] (-793.333) * (-799.011) (-798.096) (-803.152) [-796.728] -- 0:00:57
484000 -- [-798.277] (-796.748) (-793.069) (-800.129) * [-794.605] (-796.476) (-793.089) (-798.399) -- 0:00:57
484500 -- (-804.143) (-795.870) [-796.847] (-797.715) * (-795.316) [-801.168] (-807.253) (-801.949) -- 0:00:57
485000 -- [-801.595] (-800.926) (-792.969) (-797.697) * (-805.635) [-799.230] (-795.464) (-798.017) -- 0:00:57
Average standard deviation of split frequencies: 0.006984
485500 -- (-790.598) (-801.918) (-799.351) [-795.510] * (-796.312) [-797.585] (-798.279) (-804.357) -- 0:00:58
486000 -- (-800.222) (-799.793) (-802.483) [-801.486] * (-796.911) [-794.730] (-798.542) (-804.785) -- 0:00:58
486500 -- (-802.716) [-798.319] (-806.298) (-796.303) * (-797.100) (-791.101) (-795.973) [-801.037] -- 0:00:58
487000 -- (-792.978) (-795.793) (-794.012) [-800.642] * (-805.685) [-796.535] (-799.684) (-800.493) -- 0:00:57
487500 -- (-794.103) (-803.114) [-794.800] (-797.389) * (-798.785) [-799.836] (-795.679) (-796.353) -- 0:00:57
488000 -- [-808.131] (-796.281) (-793.373) (-796.698) * (-792.937) (-799.956) [-796.952] (-796.782) -- 0:00:57
488500 -- [-794.593] (-795.389) (-795.234) (-794.709) * (-799.203) [-805.393] (-796.261) (-797.127) -- 0:00:57
489000 -- [-796.562] (-797.868) (-796.889) (-797.183) * [-798.990] (-797.168) (-794.369) (-805.858) -- 0:00:57
489500 -- (-803.008) [-798.460] (-797.017) (-798.644) * [-797.066] (-795.162) (-795.379) (-795.952) -- 0:00:57
490000 -- (-802.081) (-801.648) (-799.043) [-797.585] * (-801.915) [-804.029] (-798.137) (-801.241) -- 0:00:57
Average standard deviation of split frequencies: 0.007302
490500 -- [-797.991] (-802.616) (-798.950) (-794.908) * [-795.591] (-798.367) (-802.807) (-796.075) -- 0:00:57
491000 -- [-794.688] (-805.721) (-799.593) (-794.067) * (-796.689) (-801.190) [-793.373] (-798.473) -- 0:00:57
491500 -- (-796.138) [-796.987] (-802.882) (-807.639) * (-800.086) (-794.673) [-796.565] (-797.119) -- 0:00:56
492000 -- (-793.624) (-798.150) [-800.601] (-796.854) * (-800.065) (-794.856) [-797.875] (-798.953) -- 0:00:56
492500 -- (-797.114) [-800.084] (-797.443) (-800.321) * (-794.591) (-794.896) [-795.585] (-797.500) -- 0:00:56
493000 -- (-798.386) (-805.061) (-798.449) [-796.516] * (-804.874) (-797.578) [-797.091] (-797.818) -- 0:00:56
493500 -- (-798.887) (-799.060) [-793.043] (-799.479) * [-795.946] (-794.271) (-796.599) (-795.071) -- 0:00:56
494000 -- (-798.637) [-796.994] (-795.712) (-793.423) * (-794.166) (-794.104) (-800.465) [-802.271] -- 0:00:56
494500 -- [-796.378] (-794.781) (-798.179) (-800.723) * [-792.873] (-803.086) (-794.622) (-797.887) -- 0:00:57
495000 -- [-800.855] (-801.560) (-800.899) (-798.447) * (-804.613) (-803.614) [-793.871] (-801.600) -- 0:00:57
Average standard deviation of split frequencies: 0.007223
495500 -- (-794.062) (-803.079) (-803.814) [-794.651] * (-796.114) [-795.938] (-798.965) (-809.638) -- 0:00:57
496000 -- (-801.058) (-797.474) [-799.368] (-799.584) * (-792.307) [-791.784] (-798.479) (-797.383) -- 0:00:56
496500 -- (-796.111) (-798.945) (-804.418) [-797.542] * (-794.111) [-800.131] (-799.689) (-793.514) -- 0:00:56
497000 -- (-796.477) (-804.240) (-794.763) [-797.399] * (-800.030) [-807.307] (-799.180) (-794.558) -- 0:00:56
497500 -- [-794.781] (-802.920) (-799.005) (-797.789) * (-810.185) (-796.194) (-804.335) [-796.734] -- 0:00:56
498000 -- [-796.310] (-789.719) (-795.171) (-800.995) * (-800.914) (-803.151) (-800.541) [-801.245] -- 0:00:56
498500 -- [-792.905] (-794.338) (-798.106) (-798.171) * (-796.560) (-797.418) (-792.604) [-791.321] -- 0:00:56
499000 -- (-796.249) [-792.749] (-794.768) (-801.639) * (-791.789) [-795.678] (-799.228) (-793.522) -- 0:00:56
499500 -- (-797.303) [-808.670] (-801.675) (-797.623) * (-802.994) (-791.601) [-795.611] (-797.714) -- 0:00:56
500000 -- (-794.834) (-795.666) [-798.165] (-799.028) * [-792.652] (-797.587) (-801.450) (-800.861) -- 0:00:56
Average standard deviation of split frequencies: 0.007721
500500 -- [-795.754] (-795.579) (-793.643) (-799.462) * (-801.364) (-802.765) (-794.024) [-794.908] -- 0:00:55
501000 -- [-796.029] (-796.511) (-799.586) (-799.053) * (-804.807) (-798.485) (-795.875) [-797.090] -- 0:00:55
501500 -- (-799.845) [-796.825] (-800.051) (-793.382) * (-799.156) [-795.099] (-801.309) (-797.640) -- 0:00:55
502000 -- (-796.339) (-800.297) [-795.284] (-806.779) * (-797.639) [-794.526] (-793.822) (-794.440) -- 0:00:55
502500 -- [-796.198] (-804.640) (-798.979) (-795.352) * (-795.919) [-799.963] (-799.158) (-799.547) -- 0:00:55
503000 -- (-793.907) (-799.907) [-793.949] (-800.454) * (-801.147) [-791.948] (-798.105) (-795.989) -- 0:00:55
503500 -- (-794.323) [-797.766] (-793.860) (-798.208) * (-802.279) (-796.555) (-800.709) [-794.066] -- 0:00:56
504000 -- (-794.859) (-793.106) [-792.901] (-801.196) * (-796.500) (-797.761) (-801.230) [-793.968] -- 0:00:56
504500 -- (-800.364) (-798.856) [-794.195] (-798.542) * (-800.098) [-799.303] (-799.418) (-792.121) -- 0:00:55
505000 -- (-797.683) (-797.023) [-796.842] (-795.344) * (-803.975) [-798.644] (-794.220) (-797.745) -- 0:00:55
Average standard deviation of split frequencies: 0.007639
505500 -- (-798.569) [-794.885] (-794.047) (-793.752) * (-795.745) (-798.473) (-792.499) [-794.187] -- 0:00:55
506000 -- (-801.162) (-796.083) (-805.308) [-797.059] * (-794.768) (-798.250) (-796.398) [-796.010] -- 0:00:55
506500 -- (-795.937) (-801.004) (-796.335) [-794.742] * [-793.830] (-799.315) (-796.114) (-799.244) -- 0:00:55
507000 -- (-801.124) (-795.053) [-791.034] (-798.557) * [-795.278] (-802.628) (-801.933) (-795.910) -- 0:00:55
507500 -- (-802.049) [-801.007] (-798.860) (-794.302) * (-803.232) [-799.632] (-798.038) (-792.731) -- 0:00:55
508000 -- (-797.032) [-795.210] (-796.279) (-794.892) * (-796.405) (-800.102) (-794.352) [-799.774] -- 0:00:55
508500 -- (-794.866) (-796.629) (-802.483) [-799.209] * (-793.834) [-795.982] (-794.183) (-795.280) -- 0:00:55
509000 -- (-794.918) (-795.280) (-803.574) [-793.417] * (-797.972) [-792.124] (-794.103) (-792.652) -- 0:00:54
509500 -- (-804.448) [-793.382] (-804.853) (-796.821) * (-799.740) [-798.134] (-801.631) (-798.004) -- 0:00:54
510000 -- [-800.997] (-804.186) (-795.893) (-799.263) * [-801.926] (-798.944) (-802.687) (-798.229) -- 0:00:54
Average standard deviation of split frequencies: 0.007570
510500 -- [-793.406] (-793.745) (-794.502) (-800.734) * (-801.160) [-791.849] (-803.802) (-800.422) -- 0:00:54
511000 -- [-795.073] (-796.483) (-798.577) (-800.167) * (-803.201) [-793.089] (-795.652) (-794.323) -- 0:00:54
511500 -- (-797.419) [-797.751] (-793.353) (-793.994) * (-801.447) (-794.043) [-798.837] (-798.493) -- 0:00:54
512000 -- (-796.012) (-799.883) [-802.658] (-796.488) * (-793.326) (-791.264) [-793.996] (-796.880) -- 0:00:54
512500 -- [-798.495] (-795.870) (-796.656) (-793.134) * (-805.629) (-801.132) [-794.050] (-798.093) -- 0:00:54
513000 -- [-800.022] (-804.599) (-793.602) (-797.922) * (-796.502) [-792.094] (-794.692) (-793.932) -- 0:00:55
513500 -- (-797.450) (-803.210) (-796.093) [-793.515] * (-794.217) [-796.021] (-798.107) (-800.928) -- 0:00:54
514000 -- (-800.611) (-799.732) (-798.161) [-790.334] * (-796.073) [-794.913] (-795.773) (-796.696) -- 0:00:54
514500 -- [-798.414] (-797.547) (-803.059) (-805.256) * (-804.253) [-793.838] (-801.006) (-799.513) -- 0:00:54
515000 -- (-802.668) (-805.137) (-804.144) [-794.629] * (-793.976) [-791.959] (-800.203) (-799.057) -- 0:00:54
Average standard deviation of split frequencies: 0.008039
515500 -- (-803.202) [-803.598] (-803.064) (-794.350) * [-795.603] (-795.442) (-797.832) (-792.774) -- 0:00:54
516000 -- (-800.190) [-800.583] (-795.709) (-793.120) * (-799.668) (-796.147) [-792.329] (-796.005) -- 0:00:54
516500 -- (-796.562) (-791.060) (-792.564) [-795.536] * (-797.875) (-799.123) [-794.132] (-797.003) -- 0:00:54
517000 -- [-794.288] (-796.939) (-806.038) (-800.005) * (-791.671) [-795.428] (-794.505) (-794.716) -- 0:00:54
517500 -- [-801.785] (-798.245) (-799.742) (-794.304) * (-798.865) [-796.900] (-797.072) (-799.411) -- 0:00:54
518000 -- (-797.176) [-796.203] (-796.661) (-799.234) * (-794.409) (-795.767) [-795.173] (-795.989) -- 0:00:53
518500 -- (-795.256) [-798.710] (-799.490) (-797.054) * [-799.258] (-798.943) (-796.917) (-794.006) -- 0:00:53
519000 -- (-790.914) [-797.830] (-793.475) (-794.845) * [-797.210] (-797.736) (-798.628) (-791.555) -- 0:00:53
519500 -- (-808.734) (-799.642) (-801.602) [-792.159] * (-802.349) (-804.140) [-795.290] (-793.576) -- 0:00:53
520000 -- (-806.001) (-800.497) (-794.903) [-795.669] * (-795.753) [-794.523] (-796.994) (-800.336) -- 0:00:53
Average standard deviation of split frequencies: 0.007062
520500 -- (-796.954) [-793.971] (-791.899) (-795.868) * (-802.911) (-795.703) [-792.045] (-804.729) -- 0:00:53
521000 -- [-798.370] (-799.035) (-795.271) (-797.364) * (-799.105) (-801.017) (-790.819) [-801.877] -- 0:00:53
521500 -- [-800.967] (-802.848) (-794.335) (-799.943) * (-795.958) (-795.006) [-793.631] (-799.616) -- 0:00:53
522000 -- (-799.265) [-799.118] (-800.730) (-796.076) * (-801.498) (-803.099) (-798.237) [-799.962] -- 0:00:54
522500 -- (-798.445) (-802.870) [-793.370] (-807.901) * (-795.808) (-796.863) (-795.801) [-801.445] -- 0:00:53
523000 -- [-794.225] (-806.539) (-801.894) (-799.280) * (-794.035) (-797.017) (-803.760) [-804.221] -- 0:00:53
523500 -- (-790.540) (-798.723) [-801.412] (-795.924) * (-797.817) (-799.683) [-796.766] (-795.954) -- 0:00:53
524000 -- (-798.826) (-797.224) (-799.286) [-793.635] * (-797.732) (-797.078) [-797.938] (-810.053) -- 0:00:53
524500 -- (-794.976) (-802.249) [-790.650] (-797.967) * (-796.531) (-799.829) (-798.563) [-795.025] -- 0:00:53
525000 -- (-792.873) (-798.873) [-798.970] (-801.094) * (-796.239) [-792.313] (-795.678) (-793.421) -- 0:00:53
Average standard deviation of split frequencies: 0.007170
525500 -- (-796.203) (-801.292) [-795.446] (-799.013) * (-799.500) [-792.930] (-805.124) (-799.580) -- 0:00:53
526000 -- [-795.641] (-796.820) (-800.386) (-799.194) * [-796.195] (-801.490) (-795.295) (-795.626) -- 0:00:53
526500 -- (-802.235) (-798.094) [-800.059] (-800.060) * (-795.870) (-794.340) (-800.149) [-789.959] -- 0:00:53
527000 -- [-794.105] (-792.836) (-804.553) (-797.605) * (-795.596) (-797.682) [-807.977] (-801.234) -- 0:00:52
527500 -- (-799.478) (-796.521) (-800.807) [-795.301] * (-797.059) (-799.382) [-791.288] (-802.472) -- 0:00:52
528000 -- (-794.974) (-801.968) [-794.923] (-797.028) * (-793.505) (-795.553) (-802.664) [-797.342] -- 0:00:52
528500 -- (-798.768) (-799.059) [-804.232] (-799.932) * (-795.916) (-797.085) [-798.424] (-793.049) -- 0:00:52
529000 -- (-795.651) (-795.387) [-797.411] (-795.038) * [-795.579] (-794.772) (-799.750) (-798.537) -- 0:00:52
529500 -- [-795.112] (-793.167) (-792.201) (-799.095) * (-803.362) (-795.009) [-795.908] (-794.116) -- 0:00:52
530000 -- [-798.058] (-802.035) (-798.414) (-796.656) * (-800.969) [-797.734] (-800.881) (-798.947) -- 0:00:52
Average standard deviation of split frequencies: 0.007107
530500 -- (-796.745) (-795.948) [-798.577] (-798.738) * (-799.975) (-798.213) (-800.952) [-798.844] -- 0:00:52
531000 -- (-801.598) (-800.009) (-794.445) [-797.682] * (-797.166) [-795.039] (-795.110) (-794.962) -- 0:00:52
531500 -- (-797.405) [-794.517] (-803.210) (-799.254) * (-794.088) (-799.452) [-798.866] (-791.468) -- 0:00:52
532000 -- (-803.690) [-796.317] (-794.190) (-798.157) * (-797.350) [-796.593] (-796.796) (-791.227) -- 0:00:52
532500 -- [-795.932] (-798.630) (-805.182) (-792.270) * (-803.759) (-795.228) (-802.426) [-790.590] -- 0:00:52
533000 -- (-791.428) (-799.781) (-797.719) [-797.641] * (-800.510) (-799.843) [-797.539] (-799.253) -- 0:00:52
533500 -- (-797.326) (-796.563) (-801.534) [-795.031] * [-791.342] (-797.047) (-796.638) (-795.324) -- 0:00:52
534000 -- (-798.206) (-799.161) (-798.231) [-794.073] * [-795.667] (-796.817) (-794.234) (-798.097) -- 0:00:52
534500 -- (-805.212) [-798.029] (-794.156) (-799.882) * (-795.870) (-796.573) [-792.983] (-796.107) -- 0:00:52
535000 -- (-797.277) (-794.550) (-805.440) [-797.783] * (-804.937) (-798.689) (-794.873) [-798.459] -- 0:00:52
Average standard deviation of split frequencies: 0.007388
535500 -- [-802.848] (-800.039) (-798.259) (-805.264) * (-799.182) (-802.424) (-794.265) [-798.018] -- 0:00:52
536000 -- (-804.336) [-796.037] (-798.542) (-796.739) * (-798.310) (-807.824) (-794.923) [-795.954] -- 0:00:51
536500 -- (-796.530) (-795.421) (-797.811) [-800.533] * [-796.102] (-802.489) (-799.840) (-797.336) -- 0:00:51
537000 -- (-800.048) (-795.315) (-795.787) [-796.640] * (-797.283) (-795.587) (-796.129) [-800.172] -- 0:00:51
537500 -- (-799.346) (-798.564) [-797.162] (-796.561) * (-801.884) (-794.746) (-799.406) [-802.219] -- 0:00:51
538000 -- (-798.109) [-794.156] (-798.664) (-799.213) * (-794.476) (-802.412) (-798.200) [-796.849] -- 0:00:51
538500 -- [-793.091] (-798.618) (-797.271) (-800.476) * [-794.339] (-798.720) (-797.631) (-795.327) -- 0:00:51
539000 -- (-807.198) (-797.889) [-791.675] (-800.757) * [-796.095] (-798.832) (-799.127) (-796.096) -- 0:00:51
539500 -- [-810.135] (-796.603) (-792.796) (-796.650) * (-792.315) [-797.960] (-797.123) (-803.096) -- 0:00:52
540000 -- [-799.831] (-799.437) (-796.292) (-793.789) * [-794.489] (-798.716) (-798.778) (-800.292) -- 0:00:51
Average standard deviation of split frequencies: 0.007673
540500 -- (-799.824) (-792.850) [-794.870] (-799.744) * (-795.751) (-802.462) [-799.409] (-801.822) -- 0:00:51
541000 -- (-799.171) (-795.313) [-792.681] (-800.484) * (-801.205) [-798.026] (-795.438) (-794.738) -- 0:00:51
541500 -- (-804.038) (-794.799) [-794.093] (-797.594) * (-793.602) (-800.689) [-791.987] (-795.011) -- 0:00:51
542000 -- (-802.008) [-794.224] (-795.960) (-798.414) * (-803.578) (-796.879) (-797.129) [-798.462] -- 0:00:51
542500 -- [-798.226] (-797.652) (-796.285) (-794.423) * (-797.492) (-797.407) [-799.288] (-799.101) -- 0:00:51
543000 -- [-798.101] (-795.326) (-794.571) (-797.816) * (-802.331) (-795.738) (-814.498) [-796.890] -- 0:00:51
543500 -- (-792.094) [-791.045] (-796.692) (-801.724) * (-799.300) (-801.110) (-801.443) [-797.874] -- 0:00:51
544000 -- (-793.870) (-796.081) (-800.847) [-796.196] * [-796.308] (-804.233) (-803.966) (-793.975) -- 0:00:51
544500 -- (-797.369) (-793.173) [-802.438] (-796.462) * (-796.327) (-796.039) [-795.428] (-798.155) -- 0:00:51
545000 -- [-794.596] (-800.198) (-796.062) (-798.520) * (-795.909) (-806.398) [-796.238] (-793.952) -- 0:00:50
Average standard deviation of split frequencies: 0.008116
545500 -- (-796.158) (-796.686) [-794.867] (-796.389) * (-795.509) (-803.071) (-795.058) [-792.579] -- 0:00:50
546000 -- (-795.975) [-797.415] (-799.310) (-805.259) * (-802.813) (-791.811) [-798.366] (-799.373) -- 0:00:50
546500 -- (-798.022) [-798.191] (-800.076) (-801.661) * (-796.710) (-794.349) (-797.804) [-800.182] -- 0:00:50
547000 -- (-797.814) [-793.321] (-796.432) (-807.474) * (-803.744) (-795.507) [-796.776] (-795.647) -- 0:00:50
547500 -- (-802.577) (-794.736) (-798.599) [-801.772] * (-801.384) (-795.517) [-794.664] (-806.993) -- 0:00:50
548000 -- (-790.108) (-796.876) (-801.103) [-795.563] * (-794.747) (-798.467) [-798.205] (-795.072) -- 0:00:51
548500 -- (-794.582) (-794.519) [-796.122] (-795.818) * [-792.650] (-794.628) (-801.266) (-799.576) -- 0:00:51
549000 -- (-805.087) (-794.147) (-794.878) [-794.530] * (-800.736) (-794.201) [-799.049] (-804.183) -- 0:00:50
549500 -- (-798.789) (-794.511) [-794.019] (-792.917) * (-798.317) (-797.913) [-793.604] (-794.099) -- 0:00:50
550000 -- (-801.526) (-801.378) [-799.270] (-797.211) * (-798.470) (-804.693) (-793.608) [-801.464] -- 0:00:50
Average standard deviation of split frequencies: 0.008561
550500 -- [-794.712] (-799.952) (-800.446) (-795.466) * (-801.992) [-796.731] (-794.844) (-791.949) -- 0:00:50
551000 -- (-802.937) (-794.949) [-798.260] (-798.881) * (-801.201) (-797.550) [-793.473] (-794.197) -- 0:00:50
551500 -- [-796.166] (-795.634) (-801.979) (-798.242) * (-801.233) (-796.370) (-802.736) [-795.563] -- 0:00:50
552000 -- (-798.855) (-804.752) [-796.052] (-795.991) * (-802.751) (-797.479) [-799.914] (-795.704) -- 0:00:50
552500 -- (-805.454) [-791.941] (-797.296) (-802.554) * (-796.969) (-796.239) [-803.149] (-798.857) -- 0:00:50
553000 -- (-797.472) [-797.595] (-805.523) (-791.906) * (-795.467) [-796.463] (-800.056) (-797.194) -- 0:00:50
553500 -- (-801.258) (-801.310) [-807.524] (-796.682) * [-795.462] (-797.733) (-795.787) (-797.791) -- 0:00:50
554000 -- (-804.376) (-801.512) [-801.273] (-797.668) * (-792.967) (-803.902) [-795.918] (-799.142) -- 0:00:49
554500 -- (-796.770) (-796.191) [-796.421] (-799.941) * (-801.745) (-799.505) [-798.497] (-799.035) -- 0:00:49
555000 -- (-801.871) (-795.639) [-796.682] (-802.657) * (-800.276) (-799.013) (-801.809) [-799.236] -- 0:00:49
Average standard deviation of split frequencies: 0.008648
555500 -- [-799.858] (-796.788) (-801.640) (-796.022) * (-796.156) [-795.820] (-797.624) (-793.621) -- 0:00:49
556000 -- (-798.763) (-799.576) (-802.335) [-796.149] * (-795.378) [-801.879] (-799.761) (-804.799) -- 0:00:49
556500 -- (-806.349) (-793.900) (-795.461) [-791.774] * (-797.863) (-796.814) [-792.925] (-806.959) -- 0:00:49
557000 -- (-798.667) [-799.184] (-802.439) (-798.198) * [-792.894] (-799.363) (-795.130) (-805.659) -- 0:00:50
557500 -- [-797.306] (-798.847) (-797.793) (-807.163) * (-794.513) (-801.404) (-797.815) [-798.494] -- 0:00:50
558000 -- (-797.240) [-798.838] (-799.322) (-793.252) * (-795.274) (-801.629) [-794.588] (-798.061) -- 0:00:49
558500 -- (-794.075) (-799.958) [-796.162] (-794.884) * (-801.299) (-796.473) (-799.185) [-795.815] -- 0:00:49
559000 -- [-796.587] (-806.144) (-793.763) (-798.499) * [-796.356] (-801.966) (-798.676) (-799.126) -- 0:00:49
559500 -- (-794.153) [-793.937] (-795.862) (-795.368) * (-799.014) (-806.032) [-797.417] (-799.856) -- 0:00:49
560000 -- (-805.678) (-804.681) (-793.062) [-795.296] * (-797.096) (-795.740) [-798.658] (-796.089) -- 0:00:49
Average standard deviation of split frequencies: 0.008408
560500 -- [-802.982] (-798.842) (-795.423) (-801.727) * (-799.233) [-791.212] (-801.166) (-794.651) -- 0:00:49
561000 -- (-797.382) [-800.458] (-799.175) (-794.018) * [-791.349] (-800.035) (-802.972) (-796.600) -- 0:00:49
561500 -- [-798.183] (-794.506) (-795.617) (-798.140) * (-806.178) (-801.260) (-795.834) [-798.660] -- 0:00:49
562000 -- [-809.780] (-795.664) (-798.132) (-794.351) * (-800.517) [-797.253] (-798.449) (-803.652) -- 0:00:49
562500 -- (-797.503) (-791.267) (-796.618) [-799.430] * (-800.706) (-802.972) [-790.830] (-795.393) -- 0:00:49
563000 -- (-791.924) (-798.669) (-799.555) [-800.697] * (-797.417) [-794.268] (-793.169) (-796.829) -- 0:00:48
563500 -- (-801.114) (-796.148) [-796.496] (-806.192) * (-797.554) [-796.121] (-791.069) (-794.533) -- 0:00:48
564000 -- (-803.172) [-796.610] (-796.283) (-793.129) * (-798.391) (-798.746) [-795.854] (-801.887) -- 0:00:48
564500 -- (-793.264) (-796.474) (-793.466) [-790.751] * [-797.129] (-799.135) (-796.882) (-795.246) -- 0:00:48
565000 -- (-802.380) (-795.130) (-798.613) [-797.683] * (-798.407) (-792.979) (-799.150) [-799.314] -- 0:00:48
Average standard deviation of split frequencies: 0.007329
565500 -- (-792.696) [-799.238] (-802.397) (-800.457) * [-794.137] (-799.506) (-804.836) (-794.560) -- 0:00:48
566000 -- (-806.887) (-792.250) (-801.538) [-793.905] * (-798.356) (-799.285) (-801.745) [-795.002] -- 0:00:49
566500 -- (-795.368) [-794.444] (-799.400) (-795.981) * (-799.880) [-796.612] (-795.260) (-796.584) -- 0:00:48
567000 -- (-793.144) [-793.594] (-797.717) (-797.962) * [-796.213] (-795.195) (-799.749) (-792.865) -- 0:00:48
567500 -- (-796.901) [-796.848] (-803.306) (-797.329) * (-797.801) [-795.068] (-795.810) (-803.322) -- 0:00:48
568000 -- (-801.136) (-800.640) (-798.150) [-798.184] * [-800.574] (-797.036) (-802.385) (-791.800) -- 0:00:48
568500 -- (-801.268) [-802.759] (-798.038) (-791.595) * (-801.399) [-797.541] (-798.127) (-792.004) -- 0:00:48
569000 -- (-797.130) (-800.955) [-794.721] (-797.227) * (-798.446) (-794.370) (-809.193) [-799.130] -- 0:00:48
569500 -- [-805.625] (-797.556) (-807.449) (-792.020) * [-791.607] (-793.013) (-799.834) (-802.102) -- 0:00:48
570000 -- [-801.283] (-796.382) (-803.594) (-801.405) * (-794.742) [-793.651] (-797.399) (-797.093) -- 0:00:48
Average standard deviation of split frequencies: 0.007600
570500 -- [-798.109] (-800.162) (-796.899) (-801.672) * [-801.866] (-803.989) (-797.246) (-797.261) -- 0:00:48
571000 -- [-797.294] (-798.870) (-796.400) (-803.434) * (-798.670) (-793.927) (-807.989) [-794.054] -- 0:00:48
571500 -- (-800.104) (-798.946) [-800.289] (-797.872) * (-807.877) [-794.790] (-798.334) (-802.234) -- 0:00:47
572000 -- (-797.522) (-798.368) (-798.449) [-801.934] * [-792.650] (-802.797) (-798.774) (-797.660) -- 0:00:47
572500 -- (-794.736) [-792.963] (-803.028) (-795.239) * (-799.570) (-799.833) (-797.077) [-792.081] -- 0:00:47
573000 -- (-804.576) (-793.044) [-798.740] (-795.125) * (-797.783) [-795.150] (-797.978) (-795.086) -- 0:00:47
573500 -- (-797.045) [-795.893] (-796.676) (-796.441) * (-793.381) (-796.360) [-796.102] (-792.216) -- 0:00:47
574000 -- (-793.841) (-795.768) (-804.604) [-795.500] * (-804.156) (-795.632) (-795.962) [-794.984] -- 0:00:47
574500 -- (-799.972) [-797.223] (-796.090) (-795.255) * (-795.702) (-806.256) [-790.095] (-799.236) -- 0:00:47
575000 -- (-795.194) [-796.045] (-797.250) (-798.098) * (-797.836) (-800.881) [-793.997] (-796.386) -- 0:00:48
Average standard deviation of split frequencies: 0.007366
575500 -- (-795.692) (-802.928) (-793.951) [-798.683] * (-803.105) (-795.292) [-793.540] (-795.472) -- 0:00:47
576000 -- (-795.877) [-795.220] (-800.736) (-799.631) * (-805.468) (-793.632) (-793.304) [-802.864] -- 0:00:47
576500 -- (-796.287) (-798.217) [-796.432] (-795.167) * (-796.953) [-793.167] (-796.551) (-798.841) -- 0:00:47
577000 -- [-801.031] (-802.047) (-799.501) (-798.909) * (-794.162) (-799.119) (-798.036) [-793.482] -- 0:00:47
577500 -- [-794.075] (-801.750) (-795.063) (-799.417) * (-801.565) (-798.190) (-795.950) [-795.672] -- 0:00:47
578000 -- [-795.103] (-795.126) (-805.197) (-798.184) * (-800.250) (-795.527) (-796.747) [-795.568] -- 0:00:47
578500 -- (-799.303) [-794.984] (-796.522) (-804.193) * (-805.100) (-792.604) (-796.675) [-802.268] -- 0:00:47
579000 -- (-793.770) (-795.025) (-800.328) [-796.166] * [-799.733] (-791.672) (-795.040) (-799.751) -- 0:00:47
579500 -- [-795.980] (-799.083) (-795.138) (-800.205) * (-796.257) [-805.743] (-796.391) (-800.814) -- 0:00:47
580000 -- (-799.177) (-804.116) [-795.911] (-799.412) * [-800.549] (-796.177) (-795.649) (-798.295) -- 0:00:47
Average standard deviation of split frequencies: 0.007794
580500 -- (-802.894) [-797.051] (-791.793) (-797.624) * [-800.916] (-796.448) (-797.421) (-795.424) -- 0:00:46
581000 -- [-798.072] (-794.306) (-796.476) (-795.016) * (-794.781) (-793.729) (-805.106) [-793.154] -- 0:00:46
581500 -- [-800.637] (-795.128) (-799.203) (-795.887) * [-795.034] (-801.930) (-798.761) (-794.878) -- 0:00:46
582000 -- (-802.916) (-797.222) (-798.460) [-797.482] * (-799.285) (-804.056) [-795.176] (-793.646) -- 0:00:46
582500 -- (-799.135) (-797.824) [-792.694] (-798.049) * [-795.488] (-794.258) (-800.126) (-801.479) -- 0:00:46
583000 -- [-793.913] (-798.752) (-801.455) (-796.677) * [-794.667] (-794.650) (-798.320) (-810.248) -- 0:00:46
583500 -- (-800.100) (-797.783) [-795.314] (-796.269) * (-797.538) (-800.940) [-797.587] (-802.825) -- 0:00:46
584000 -- (-797.122) (-804.484) [-798.322] (-796.920) * (-800.688) (-802.652) [-792.871] (-800.806) -- 0:00:47
584500 -- (-795.035) (-797.275) [-794.325] (-801.278) * (-798.626) (-803.043) [-796.885] (-807.353) -- 0:00:46
585000 -- [-796.847] (-796.630) (-800.014) (-798.395) * (-797.055) (-799.902) [-795.525] (-802.268) -- 0:00:46
Average standard deviation of split frequencies: 0.007884
585500 -- (-802.810) [-793.000] (-800.070) (-799.101) * [-799.130] (-801.806) (-794.575) (-799.303) -- 0:00:46
586000 -- (-800.857) [-794.084] (-799.480) (-800.175) * [-792.423] (-794.759) (-793.139) (-803.550) -- 0:00:46
586500 -- (-802.409) (-791.278) (-805.380) [-793.889] * (-793.818) (-795.508) (-794.457) [-792.419] -- 0:00:46
587000 -- (-799.934) (-800.643) [-797.352] (-797.845) * (-799.472) (-791.989) [-795.754] (-794.026) -- 0:00:46
587500 -- [-793.058] (-800.166) (-792.891) (-797.102) * [-794.726] (-798.510) (-800.320) (-799.000) -- 0:00:46
588000 -- (-794.496) [-797.557] (-800.340) (-792.305) * (-795.285) [-791.931] (-797.193) (-796.279) -- 0:00:46
588500 -- (-799.673) [-794.913] (-804.796) (-797.872) * (-802.776) (-795.970) (-800.008) [-806.267] -- 0:00:46
589000 -- (-798.064) (-798.959) [-794.556] (-798.261) * [-796.654] (-802.032) (-795.608) (-798.156) -- 0:00:46
589500 -- (-797.481) (-792.862) [-799.843] (-797.949) * (-795.839) [-794.531] (-797.124) (-803.782) -- 0:00:45
590000 -- (-795.279) [-796.248] (-800.156) (-799.624) * (-797.037) (-799.137) [-793.738] (-796.949) -- 0:00:45
Average standard deviation of split frequencies: 0.008300
590500 -- [-795.957] (-796.322) (-801.958) (-793.729) * (-795.167) (-798.065) (-794.634) [-800.753] -- 0:00:45
591000 -- [-797.220] (-804.298) (-794.534) (-793.715) * (-799.332) (-800.145) (-799.328) [-800.629] -- 0:00:45
591500 -- (-801.297) [-797.687] (-796.663) (-798.403) * (-798.333) (-795.280) [-798.437] (-803.017) -- 0:00:45
592000 -- (-794.977) (-797.176) (-797.277) [-795.786] * (-799.001) (-802.417) (-798.946) [-797.050] -- 0:00:45
592500 -- [-794.077] (-800.427) (-793.088) (-792.149) * (-791.809) [-795.548] (-798.480) (-800.411) -- 0:00:45
593000 -- [-795.306] (-802.426) (-795.132) (-797.782) * (-796.955) [-796.622] (-794.714) (-801.598) -- 0:00:45
593500 -- (-798.454) (-805.026) (-796.484) [-796.185] * (-796.659) [-793.324] (-792.829) (-802.366) -- 0:00:45
594000 -- (-796.962) [-805.431] (-799.049) (-793.537) * (-804.071) (-794.230) [-793.331] (-794.701) -- 0:00:45
594500 -- (-797.855) [-797.279] (-791.988) (-802.448) * (-795.727) (-800.102) (-798.594) [-800.530] -- 0:00:45
595000 -- (-798.138) (-797.684) (-803.986) [-801.763] * (-803.668) (-800.399) [-793.725] (-799.763) -- 0:00:45
Average standard deviation of split frequencies: 0.009017
595500 -- (-797.050) [-798.095] (-797.105) (-800.210) * (-805.988) (-801.205) (-801.984) [-799.637] -- 0:00:45
596000 -- (-792.784) [-794.359] (-804.624) (-800.728) * (-799.409) (-796.891) [-796.561] (-796.191) -- 0:00:45
596500 -- (-801.937) (-807.193) (-800.472) [-795.488] * (-798.554) (-797.281) (-794.821) [-795.500] -- 0:00:45
597000 -- [-795.950] (-794.581) (-804.517) (-796.141) * (-797.855) (-792.658) (-795.728) [-793.148] -- 0:00:45
597500 -- (-795.492) [-796.023] (-799.190) (-793.998) * (-796.920) (-795.601) [-794.475] (-799.308) -- 0:00:45
598000 -- (-797.959) [-796.625] (-796.115) (-793.948) * (-797.443) (-800.700) (-801.955) [-796.879] -- 0:00:45
598500 -- (-801.814) [-796.926] (-800.440) (-799.606) * (-794.578) (-801.428) [-805.014] (-798.614) -- 0:00:44
599000 -- (-799.413) [-796.250] (-797.874) (-798.513) * (-799.146) [-796.717] (-802.171) (-801.035) -- 0:00:44
599500 -- (-794.238) (-791.480) (-801.769) [-797.251] * (-797.349) (-797.855) (-797.641) [-795.239] -- 0:00:44
600000 -- (-799.706) (-799.239) (-797.971) [-790.865] * (-798.096) (-795.506) [-795.062] (-796.170) -- 0:00:44
Average standard deviation of split frequencies: 0.008790
600500 -- [-798.155] (-803.110) (-796.504) (-798.650) * [-802.256] (-801.210) (-797.892) (-797.558) -- 0:00:44
601000 -- [-800.314] (-793.948) (-799.777) (-798.031) * [-796.071] (-801.670) (-795.499) (-796.305) -- 0:00:44
601500 -- (-795.691) [-794.626] (-798.682) (-804.043) * [-796.590] (-797.741) (-801.515) (-791.741) -- 0:00:44
602000 -- (-800.053) [-800.616] (-794.474) (-801.208) * (-800.357) (-803.283) [-798.283] (-796.791) -- 0:00:44
602500 -- (-799.183) (-797.802) [-797.551] (-804.675) * (-795.551) (-796.323) [-798.717] (-796.172) -- 0:00:44
603000 -- (-798.586) [-796.447] (-800.260) (-802.065) * [-795.718] (-794.521) (-800.538) (-796.250) -- 0:00:44
603500 -- (-793.893) (-796.738) [-795.352] (-793.463) * [-796.894] (-799.485) (-805.220) (-795.889) -- 0:00:44
604000 -- (-803.180) (-798.482) [-799.068] (-798.687) * (-793.576) (-801.848) (-801.424) [-798.218] -- 0:00:44
604500 -- (-805.242) (-792.714) (-796.396) [-793.658] * (-797.752) (-796.175) [-794.047] (-799.048) -- 0:00:44
605000 -- (-794.255) (-797.481) (-802.232) [-798.559] * (-798.718) [-800.282] (-806.274) (-798.419) -- 0:00:44
Average standard deviation of split frequencies: 0.009179
605500 -- [-791.924] (-805.655) (-798.421) (-796.031) * [-798.255] (-797.206) (-807.508) (-798.999) -- 0:00:44
606000 -- [-796.188] (-796.371) (-797.318) (-790.463) * (-796.348) [-794.875] (-802.662) (-801.416) -- 0:00:44
606500 -- (-796.524) [-794.305] (-796.668) (-799.901) * (-796.494) (-800.986) [-796.008] (-797.360) -- 0:00:44
607000 -- (-800.056) [-792.786] (-800.485) (-797.256) * [-803.131] (-800.530) (-799.006) (-798.672) -- 0:00:44
607500 -- (-799.389) (-800.215) (-794.821) [-791.221] * (-796.864) (-799.829) (-799.267) [-800.114] -- 0:00:43
608000 -- [-801.203] (-801.428) (-792.239) (-804.468) * (-799.903) (-806.683) [-793.678] (-804.147) -- 0:00:43
608500 -- (-799.728) (-799.851) (-794.282) [-799.268] * (-796.742) [-795.911] (-796.891) (-800.191) -- 0:00:43
609000 -- (-799.393) [-804.360] (-796.252) (-801.975) * [-794.277] (-795.917) (-803.051) (-801.047) -- 0:00:43
609500 -- (-799.328) (-797.972) (-793.195) [-793.740] * (-798.762) (-792.531) [-792.229] (-800.554) -- 0:00:43
610000 -- (-794.918) (-794.621) (-803.198) [-789.937] * (-804.817) [-795.364] (-795.939) (-795.438) -- 0:00:43
Average standard deviation of split frequencies: 0.008800
610500 -- [-797.777] (-795.290) (-799.840) (-797.807) * (-795.546) [-796.902] (-795.111) (-795.519) -- 0:00:43
611000 -- [-795.905] (-790.797) (-801.228) (-797.851) * (-796.208) (-801.929) (-793.311) [-799.455] -- 0:00:43
611500 -- (-793.862) (-804.841) (-801.937) [-795.893] * [-803.420] (-798.062) (-797.469) (-794.992) -- 0:00:43
612000 -- (-796.730) [-791.766] (-797.780) (-792.008) * (-796.176) (-792.626) [-797.289] (-800.320) -- 0:00:43
612500 -- [-800.999] (-797.254) (-795.966) (-801.445) * (-793.880) (-803.237) [-797.397] (-800.979) -- 0:00:43
613000 -- (-805.857) (-801.281) (-794.098) [-794.925] * (-797.757) (-800.549) [-795.358] (-798.690) -- 0:00:43
613500 -- [-797.968] (-800.356) (-793.085) (-793.375) * (-796.854) (-798.498) (-800.572) [-794.607] -- 0:00:43
614000 -- (-795.703) (-802.258) [-793.910] (-805.680) * [-794.490] (-795.301) (-799.470) (-797.877) -- 0:00:43
614500 -- (-794.648) [-791.868] (-796.051) (-804.759) * (-798.517) (-797.238) [-797.820] (-796.196) -- 0:00:43
615000 -- (-800.812) [-795.109] (-806.727) (-796.601) * (-804.647) (-796.666) [-799.561] (-794.292) -- 0:00:43
Average standard deviation of split frequencies: 0.008571
615500 -- (-797.367) [-796.318] (-802.270) (-796.638) * (-795.673) (-794.260) [-795.058] (-797.344) -- 0:00:43
616000 -- (-802.618) [-796.537] (-805.440) (-800.251) * (-796.688) [-798.007] (-803.013) (-794.969) -- 0:00:43
616500 -- (-803.329) (-797.073) [-793.766] (-796.505) * [-795.593] (-798.335) (-805.384) (-800.846) -- 0:00:42
617000 -- (-795.927) [-797.040] (-801.707) (-795.306) * [-793.346] (-796.641) (-798.472) (-796.413) -- 0:00:42
617500 -- [-801.295] (-799.777) (-801.148) (-793.942) * (-799.602) (-798.596) [-794.910] (-794.657) -- 0:00:42
618000 -- (-797.095) (-794.386) (-802.257) [-797.803] * (-799.269) (-798.654) [-798.896] (-789.772) -- 0:00:42
618500 -- (-794.744) (-797.217) [-796.426] (-800.213) * (-797.303) (-795.716) (-797.276) [-793.991] -- 0:00:42
619000 -- (-798.414) (-801.258) [-796.390] (-802.041) * (-794.302) (-797.331) (-796.009) [-793.894] -- 0:00:42
619500 -- (-794.550) (-795.519) (-807.377) [-796.196] * (-793.012) (-801.278) [-794.992] (-795.495) -- 0:00:42
620000 -- (-799.590) (-801.892) [-800.172] (-803.623) * (-797.237) (-796.087) [-799.621] (-795.233) -- 0:00:42
Average standard deviation of split frequencies: 0.008658
620500 -- (-799.493) (-795.933) (-794.508) [-793.992] * (-796.536) [-801.238] (-799.156) (-793.367) -- 0:00:42
621000 -- (-802.483) (-796.166) (-806.075) [-801.288] * (-800.120) (-800.553) [-797.760] (-795.380) -- 0:00:42
621500 -- [-796.690] (-799.087) (-799.065) (-796.262) * (-801.538) [-792.413] (-798.377) (-799.264) -- 0:00:42
622000 -- [-792.815] (-798.152) (-803.495) (-795.607) * (-793.628) [-792.766] (-798.857) (-795.965) -- 0:00:42
622500 -- (-796.284) (-793.895) [-799.173] (-799.839) * (-796.097) [-794.325] (-798.714) (-793.934) -- 0:00:42
623000 -- [-796.410] (-803.567) (-795.386) (-798.948) * [-794.483] (-800.092) (-800.446) (-800.481) -- 0:00:42
623500 -- [-796.945] (-805.362) (-800.202) (-795.432) * (-794.679) (-797.614) (-793.477) [-790.047] -- 0:00:42
624000 -- (-798.589) (-802.324) (-806.773) [-797.410] * [-797.320] (-794.054) (-797.919) (-794.088) -- 0:00:42
624500 -- (-809.998) [-800.813] (-800.148) (-795.593) * (-805.247) [-796.491] (-802.288) (-795.508) -- 0:00:42
625000 -- [-800.849] (-801.310) (-799.757) (-799.419) * (-803.990) [-794.384] (-805.292) (-802.277) -- 0:00:42
Average standard deviation of split frequencies: 0.008735
625500 -- (-797.964) (-808.392) (-796.364) [-794.208] * (-796.198) (-795.723) (-796.572) [-798.909] -- 0:00:41
626000 -- (-796.277) (-799.599) [-797.487] (-799.137) * (-799.606) (-801.190) (-799.718) [-797.866] -- 0:00:41
626500 -- (-808.567) (-796.322) (-795.468) [-797.503] * [-794.053] (-795.016) (-792.332) (-794.969) -- 0:00:41
627000 -- (-797.905) (-799.983) (-801.069) [-798.749] * [-798.812] (-801.024) (-793.039) (-794.785) -- 0:00:41
627500 -- (-797.085) [-794.280] (-800.750) (-793.419) * [-797.434] (-801.414) (-796.772) (-794.724) -- 0:00:41
628000 -- (-794.541) [-800.042] (-794.871) (-795.387) * [-798.387] (-801.563) (-802.150) (-795.817) -- 0:00:41
628500 -- (-798.419) (-799.861) (-798.513) [-797.384] * [-796.019] (-796.588) (-804.270) (-794.078) -- 0:00:41
629000 -- (-800.427) (-797.687) (-804.435) [-799.373] * (-800.960) (-798.725) (-794.880) [-799.263] -- 0:00:41
629500 -- [-790.428] (-795.531) (-808.549) (-794.471) * (-795.807) (-799.205) [-790.825] (-805.815) -- 0:00:41
630000 -- (-798.702) [-799.159] (-802.155) (-797.078) * [-795.015] (-798.373) (-795.111) (-799.893) -- 0:00:41
Average standard deviation of split frequencies: 0.009568
630500 -- (-797.180) (-801.402) [-794.463] (-795.389) * (-792.064) (-804.478) [-793.109] (-798.632) -- 0:00:41
631000 -- (-794.718) (-806.319) (-800.426) [-792.661] * [-793.320] (-793.523) (-795.605) (-804.241) -- 0:00:41
631500 -- (-796.632) [-800.625] (-793.875) (-796.012) * (-796.286) [-790.757] (-801.202) (-796.877) -- 0:00:41
632000 -- (-793.713) [-798.044] (-797.401) (-798.142) * [-791.979] (-792.379) (-803.350) (-803.046) -- 0:00:41
632500 -- (-792.233) (-797.349) [-798.063] (-793.932) * (-792.097) (-797.791) [-799.818] (-796.104) -- 0:00:41
633000 -- (-797.167) (-796.301) [-798.389] (-799.451) * (-795.220) (-797.165) [-797.618] (-801.543) -- 0:00:41
633500 -- (-800.151) (-801.035) [-794.414] (-799.916) * (-801.541) (-803.113) (-792.180) [-795.589] -- 0:00:41
634000 -- (-794.143) (-804.888) [-798.140] (-805.508) * (-794.247) [-798.489] (-798.584) (-793.638) -- 0:00:40
634500 -- (-799.036) [-803.717] (-793.631) (-799.503) * (-798.430) (-798.282) (-796.958) [-801.078] -- 0:00:40
635000 -- (-797.321) (-794.041) [-793.614] (-797.219) * (-794.705) [-792.933] (-801.587) (-797.483) -- 0:00:40
Average standard deviation of split frequencies: 0.009487
635500 -- (-797.505) [-797.106] (-799.287) (-798.435) * (-796.264) [-799.889] (-797.850) (-804.315) -- 0:00:40
636000 -- (-798.081) [-796.174] (-792.400) (-792.609) * [-799.316] (-791.781) (-797.416) (-801.429) -- 0:00:40
636500 -- (-798.297) (-796.878) [-802.987] (-795.065) * [-796.402] (-792.695) (-803.938) (-799.439) -- 0:00:40
637000 -- (-794.593) [-792.812] (-798.364) (-795.436) * [-792.445] (-794.115) (-794.012) (-795.854) -- 0:00:40
637500 -- (-794.738) [-795.562] (-801.599) (-804.075) * (-800.369) [-791.628] (-795.970) (-793.452) -- 0:00:40
638000 -- [-793.195] (-799.477) (-801.795) (-797.431) * [-796.240] (-801.117) (-797.739) (-798.217) -- 0:00:40
638500 -- [-794.709] (-795.882) (-797.680) (-799.824) * (-795.771) (-796.664) [-794.171] (-796.192) -- 0:00:40
639000 -- (-793.255) (-796.578) [-795.828] (-797.730) * (-795.669) [-797.058] (-793.545) (-799.197) -- 0:00:40
639500 -- (-794.745) [-793.973] (-809.452) (-797.257) * (-795.380) [-796.123] (-794.428) (-797.986) -- 0:00:40
640000 -- [-792.193] (-795.663) (-806.888) (-797.821) * [-794.551] (-803.311) (-792.529) (-802.454) -- 0:00:40
Average standard deviation of split frequencies: 0.010007
640500 -- [-796.072] (-796.235) (-802.428) (-794.017) * (-804.144) (-793.403) [-796.851] (-800.811) -- 0:00:40
641000 -- (-794.414) [-794.628] (-800.197) (-795.802) * [-801.997] (-793.025) (-804.652) (-804.626) -- 0:00:40
641500 -- [-793.246] (-795.768) (-797.421) (-794.498) * [-799.264] (-802.832) (-794.746) (-793.791) -- 0:00:40
642000 -- (-796.286) [-793.151] (-801.868) (-798.253) * (-799.471) (-793.732) [-797.668] (-797.737) -- 0:00:40
642500 -- (-797.103) (-795.500) (-797.123) [-800.239] * (-793.311) (-800.706) [-797.942] (-795.012) -- 0:00:40
643000 -- [-799.366] (-799.819) (-808.495) (-795.108) * (-794.032) (-798.362) (-795.810) [-795.312] -- 0:00:39
643500 -- (-792.114) (-804.012) (-801.332) [-794.944] * (-796.317) (-801.042) (-797.852) [-798.826] -- 0:00:39
644000 -- (-798.470) (-794.731) (-804.081) [-794.397] * (-798.320) [-796.373] (-797.574) (-798.795) -- 0:00:39
644500 -- (-793.507) (-797.582) (-807.115) [-792.600] * (-810.272) (-797.543) [-794.371] (-795.444) -- 0:00:39
645000 -- (-792.303) (-795.172) (-802.227) [-799.553] * (-800.468) (-793.070) [-800.768] (-801.923) -- 0:00:39
Average standard deviation of split frequencies: 0.009486
645500 -- (-799.726) [-794.947] (-803.165) (-811.358) * (-799.180) (-801.343) [-794.688] (-804.252) -- 0:00:39
646000 -- [-794.467] (-795.131) (-798.685) (-798.868) * (-796.524) [-794.332] (-796.621) (-802.657) -- 0:00:39
646500 -- (-801.633) (-792.765) (-800.663) [-798.840] * (-795.602) (-800.321) (-799.775) [-798.671] -- 0:00:39
647000 -- [-796.897] (-797.250) (-808.617) (-808.106) * (-796.020) [-796.441] (-799.025) (-795.265) -- 0:00:39
647500 -- (-796.014) (-797.651) (-802.788) [-799.541] * [-798.549] (-809.206) (-793.021) (-796.918) -- 0:00:39
648000 -- [-797.777] (-799.314) (-808.611) (-801.520) * (-794.559) (-802.787) (-798.111) [-795.222] -- 0:00:39
648500 -- (-796.825) [-800.272] (-798.935) (-800.858) * (-799.296) (-803.468) [-797.014] (-795.002) -- 0:00:39
649000 -- (-796.345) [-794.517] (-796.723) (-795.251) * (-796.456) (-794.869) (-796.988) [-796.595] -- 0:00:39
649500 -- [-794.894] (-806.450) (-798.751) (-793.575) * (-798.457) [-795.122] (-794.353) (-802.894) -- 0:00:39
650000 -- [-795.786] (-796.429) (-795.149) (-801.029) * (-797.985) (-795.654) [-795.536] (-801.569) -- 0:00:39
Average standard deviation of split frequencies: 0.011012
650500 -- (-796.725) [-798.689] (-801.367) (-797.353) * (-798.569) (-793.287) [-798.241] (-799.967) -- 0:00:39
651000 -- [-790.201] (-796.054) (-794.848) (-791.000) * (-798.694) (-794.832) [-797.567] (-800.038) -- 0:00:39
651500 -- (-795.604) (-799.965) [-796.438] (-789.765) * (-798.931) (-799.359) (-798.318) [-792.488] -- 0:00:39
652000 -- (-794.665) [-795.746] (-795.414) (-794.825) * (-799.585) (-803.660) (-793.946) [-794.916] -- 0:00:38
652500 -- (-794.396) [-795.800] (-794.492) (-791.494) * (-798.018) [-794.259] (-795.500) (-798.126) -- 0:00:38
653000 -- (-802.614) (-799.853) (-797.002) [-791.738] * (-799.224) [-795.013] (-800.765) (-796.744) -- 0:00:38
653500 -- (-799.653) (-807.315) [-795.601] (-797.006) * (-796.528) (-803.182) [-802.585] (-803.308) -- 0:00:38
654000 -- (-793.789) [-794.764] (-801.021) (-800.581) * (-798.262) (-795.752) [-793.057] (-799.146) -- 0:00:38
654500 -- [-791.660] (-795.825) (-798.869) (-798.433) * (-801.781) (-799.821) [-795.660] (-798.998) -- 0:00:38
655000 -- (-796.501) (-796.161) [-797.908] (-800.965) * [-793.701] (-799.797) (-796.018) (-797.662) -- 0:00:38
Average standard deviation of split frequencies: 0.010923
655500 -- (-793.499) [-796.498] (-796.263) (-801.505) * (-802.035) (-800.230) (-813.263) [-794.087] -- 0:00:38
656000 -- (-798.098) (-798.905) [-795.093] (-802.201) * [-798.993] (-797.772) (-797.507) (-809.992) -- 0:00:38
656500 -- (-799.827) (-801.025) (-795.802) [-795.943] * (-796.302) [-796.235] (-801.912) (-797.166) -- 0:00:38
657000 -- (-808.324) (-794.055) (-806.673) [-801.358] * [-795.212] (-802.147) (-801.207) (-792.944) -- 0:00:38
657500 -- (-799.047) [-798.179] (-796.257) (-797.614) * (-798.025) (-800.135) (-795.181) [-797.469] -- 0:00:38
658000 -- (-791.959) [-797.746] (-811.482) (-797.729) * (-796.277) [-794.913] (-798.238) (-803.349) -- 0:00:38
658500 -- (-797.930) (-797.386) (-798.252) [-793.573] * [-803.773] (-794.142) (-794.908) (-792.208) -- 0:00:38
659000 -- [-792.765] (-795.624) (-796.896) (-802.571) * (-795.869) [-792.700] (-802.839) (-800.557) -- 0:00:38
659500 -- [-796.576] (-801.419) (-802.265) (-797.325) * (-800.546) [-797.348] (-805.171) (-793.445) -- 0:00:38
660000 -- (-798.474) (-797.860) [-799.901] (-797.872) * (-793.649) (-794.722) [-797.755] (-796.898) -- 0:00:38
Average standard deviation of split frequencies: 0.011416
660500 -- (-793.439) [-791.914] (-805.923) (-795.257) * [-796.569] (-792.245) (-795.862) (-800.828) -- 0:00:38
661000 -- [-790.810] (-798.048) (-793.807) (-809.031) * (-791.370) (-796.911) (-798.323) [-795.696] -- 0:00:37
661500 -- (-796.087) (-793.757) (-797.223) [-795.722] * (-801.663) (-798.277) (-794.117) [-800.716] -- 0:00:37
662000 -- [-793.680] (-796.272) (-796.256) (-798.643) * [-804.019] (-796.241) (-793.279) (-798.558) -- 0:00:37
662500 -- (-798.451) [-791.718] (-793.578) (-800.205) * (-795.468) [-795.293] (-795.179) (-796.129) -- 0:00:37
663000 -- (-797.212) [-794.038] (-796.972) (-799.299) * (-800.658) [-798.711] (-791.468) (-810.545) -- 0:00:37
663500 -- [-794.248] (-801.262) (-792.428) (-801.435) * (-799.397) (-799.112) (-793.926) [-794.398] -- 0:00:37
664000 -- (-796.575) [-797.009] (-812.094) (-799.587) * (-797.767) [-792.730] (-791.633) (-803.640) -- 0:00:37
664500 -- (-805.733) [-797.398] (-797.971) (-802.211) * [-797.675] (-807.829) (-798.173) (-796.019) -- 0:00:37
665000 -- (-799.590) (-801.155) [-798.728] (-796.294) * (-799.099) [-796.834] (-818.509) (-793.625) -- 0:00:37
Average standard deviation of split frequencies: 0.011750
665500 -- (-802.432) (-795.385) [-797.460] (-793.190) * [-797.748] (-799.160) (-799.751) (-799.367) -- 0:00:37
666000 -- [-797.796] (-796.681) (-799.504) (-797.872) * [-796.998] (-799.659) (-802.414) (-796.837) -- 0:00:37
666500 -- (-807.666) [-794.373] (-795.450) (-801.837) * [-794.425] (-803.242) (-801.564) (-799.301) -- 0:00:37
667000 -- [-795.411] (-794.610) (-795.162) (-792.713) * (-800.557) [-798.510] (-797.452) (-801.567) -- 0:00:37
667500 -- (-800.861) (-800.062) (-807.283) [-792.738] * [-793.489] (-801.882) (-799.594) (-797.727) -- 0:00:37
668000 -- (-793.286) (-804.342) [-794.628] (-795.997) * [-797.092] (-797.067) (-799.517) (-797.942) -- 0:00:37
668500 -- (-795.976) (-796.489) [-794.187] (-797.246) * (-795.859) (-799.524) (-799.884) [-796.402] -- 0:00:37
669000 -- [-797.762] (-808.424) (-795.712) (-800.654) * (-809.063) (-799.680) [-796.766] (-799.437) -- 0:00:37
669500 -- (-799.462) (-801.629) (-798.883) [-795.066] * (-800.892) (-795.537) (-802.418) [-796.133] -- 0:00:37
670000 -- (-800.113) (-804.891) (-798.722) [-800.081] * (-806.232) (-796.063) (-791.947) [-797.991] -- 0:00:36
Average standard deviation of split frequencies: 0.011387
670500 -- (-797.265) (-794.786) (-801.882) [-805.460] * (-796.988) (-804.234) (-794.921) [-795.236] -- 0:00:36
671000 -- [-796.042] (-798.794) (-801.683) (-798.781) * (-802.217) (-798.494) (-796.023) [-798.090] -- 0:00:36
671500 -- [-796.334] (-797.169) (-796.886) (-799.835) * (-802.850) (-801.751) [-792.607] (-801.370) -- 0:00:36
672000 -- (-794.537) (-796.911) [-796.910] (-794.556) * (-799.081) (-800.688) (-797.112) [-797.172] -- 0:00:36
672500 -- (-800.373) (-794.914) (-800.049) [-794.579] * (-798.515) (-807.210) [-792.820] (-793.119) -- 0:00:36
673000 -- (-800.322) [-800.621] (-800.136) (-793.193) * [-796.756] (-796.992) (-798.553) (-795.438) -- 0:00:36
673500 -- (-799.902) [-801.098] (-796.712) (-794.487) * (-796.753) (-800.647) (-799.974) [-794.241] -- 0:00:36
674000 -- [-793.123] (-793.966) (-795.788) (-797.145) * (-796.440) (-796.425) (-800.747) [-796.057] -- 0:00:36
674500 -- (-796.374) [-797.073] (-792.063) (-797.325) * (-805.806) (-796.765) [-797.489] (-805.707) -- 0:00:36
675000 -- [-794.396] (-798.277) (-795.906) (-795.909) * (-798.772) [-795.964] (-794.018) (-805.045) -- 0:00:36
Average standard deviation of split frequencies: 0.010879
675500 -- (-792.888) [-795.656] (-796.846) (-796.181) * (-801.230) (-795.772) [-794.527] (-802.807) -- 0:00:36
676000 -- [-792.408] (-798.369) (-796.888) (-795.352) * (-798.423) [-791.469] (-794.342) (-794.588) -- 0:00:36
676500 -- (-796.570) (-796.005) [-793.447] (-797.668) * (-800.805) [-794.223] (-793.994) (-801.665) -- 0:00:36
677000 -- (-800.814) (-795.983) (-793.260) [-794.042] * (-797.075) (-791.689) (-796.668) [-795.623] -- 0:00:36
677500 -- (-803.227) (-805.897) [-793.549] (-802.146) * (-801.007) [-795.924] (-803.021) (-799.795) -- 0:00:36
678000 -- (-798.929) [-798.178] (-796.361) (-807.188) * [-794.283] (-795.391) (-797.325) (-796.544) -- 0:00:36
678500 -- [-798.995] (-796.729) (-792.442) (-803.495) * (-795.020) (-806.968) [-796.672] (-795.166) -- 0:00:36
679000 -- (-791.085) (-792.485) [-794.728] (-794.469) * (-796.497) (-802.596) [-798.943] (-805.854) -- 0:00:35
679500 -- (-794.451) [-792.218] (-796.939) (-795.144) * (-797.233) (-797.346) (-798.487) [-796.036] -- 0:00:35
680000 -- (-794.741) (-795.278) (-800.443) [-795.915] * [-801.655] (-808.099) (-795.140) (-795.966) -- 0:00:35
Average standard deviation of split frequencies: 0.010942
680500 -- (-793.502) (-791.784) (-807.720) [-793.152] * [-795.339] (-796.064) (-801.302) (-803.393) -- 0:00:35
681000 -- (-796.563) (-796.511) (-794.792) [-798.814] * (-796.210) (-798.536) [-798.458] (-793.300) -- 0:00:35
681500 -- (-797.806) (-801.387) [-798.296] (-800.235) * (-795.989) [-800.823] (-796.779) (-795.464) -- 0:00:35
682000 -- (-801.718) [-793.509] (-802.376) (-795.032) * (-793.940) (-792.171) [-792.168] (-798.728) -- 0:00:35
682500 -- (-804.274) (-798.170) (-795.739) [-801.258] * (-801.000) (-798.691) (-797.092) [-797.287] -- 0:00:35
683000 -- (-803.503) [-799.062] (-798.480) (-801.704) * (-807.253) (-795.335) [-792.294] (-798.889) -- 0:00:35
683500 -- (-795.488) (-801.196) (-802.047) [-799.756] * [-797.157] (-799.302) (-794.945) (-800.183) -- 0:00:35
684000 -- [-799.392] (-799.443) (-808.083) (-801.516) * (-799.007) (-805.487) [-798.203] (-800.976) -- 0:00:35
684500 -- (-797.040) [-798.603] (-800.485) (-795.867) * (-798.306) [-795.891] (-795.488) (-792.389) -- 0:00:35
685000 -- (-796.491) (-798.314) [-796.848] (-796.473) * [-797.671] (-797.801) (-796.384) (-806.572) -- 0:00:35
Average standard deviation of split frequencies: 0.010308
685500 -- [-799.304] (-795.710) (-799.281) (-799.052) * [-796.852] (-797.515) (-796.090) (-802.277) -- 0:00:35
686000 -- [-795.866] (-797.476) (-800.920) (-802.735) * (-800.648) (-799.045) (-797.406) [-792.830] -- 0:00:35
686500 -- (-795.845) (-804.170) (-799.249) [-794.839] * (-796.252) (-798.113) [-797.009] (-798.191) -- 0:00:35
687000 -- (-796.555) (-799.351) (-800.328) [-795.899] * [-797.193] (-797.222) (-798.980) (-793.443) -- 0:00:35
687500 -- (-792.965) (-795.493) (-804.264) [-806.805] * (-795.635) (-805.451) [-795.040] (-799.336) -- 0:00:35
688000 -- (-801.145) (-805.739) (-803.870) [-799.752] * (-796.884) (-798.777) [-799.303] (-805.173) -- 0:00:34
688500 -- (-796.985) (-794.032) [-793.087] (-800.998) * (-801.948) (-801.128) [-793.902] (-794.205) -- 0:00:34
689000 -- (-797.765) [-800.305] (-798.746) (-798.552) * (-797.150) (-795.525) (-797.816) [-798.576] -- 0:00:34
689500 -- [-799.308] (-796.458) (-806.369) (-801.070) * (-794.253) (-806.781) [-795.418] (-796.590) -- 0:00:34
690000 -- (-799.647) (-795.479) [-797.664] (-791.892) * (-794.267) [-795.318] (-794.950) (-797.294) -- 0:00:34
Average standard deviation of split frequencies: 0.009829
690500 -- (-800.135) (-800.537) (-794.817) [-792.868] * (-791.163) (-795.739) (-800.070) [-798.956] -- 0:00:34
691000 -- (-800.133) (-794.949) [-792.439] (-797.054) * (-794.092) [-795.416] (-796.628) (-798.408) -- 0:00:34
691500 -- (-802.794) (-798.104) [-798.028] (-801.932) * (-804.420) (-801.462) [-794.973] (-798.613) -- 0:00:34
692000 -- [-794.576] (-794.543) (-799.907) (-794.135) * (-798.017) (-794.357) (-794.965) [-795.611] -- 0:00:34
692500 -- (-801.521) (-798.430) [-796.659] (-796.969) * (-797.167) [-797.302] (-804.600) (-798.268) -- 0:00:34
693000 -- [-809.701] (-794.159) (-794.079) (-797.196) * (-795.256) (-802.254) (-801.589) [-791.267] -- 0:00:34
693500 -- (-799.717) (-798.513) (-794.938) [-793.165] * (-796.236) [-800.367] (-797.242) (-801.858) -- 0:00:34
694000 -- (-793.203) [-800.657] (-797.484) (-797.566) * (-794.862) [-792.232] (-797.962) (-802.308) -- 0:00:34
694500 -- (-792.769) [-796.625] (-800.282) (-795.447) * (-800.050) (-797.304) (-803.263) [-796.043] -- 0:00:34
695000 -- [-794.408] (-795.988) (-796.163) (-795.428) * (-797.492) [-791.912] (-793.821) (-794.698) -- 0:00:34
Average standard deviation of split frequencies: 0.009753
695500 -- (-799.138) [-803.690] (-800.691) (-791.402) * (-798.116) (-796.480) (-798.763) [-792.248] -- 0:00:34
696000 -- (-795.419) (-797.855) (-807.726) [-796.787] * [-794.449] (-806.757) (-807.849) (-796.804) -- 0:00:34
696500 -- (-796.330) (-795.576) [-797.992] (-799.235) * (-794.861) [-798.828] (-797.631) (-794.347) -- 0:00:33
697000 -- (-811.618) [-795.069] (-798.616) (-800.699) * (-795.631) (-793.401) (-799.580) [-794.450] -- 0:00:33
697500 -- [-793.961] (-802.063) (-804.327) (-801.471) * (-795.597) (-794.016) (-798.953) [-798.704] -- 0:00:33
698000 -- (-794.291) (-796.706) (-801.329) [-794.937] * (-795.344) (-795.833) (-805.302) [-796.891] -- 0:00:33
698500 -- [-794.978] (-801.905) (-809.024) (-796.586) * (-798.034) [-800.925] (-799.610) (-793.771) -- 0:00:33
699000 -- (-795.708) (-795.782) [-795.789] (-811.532) * (-805.053) [-794.888] (-797.723) (-795.619) -- 0:00:33
699500 -- (-799.917) (-793.903) (-793.087) [-794.967] * (-799.353) (-792.594) [-795.116] (-801.227) -- 0:00:33
700000 -- (-804.420) (-794.798) [-797.870] (-799.924) * [-795.083] (-796.905) (-799.385) (-794.692) -- 0:00:33
Average standard deviation of split frequencies: 0.010226
700500 -- (-798.533) (-799.204) (-801.574) [-798.307] * (-799.737) (-794.804) [-798.899] (-793.080) -- 0:00:33
701000 -- (-797.056) (-795.589) [-798.635] (-798.429) * (-796.568) (-794.096) (-803.086) [-795.890] -- 0:00:33
701500 -- (-805.631) (-793.768) [-801.623] (-793.499) * (-801.975) (-794.717) (-797.707) [-797.215] -- 0:00:33
702000 -- [-791.175] (-803.760) (-798.421) (-793.393) * (-795.365) (-796.798) [-800.697] (-799.381) -- 0:00:33
702500 -- (-800.598) [-792.445] (-800.642) (-796.968) * [-801.083] (-798.281) (-796.413) (-800.831) -- 0:00:33
703000 -- (-801.127) (-798.988) (-796.164) [-795.880] * (-802.772) [-795.304] (-794.222) (-800.342) -- 0:00:33
703500 -- (-797.588) (-797.981) [-791.839] (-794.122) * (-804.359) [-790.756] (-796.657) (-796.172) -- 0:00:33
704000 -- (-800.690) (-793.825) [-791.526] (-799.648) * (-799.656) (-796.239) [-794.136] (-795.989) -- 0:00:33
704500 -- [-794.428] (-796.342) (-798.663) (-791.995) * (-799.672) (-797.786) [-796.420] (-796.636) -- 0:00:33
705000 -- (-793.707) [-795.497] (-795.105) (-795.213) * (-797.056) (-799.514) [-797.776] (-799.351) -- 0:00:33
Average standard deviation of split frequencies: 0.010817
705500 -- [-793.267] (-799.576) (-800.160) (-793.722) * [-795.943] (-803.193) (-795.731) (-800.424) -- 0:00:32
706000 -- [-797.672] (-793.450) (-798.758) (-799.139) * (-798.890) [-799.225] (-797.669) (-804.473) -- 0:00:32
706500 -- (-793.433) (-796.153) (-795.151) [-796.215] * (-798.370) (-790.732) [-803.103] (-795.666) -- 0:00:32
707000 -- (-795.887) [-796.795] (-801.295) (-798.608) * (-796.139) (-795.576) (-793.315) [-799.701] -- 0:00:32
707500 -- (-803.428) (-793.655) [-799.455] (-795.569) * (-796.601) (-799.011) [-793.028] (-799.136) -- 0:00:32
708000 -- (-795.221) (-797.524) [-794.840] (-793.777) * (-801.859) [-797.828] (-801.652) (-799.724) -- 0:00:32
708500 -- (-802.593) (-794.142) [-793.032] (-793.787) * (-798.333) [-801.356] (-794.036) (-799.864) -- 0:00:32
709000 -- (-794.203) [-795.472] (-796.801) (-799.448) * (-804.263) [-799.388] (-797.095) (-795.018) -- 0:00:32
709500 -- (-796.593) [-793.990] (-798.557) (-798.750) * (-800.975) (-795.535) (-799.512) [-793.928] -- 0:00:32
710000 -- (-792.337) (-795.403) (-798.010) [-800.293] * (-799.244) (-807.144) [-798.950] (-796.825) -- 0:00:32
Average standard deviation of split frequencies: 0.011011
710500 -- (-796.261) (-797.876) (-798.604) [-793.652] * (-808.691) (-807.130) (-797.154) [-796.395] -- 0:00:32
711000 -- (-796.837) (-803.766) [-796.884] (-800.876) * (-801.747) (-802.408) (-803.452) [-794.720] -- 0:00:32
711500 -- (-799.552) [-796.018] (-798.210) (-803.974) * [-797.546] (-796.027) (-803.353) (-800.277) -- 0:00:32
712000 -- (-795.648) (-794.663) [-794.604] (-797.861) * (-796.738) (-799.166) (-800.279) [-797.206] -- 0:00:32
712500 -- (-793.984) [-794.750] (-799.909) (-800.627) * (-797.900) (-802.112) [-797.376] (-806.540) -- 0:00:32
713000 -- [-793.155] (-795.901) (-797.245) (-795.331) * (-803.159) (-798.014) [-799.267] (-802.558) -- 0:00:32
713500 -- (-800.863) (-795.947) [-796.684] (-794.226) * [-795.100] (-806.099) (-802.036) (-792.413) -- 0:00:32
714000 -- (-798.183) [-796.430] (-802.132) (-798.906) * (-796.518) [-795.748] (-807.709) (-795.260) -- 0:00:32
714500 -- (-795.884) [-794.194] (-800.878) (-797.127) * (-796.372) [-795.673] (-794.667) (-797.310) -- 0:00:31
715000 -- [-798.517] (-802.938) (-799.756) (-796.583) * [-795.999] (-797.968) (-802.846) (-799.195) -- 0:00:31
Average standard deviation of split frequencies: 0.010534
715500 -- (-796.225) (-794.710) [-796.410] (-794.623) * (-796.842) (-798.223) [-797.297] (-800.558) -- 0:00:31
716000 -- (-803.105) [-797.273] (-798.459) (-798.534) * [-800.453] (-794.431) (-797.665) (-799.199) -- 0:00:31
716500 -- (-800.880) (-794.042) [-795.687] (-792.725) * [-799.328] (-792.704) (-801.196) (-799.324) -- 0:00:31
717000 -- [-798.863] (-799.307) (-791.931) (-801.036) * [-801.401] (-798.171) (-794.624) (-800.013) -- 0:00:31
717500 -- [-801.187] (-798.181) (-795.084) (-801.659) * (-798.150) (-793.639) [-795.262] (-799.102) -- 0:00:31
718000 -- (-798.931) [-797.744] (-798.518) (-804.705) * [-796.991] (-795.981) (-796.535) (-796.346) -- 0:00:31
718500 -- (-805.128) (-795.977) (-803.125) [-804.409] * (-796.574) [-790.954] (-799.411) (-796.755) -- 0:00:31
719000 -- (-792.664) [-796.195] (-790.353) (-796.403) * (-808.249) (-794.961) (-797.405) [-795.626] -- 0:00:31
719500 -- (-799.868) [-791.880] (-796.909) (-792.086) * (-795.251) (-798.944) (-797.453) [-796.633] -- 0:00:31
720000 -- (-802.636) (-797.017) (-796.932) [-800.444] * (-800.950) (-804.823) (-798.545) [-802.497] -- 0:00:31
Average standard deviation of split frequencies: 0.010466
720500 -- [-795.988] (-803.504) (-792.995) (-802.979) * (-800.662) [-798.225] (-801.902) (-802.283) -- 0:00:31
721000 -- [-798.712] (-811.181) (-796.836) (-799.682) * (-803.694) [-789.710] (-794.879) (-797.297) -- 0:00:31
721500 -- (-798.313) [-795.443] (-796.874) (-794.856) * [-793.272] (-793.795) (-797.700) (-805.907) -- 0:00:31
722000 -- [-792.410] (-800.114) (-797.440) (-795.704) * [-795.324] (-800.299) (-805.486) (-800.567) -- 0:00:31
722500 -- [-796.615] (-799.297) (-792.598) (-805.542) * (-801.143) (-795.284) [-797.653] (-800.985) -- 0:00:31
723000 -- (-795.899) (-793.698) (-793.866) [-799.289] * [-797.701] (-797.791) (-796.701) (-798.364) -- 0:00:31
723500 -- (-800.643) (-799.866) [-792.909] (-798.298) * (-800.633) (-805.566) [-794.754] (-797.727) -- 0:00:30
724000 -- (-794.538) (-799.976) [-794.992] (-798.327) * (-796.083) (-794.869) [-795.781] (-801.265) -- 0:00:30
724500 -- [-795.584] (-802.243) (-803.517) (-801.160) * (-797.217) [-794.280] (-796.313) (-807.244) -- 0:00:30
725000 -- [-793.162] (-799.900) (-798.660) (-796.431) * [-797.785] (-799.263) (-794.406) (-805.710) -- 0:00:30
Average standard deviation of split frequencies: 0.010519
725500 -- (-799.303) (-799.402) [-793.871] (-798.453) * (-795.653) [-795.977] (-799.772) (-792.097) -- 0:00:30
726000 -- [-796.554] (-795.749) (-797.066) (-800.172) * (-802.245) (-800.011) [-793.188] (-799.692) -- 0:00:30
726500 -- (-806.124) (-794.924) (-800.778) [-796.097] * (-795.142) (-797.918) (-799.734) [-793.133] -- 0:00:30
727000 -- (-794.071) (-797.971) (-797.737) [-793.829] * [-796.235] (-803.665) (-799.137) (-801.052) -- 0:00:30
727500 -- [-801.131] (-800.186) (-799.476) (-797.425) * [-792.370] (-801.967) (-796.247) (-797.312) -- 0:00:30
728000 -- (-801.188) (-803.053) [-797.742] (-803.929) * (-793.969) [-793.810] (-795.483) (-791.063) -- 0:00:30
728500 -- (-797.989) (-798.637) [-796.610] (-799.668) * (-794.433) (-795.176) [-801.105] (-792.398) -- 0:00:30
729000 -- (-794.825) (-804.886) (-801.929) [-798.673] * (-795.078) (-796.056) [-798.504] (-796.000) -- 0:00:30
729500 -- (-799.344) (-802.912) (-803.505) [-798.818] * (-794.569) [-796.323] (-802.118) (-798.652) -- 0:00:30
730000 -- (-794.590) [-798.087] (-794.832) (-805.845) * (-793.042) [-798.256] (-797.446) (-798.298) -- 0:00:30
Average standard deviation of split frequencies: 0.009549
730500 -- (-806.137) (-798.488) [-792.223] (-796.675) * (-797.947) (-803.483) (-796.984) [-795.975] -- 0:00:30
731000 -- (-797.506) (-798.292) [-795.893] (-802.040) * (-795.978) (-795.468) [-807.340] (-801.372) -- 0:00:30
731500 -- (-805.519) (-799.853) [-797.698] (-795.047) * (-793.163) [-793.429] (-800.540) (-797.566) -- 0:00:30
732000 -- (-795.334) [-800.065] (-797.042) (-796.072) * [-795.432] (-797.483) (-800.826) (-792.747) -- 0:00:30
732500 -- (-797.473) [-795.831] (-793.902) (-795.045) * (-794.356) [-799.763] (-799.165) (-797.404) -- 0:00:29
733000 -- (-799.248) (-792.906) [-795.852] (-796.372) * (-798.340) (-796.949) (-802.339) [-796.700] -- 0:00:29
733500 -- (-804.124) [-793.580] (-799.331) (-792.870) * (-792.828) [-797.148] (-804.529) (-794.466) -- 0:00:29
734000 -- (-796.925) [-798.034] (-802.913) (-793.439) * (-795.724) [-789.634] (-796.200) (-791.594) -- 0:00:29
734500 -- (-796.037) [-802.907] (-793.995) (-796.731) * (-800.370) (-800.326) [-795.093] (-795.059) -- 0:00:29
735000 -- (-799.670) (-798.606) (-796.822) [-799.586] * (-798.219) [-799.656] (-799.499) (-798.953) -- 0:00:29
Average standard deviation of split frequencies: 0.009992
735500 -- (-805.145) (-801.507) (-800.734) [-796.217] * (-799.735) (-796.245) [-800.445] (-799.554) -- 0:00:29
736000 -- (-795.015) [-796.664] (-801.605) (-797.580) * [-804.759] (-795.529) (-798.606) (-800.423) -- 0:00:29
736500 -- (-800.240) (-806.040) (-793.859) [-798.336] * (-795.270) (-801.853) (-796.977) [-795.231] -- 0:00:29
737000 -- (-798.383) (-804.550) [-796.080] (-795.681) * [-795.812] (-803.102) (-796.101) (-799.121) -- 0:00:29
737500 -- (-800.301) (-798.315) (-797.098) [-794.195] * [-793.580] (-809.698) (-794.831) (-799.939) -- 0:00:29
738000 -- (-809.364) (-796.485) (-799.353) [-794.929] * (-792.411) (-802.315) (-796.060) [-795.413] -- 0:00:29
738500 -- (-796.157) (-798.235) (-806.002) [-801.516] * (-796.640) (-802.529) [-802.723] (-799.419) -- 0:00:29
739000 -- (-796.790) [-793.311] (-797.746) (-796.088) * (-796.989) (-800.410) [-796.810] (-798.449) -- 0:00:29
739500 -- (-800.883) (-796.356) (-800.372) [-797.686] * (-797.890) (-800.031) (-795.599) [-795.297] -- 0:00:29
740000 -- (-796.379) (-796.761) (-800.379) [-791.631] * (-794.197) (-804.665) [-794.958] (-795.448) -- 0:00:29
Average standard deviation of split frequencies: 0.010183
740500 -- (-795.816) (-792.139) [-796.515] (-796.733) * (-800.949) (-793.288) [-796.509] (-802.753) -- 0:00:29
741000 -- [-793.492] (-795.292) (-798.179) (-798.587) * (-797.891) [-795.950] (-795.936) (-799.577) -- 0:00:29
741500 -- (-794.284) (-799.206) (-791.370) [-796.553] * [-801.596] (-798.347) (-802.047) (-795.833) -- 0:00:28
742000 -- [-797.630] (-804.801) (-793.964) (-797.997) * (-804.218) [-793.754] (-795.289) (-802.686) -- 0:00:28
742500 -- (-800.156) [-793.915] (-794.703) (-801.723) * (-798.838) [-792.310] (-793.025) (-802.576) -- 0:00:28
743000 -- (-797.428) (-796.777) (-797.093) [-795.288] * (-799.241) (-799.293) (-799.484) [-798.536] -- 0:00:28
743500 -- (-797.082) [-801.249] (-798.019) (-795.667) * (-800.577) [-791.010] (-800.389) (-793.917) -- 0:00:28
744000 -- (-799.258) [-797.992] (-789.404) (-793.928) * (-798.642) [-801.517] (-796.509) (-797.734) -- 0:00:28
744500 -- (-798.427) (-802.922) [-796.936] (-795.468) * [-797.494] (-795.366) (-797.886) (-797.561) -- 0:00:28
745000 -- (-805.556) (-793.466) (-799.947) [-800.206] * (-795.360) (-793.698) (-792.232) [-795.776] -- 0:00:28
Average standard deviation of split frequencies: 0.009984
745500 -- (-797.047) (-792.340) (-802.025) [-796.293] * [-793.141] (-795.697) (-800.102) (-793.712) -- 0:00:28
746000 -- (-797.350) [-802.456] (-807.392) (-804.873) * (-794.746) [-802.381] (-793.726) (-800.450) -- 0:00:28
746500 -- (-794.011) [-793.637] (-805.851) (-800.431) * [-793.889] (-801.194) (-794.665) (-801.756) -- 0:00:28
747000 -- (-800.987) (-802.712) [-797.600] (-792.841) * [-801.356] (-806.308) (-797.357) (-800.676) -- 0:00:28
747500 -- (-794.368) [-796.752] (-800.340) (-801.470) * (-804.332) [-805.791] (-794.648) (-798.084) -- 0:00:28
748000 -- (-794.598) (-792.974) [-799.054] (-797.335) * (-798.884) (-800.976) [-797.844] (-799.721) -- 0:00:28
748500 -- (-798.756) (-800.918) (-795.674) [-794.191] * [-795.405] (-801.101) (-794.048) (-799.707) -- 0:00:28
749000 -- (-806.073) [-796.713] (-797.734) (-804.352) * (-796.955) [-797.978] (-799.303) (-794.378) -- 0:00:28
749500 -- (-799.854) (-803.553) [-792.940] (-800.258) * (-798.494) (-801.267) [-794.033] (-799.536) -- 0:00:28
750000 -- (-800.118) [-794.695] (-798.342) (-799.223) * (-799.128) (-800.196) (-798.889) [-792.706] -- 0:00:28
Average standard deviation of split frequencies: 0.010048
750500 -- [-796.998] (-797.635) (-795.020) (-800.680) * (-800.225) (-794.891) [-793.023] (-793.389) -- 0:00:27
751000 -- (-801.714) (-794.402) (-800.486) [-796.211] * (-794.585) (-803.072) [-791.005] (-805.704) -- 0:00:27
751500 -- (-801.412) (-799.011) (-794.538) [-792.063] * (-796.855) [-794.796] (-796.543) (-803.949) -- 0:00:27
752000 -- (-807.715) (-799.741) (-803.524) [-794.164] * [-805.288] (-795.991) (-793.817) (-799.451) -- 0:00:27
752500 -- (-793.600) [-799.299] (-802.849) (-799.998) * (-805.722) [-798.765] (-793.128) (-803.491) -- 0:00:27
753000 -- (-795.324) [-795.040] (-805.901) (-797.974) * [-797.085] (-804.187) (-800.752) (-801.833) -- 0:00:27
753500 -- (-796.884) (-795.526) (-793.001) [-792.308] * (-799.429) (-795.253) [-800.187] (-796.169) -- 0:00:27
754000 -- (-792.701) (-795.326) (-797.514) [-802.640] * (-794.349) (-798.385) [-793.963] (-799.741) -- 0:00:27
754500 -- [-793.842] (-792.530) (-797.464) (-794.083) * (-797.043) (-798.358) [-792.718] (-799.770) -- 0:00:27
755000 -- [-800.386] (-799.872) (-797.661) (-801.405) * (-799.999) (-793.853) (-796.754) [-800.226] -- 0:00:27
Average standard deviation of split frequencies: 0.009977
755500 -- (-804.488) (-792.273) [-795.954] (-797.972) * [-799.833] (-797.419) (-801.278) (-806.733) -- 0:00:27
756000 -- [-801.137] (-796.033) (-796.155) (-792.863) * [-796.224] (-796.814) (-803.726) (-799.704) -- 0:00:27
756500 -- [-791.700] (-803.141) (-798.593) (-807.214) * (-800.330) (-796.842) (-804.530) [-795.756] -- 0:00:27
757000 -- (-798.235) (-796.598) [-796.134] (-793.130) * (-798.048) [-791.323] (-801.003) (-795.562) -- 0:00:27
757500 -- (-793.606) (-798.493) [-794.735] (-794.084) * (-804.074) [-796.997] (-798.924) (-796.027) -- 0:00:27
758000 -- (-794.886) [-799.109] (-798.372) (-799.237) * (-796.011) (-802.418) (-800.344) [-795.182] -- 0:00:27
758500 -- [-795.127] (-794.734) (-802.379) (-798.012) * (-801.714) [-799.520] (-800.518) (-804.995) -- 0:00:27
759000 -- [-794.325] (-804.877) (-800.521) (-801.520) * (-802.883) (-808.139) [-794.416] (-796.858) -- 0:00:26
759500 -- (-796.799) (-800.470) (-800.514) [-795.447] * (-803.844) [-796.009] (-799.686) (-801.217) -- 0:00:26
760000 -- (-804.652) [-797.991] (-799.528) (-793.987) * (-799.203) [-800.741] (-802.857) (-792.543) -- 0:00:26
Average standard deviation of split frequencies: 0.009916
760500 -- [-796.378] (-801.179) (-800.084) (-797.561) * (-795.620) (-797.702) [-806.665] (-794.320) -- 0:00:26
761000 -- (-790.219) [-803.909] (-801.352) (-796.168) * (-794.834) (-794.955) [-799.234] (-796.657) -- 0:00:26
761500 -- (-793.935) (-796.234) (-795.223) [-792.230] * [-796.733] (-797.372) (-798.064) (-793.908) -- 0:00:26
762000 -- (-795.169) [-798.528] (-798.017) (-799.052) * (-796.652) (-795.331) (-797.798) [-796.748] -- 0:00:26
762500 -- [-793.089] (-794.089) (-794.085) (-796.333) * (-797.904) (-793.819) (-798.032) [-797.679] -- 0:00:26
763000 -- (-800.021) [-795.266] (-796.260) (-803.294) * (-791.377) (-796.530) [-792.686] (-799.709) -- 0:00:26
763500 -- [-794.356] (-796.752) (-795.781) (-800.242) * [-794.120] (-801.913) (-800.426) (-796.721) -- 0:00:26
764000 -- (-803.047) (-797.158) (-796.829) [-798.956] * [-793.299] (-813.887) (-796.223) (-798.117) -- 0:00:26
764500 -- (-798.444) (-797.730) (-800.472) [-799.425] * (-798.286) [-800.347] (-798.918) (-796.477) -- 0:00:26
765000 -- (-800.657) (-799.019) [-795.167] (-795.760) * (-797.707) (-796.013) (-791.513) [-792.972] -- 0:00:26
Average standard deviation of split frequencies: 0.008985
765500 -- (-798.973) (-799.883) [-800.709] (-801.376) * (-796.219) [-797.603] (-797.108) (-800.113) -- 0:00:26
766000 -- (-804.809) (-800.098) [-794.549] (-803.582) * (-797.868) (-796.323) [-794.948] (-807.985) -- 0:00:26
766500 -- (-802.628) [-797.757] (-794.351) (-800.714) * (-800.807) (-797.504) (-798.932) [-792.913] -- 0:00:26
767000 -- (-798.016) (-796.321) [-798.219] (-797.678) * [-792.749] (-800.779) (-795.924) (-792.753) -- 0:00:26
767500 -- (-806.955) (-792.439) [-796.691] (-808.046) * (-794.419) [-797.091] (-794.754) (-799.233) -- 0:00:26
768000 -- (-794.355) (-798.078) [-797.942] (-795.851) * (-794.515) (-792.707) [-795.832] (-801.260) -- 0:00:25
768500 -- (-793.526) [-793.409] (-793.561) (-793.883) * (-803.315) [-796.303] (-798.019) (-800.091) -- 0:00:25
769000 -- (-801.462) [-797.053] (-792.267) (-798.971) * [-803.273] (-793.937) (-792.775) (-795.526) -- 0:00:25
769500 -- (-797.751) (-810.092) [-794.848] (-800.078) * (-796.390) (-796.138) [-797.281] (-798.049) -- 0:00:25
770000 -- (-795.803) (-797.041) [-792.075] (-798.892) * [-790.403] (-799.613) (-796.070) (-796.230) -- 0:00:25
Average standard deviation of split frequencies: 0.008808
770500 -- (-801.411) [-795.593] (-799.737) (-801.061) * (-792.921) (-793.039) (-793.055) [-800.393] -- 0:00:25
771000 -- (-800.582) (-793.010) (-798.142) [-799.662] * (-794.728) (-792.459) [-800.162] (-803.497) -- 0:00:25
771500 -- (-799.340) [-792.351] (-808.315) (-795.831) * (-808.730) [-798.979] (-792.800) (-796.657) -- 0:00:25
772000 -- (-798.936) (-805.551) (-798.072) [-796.829] * (-797.351) [-793.931] (-801.940) (-800.780) -- 0:00:25
772500 -- (-796.660) (-796.128) (-797.275) [-798.504] * (-802.237) (-801.886) [-799.129] (-801.465) -- 0:00:25
773000 -- (-803.623) (-797.666) (-791.210) [-797.374] * (-797.617) (-803.040) (-798.357) [-799.310] -- 0:00:25
773500 -- (-796.044) (-799.777) [-797.048] (-793.259) * (-798.421) (-797.582) [-793.207] (-799.058) -- 0:00:25
774000 -- [-794.416] (-796.447) (-794.744) (-794.656) * (-793.627) [-803.256] (-798.731) (-794.486) -- 0:00:25
774500 -- (-795.174) (-801.437) (-797.541) [-802.242] * (-804.212) (-807.575) (-795.730) [-801.101] -- 0:00:25
775000 -- (-798.516) [-802.117] (-794.236) (-796.648) * (-797.673) (-806.249) [-796.259] (-802.893) -- 0:00:25
Average standard deviation of split frequencies: 0.008991
775500 -- (-800.127) (-794.343) [-794.202] (-796.255) * (-798.433) (-794.061) [-795.207] (-795.223) -- 0:00:25
776000 -- [-801.703] (-802.790) (-795.072) (-796.544) * (-801.423) (-795.155) [-798.413] (-796.727) -- 0:00:25
776500 -- (-797.918) [-796.306] (-804.584) (-801.509) * (-796.159) [-796.863] (-794.263) (-795.397) -- 0:00:25
777000 -- (-795.977) [-795.019] (-794.441) (-794.764) * (-796.043) (-799.066) (-794.709) [-796.976] -- 0:00:24
777500 -- [-795.749] (-797.363) (-797.257) (-792.134) * (-800.056) (-798.437) [-795.324] (-806.833) -- 0:00:24
778000 -- (-800.975) [-799.449] (-793.914) (-797.288) * (-796.114) [-799.743] (-793.440) (-802.930) -- 0:00:24
778500 -- (-797.483) (-794.535) (-793.820) [-796.819] * (-795.334) (-797.036) [-791.519] (-796.007) -- 0:00:24
779000 -- (-792.100) (-795.911) (-792.061) [-801.567] * [-792.252] (-802.502) (-791.202) (-806.721) -- 0:00:24
779500 -- [-798.896] (-798.027) (-797.695) (-798.929) * (-800.295) (-799.397) [-794.258] (-795.284) -- 0:00:24
780000 -- (-793.729) (-805.490) (-802.780) [-795.615] * (-799.648) (-796.116) [-798.117] (-800.420) -- 0:00:24
Average standard deviation of split frequencies: 0.008816
780500 -- (-796.437) [-795.157] (-794.839) (-796.440) * [-796.911] (-791.953) (-797.309) (-795.181) -- 0:00:24
781000 -- (-800.651) [-801.591] (-798.388) (-797.678) * [-798.081] (-800.585) (-797.182) (-804.185) -- 0:00:24
781500 -- (-800.224) (-811.962) (-794.662) [-795.222] * [-795.986] (-797.676) (-796.797) (-794.842) -- 0:00:24
782000 -- (-798.391) (-801.444) [-794.372] (-792.005) * (-796.745) [-806.229] (-803.467) (-797.014) -- 0:00:24
782500 -- (-798.753) (-813.351) (-793.855) [-796.168] * (-804.279) (-805.690) (-800.659) [-799.735] -- 0:00:24
783000 -- (-801.549) (-804.530) (-797.285) [-795.342] * (-799.287) (-792.964) (-799.526) [-796.353] -- 0:00:24
783500 -- [-799.587] (-797.704) (-796.939) (-794.880) * (-800.480) (-795.582) [-799.784] (-797.611) -- 0:00:24
784000 -- (-796.166) [-798.352] (-793.929) (-799.412) * (-797.791) (-797.136) (-799.685) [-796.756] -- 0:00:24
784500 -- [-800.988] (-799.711) (-792.860) (-803.210) * (-795.244) (-793.963) [-795.249] (-794.935) -- 0:00:24
785000 -- (-801.117) (-801.784) [-797.092] (-801.651) * (-800.359) (-798.332) [-798.907] (-793.345) -- 0:00:24
Average standard deviation of split frequencies: 0.008636
785500 -- (-794.750) [-792.972] (-797.011) (-799.697) * (-792.873) (-799.179) (-794.547) [-800.079] -- 0:00:24
786000 -- [-797.395] (-800.430) (-798.338) (-791.734) * [-799.878] (-799.958) (-800.922) (-802.629) -- 0:00:23
786500 -- (-803.034) (-801.199) [-803.218] (-791.428) * [-796.785] (-797.177) (-804.316) (-796.724) -- 0:00:23
787000 -- (-794.520) [-799.560] (-800.137) (-798.781) * (-798.661) (-807.430) [-802.602] (-797.458) -- 0:00:23
787500 -- (-796.780) (-800.584) (-795.166) [-794.493] * (-798.825) [-797.199] (-801.189) (-801.883) -- 0:00:23
788000 -- (-794.710) (-794.738) [-799.182] (-796.112) * (-802.205) (-798.610) (-801.438) [-796.584] -- 0:00:23
788500 -- (-800.453) (-796.519) (-802.837) [-798.775] * (-801.596) (-794.234) (-804.219) [-798.096] -- 0:00:23
789000 -- (-801.107) (-797.081) (-794.463) [-797.831] * (-797.981) (-796.252) (-800.824) [-798.136] -- 0:00:23
789500 -- (-800.123) (-794.893) [-794.879] (-798.792) * [-793.830] (-796.290) (-793.703) (-796.208) -- 0:00:23
790000 -- [-790.637] (-803.622) (-796.244) (-802.438) * (-794.719) (-798.740) (-795.855) [-794.355] -- 0:00:23
Average standard deviation of split frequencies: 0.008466
790500 -- (-801.660) (-799.500) (-800.136) [-795.141] * [-796.915] (-795.846) (-796.828) (-800.683) -- 0:00:23
791000 -- [-795.389] (-796.683) (-793.967) (-793.687) * (-796.781) (-798.384) (-796.984) [-794.026] -- 0:00:23
791500 -- (-794.508) (-801.338) [-795.341] (-796.307) * (-799.503) (-798.253) [-803.788] (-796.987) -- 0:00:23
792000 -- (-800.776) [-795.061] (-798.779) (-798.789) * (-796.298) [-793.279] (-807.790) (-800.135) -- 0:00:23
792500 -- [-800.210] (-809.275) (-798.229) (-801.138) * [-798.143] (-798.511) (-798.477) (-800.169) -- 0:00:23
793000 -- (-801.035) (-801.830) [-795.767] (-793.631) * (-797.187) (-797.961) [-793.522] (-804.878) -- 0:00:23
793500 -- (-807.445) (-795.193) [-793.156] (-802.611) * (-802.673) (-792.486) [-798.199] (-799.315) -- 0:00:23
794000 -- (-800.251) [-792.993] (-792.320) (-792.849) * [-800.819] (-806.439) (-797.743) (-797.527) -- 0:00:23
794500 -- (-798.896) [-800.057] (-795.617) (-804.961) * [-795.756] (-798.691) (-795.205) (-797.167) -- 0:00:23
795000 -- (-791.599) (-796.340) (-794.940) [-800.672] * [-795.773] (-796.384) (-796.720) (-804.365) -- 0:00:22
Average standard deviation of split frequencies: 0.007817
795500 -- (-795.658) (-793.938) [-796.604] (-797.705) * [-799.144] (-797.249) (-801.294) (-798.201) -- 0:00:22
796000 -- (-797.183) (-802.767) (-804.119) [-803.096] * (-799.424) (-798.622) [-798.419] (-808.226) -- 0:00:22
796500 -- (-793.753) (-798.594) (-795.079) [-802.605] * (-799.246) (-798.267) (-812.369) [-794.647] -- 0:00:22
797000 -- (-796.557) [-802.506] (-801.037) (-793.813) * (-795.843) [-794.857] (-802.706) (-798.200) -- 0:00:22
797500 -- (-796.221) [-797.433] (-798.741) (-798.510) * [-794.543] (-795.092) (-800.776) (-792.561) -- 0:00:22
798000 -- (-796.702) (-798.477) [-800.881] (-795.163) * (-796.239) (-797.091) (-801.047) [-796.096] -- 0:00:22
798500 -- (-797.282) [-798.841] (-802.598) (-800.674) * (-800.474) [-794.388] (-802.523) (-799.469) -- 0:00:22
799000 -- (-793.565) (-797.251) [-795.133] (-798.466) * (-799.544) (-802.559) [-797.174] (-795.822) -- 0:00:22
799500 -- [-793.227] (-800.556) (-801.761) (-803.967) * (-792.783) (-793.215) (-798.551) [-799.840] -- 0:00:22
800000 -- (-793.511) (-795.981) (-797.831) [-798.852] * (-796.047) [-794.924] (-794.334) (-800.668) -- 0:00:22
Average standard deviation of split frequencies: 0.006712
800500 -- (-799.693) [-795.700] (-802.927) (-793.792) * (-797.976) [-796.224] (-797.721) (-801.284) -- 0:00:22
801000 -- (-802.964) [-793.829] (-796.529) (-796.246) * (-803.130) [-796.416] (-796.747) (-792.062) -- 0:00:22
801500 -- (-798.822) [-800.606] (-795.318) (-797.403) * (-795.426) [-800.200] (-798.002) (-796.000) -- 0:00:22
802000 -- [-797.890] (-797.334) (-800.914) (-796.561) * (-794.602) (-793.405) (-804.708) [-790.836] -- 0:00:22
802500 -- (-795.575) [-798.980] (-800.166) (-800.161) * [-794.327] (-800.552) (-797.264) (-796.486) -- 0:00:22
803000 -- [-803.751] (-794.372) (-799.604) (-797.645) * (-796.989) (-806.350) (-794.845) [-795.657] -- 0:00:22
803500 -- (-802.236) (-792.240) (-799.952) [-793.928] * (-794.294) (-797.485) (-808.762) [-794.321] -- 0:00:22
804000 -- (-796.200) [-795.058] (-797.688) (-799.089) * (-794.885) (-794.334) (-800.704) [-797.152] -- 0:00:21
804500 -- (-794.826) (-798.217) (-796.447) [-792.233] * (-795.658) [-795.419] (-801.730) (-797.833) -- 0:00:21
805000 -- [-798.797] (-802.892) (-799.303) (-795.433) * [-794.232] (-794.760) (-794.379) (-805.229) -- 0:00:21
Average standard deviation of split frequencies: 0.007135
805500 -- (-805.680) (-796.347) (-800.386) [-793.452] * (-797.335) [-798.654] (-795.994) (-793.848) -- 0:00:21
806000 -- [-793.969] (-795.712) (-795.518) (-797.668) * (-799.863) (-805.228) (-800.886) [-793.976] -- 0:00:21
806500 -- [-792.588] (-794.812) (-801.588) (-794.865) * (-799.350) [-795.046] (-798.656) (-790.836) -- 0:00:21
807000 -- (-795.776) (-797.338) (-797.641) [-797.686] * (-797.267) [-794.203] (-804.172) (-798.266) -- 0:00:21
807500 -- (-799.344) [-805.361] (-797.255) (-797.056) * (-796.695) [-794.571] (-801.172) (-803.390) -- 0:00:21
808000 -- (-793.918) (-798.402) (-801.754) [-790.705] * (-796.282) (-803.297) [-797.241] (-802.195) -- 0:00:21
808500 -- (-798.249) [-796.364] (-793.047) (-798.445) * [-797.948] (-796.136) (-794.477) (-805.553) -- 0:00:21
809000 -- (-801.307) (-798.551) (-794.356) [-795.593] * (-796.467) (-798.490) [-799.504] (-796.192) -- 0:00:21
809500 -- [-789.854] (-801.486) (-796.999) (-793.271) * (-799.007) (-796.534) [-793.600] (-792.624) -- 0:00:21
810000 -- [-796.830] (-797.105) (-794.316) (-796.962) * [-802.526] (-794.282) (-794.668) (-798.314) -- 0:00:21
Average standard deviation of split frequencies: 0.007211
810500 -- [-792.574] (-806.202) (-798.496) (-798.144) * (-798.533) (-803.420) (-797.127) [-799.556] -- 0:00:21
811000 -- (-804.521) (-808.216) [-795.628] (-791.757) * (-801.999) (-802.272) [-794.147] (-798.111) -- 0:00:21
811500 -- (-803.137) (-801.671) (-794.451) [-798.407] * (-793.308) [-795.686] (-801.917) (-794.947) -- 0:00:21
812000 -- [-793.877] (-798.384) (-804.444) (-794.471) * (-801.885) [-795.773] (-795.872) (-797.273) -- 0:00:21
812500 -- (-799.908) (-799.926) (-799.386) [-793.529] * (-802.574) [-792.526] (-798.904) (-794.533) -- 0:00:21
813000 -- (-795.967) (-795.277) [-798.770] (-797.445) * (-795.366) (-796.364) [-795.584] (-797.569) -- 0:00:20
813500 -- (-794.243) (-795.816) (-795.337) [-796.489] * (-801.008) (-795.122) [-795.432] (-802.440) -- 0:00:20
814000 -- (-792.154) [-793.594] (-797.589) (-799.431) * (-800.384) (-802.139) [-795.209] (-799.601) -- 0:00:20
814500 -- (-797.859) (-798.108) [-799.932] (-795.264) * (-798.849) (-801.292) [-795.057] (-796.566) -- 0:00:20
815000 -- (-795.526) [-798.104] (-801.890) (-795.949) * (-801.070) (-796.535) (-795.248) [-799.999] -- 0:00:20
Average standard deviation of split frequencies: 0.007048
815500 -- (-792.766) [-799.986] (-805.057) (-798.453) * (-801.738) (-795.261) (-800.647) [-796.041] -- 0:00:20
816000 -- (-802.632) (-794.802) [-799.018] (-797.401) * (-800.511) [-796.061] (-794.526) (-796.627) -- 0:00:20
816500 -- [-794.832] (-793.905) (-794.745) (-797.076) * (-795.782) (-799.507) (-794.403) [-797.076] -- 0:00:20
817000 -- (-800.157) (-798.879) (-796.693) [-798.107] * [-797.853] (-800.663) (-795.061) (-801.950) -- 0:00:20
817500 -- [-799.149] (-796.951) (-797.881) (-795.878) * (-797.581) [-793.005] (-791.872) (-794.480) -- 0:00:20
818000 -- [-799.260] (-800.195) (-797.452) (-799.628) * (-797.009) [-801.225] (-798.131) (-795.539) -- 0:00:20
818500 -- (-798.598) (-797.649) (-804.235) [-792.493] * (-795.250) (-798.195) (-796.045) [-796.717] -- 0:00:20
819000 -- (-804.251) (-798.050) (-807.299) [-798.647] * [-793.635] (-803.343) (-803.967) (-797.173) -- 0:00:20
819500 -- [-797.186] (-795.411) (-800.975) (-801.885) * (-794.446) (-794.337) (-797.743) [-796.063] -- 0:00:20
820000 -- (-802.651) [-794.295] (-805.891) (-800.280) * (-796.900) [-795.621] (-800.187) (-802.711) -- 0:00:20
Average standard deviation of split frequencies: 0.007123
820500 -- [-792.588] (-794.438) (-807.176) (-798.920) * (-798.366) (-794.679) (-797.075) [-802.261] -- 0:00:20
821000 -- (-797.746) (-796.651) (-801.012) [-798.760] * [-797.391] (-797.441) (-800.172) (-797.753) -- 0:00:20
821500 -- (-798.779) [-804.417] (-803.735) (-793.020) * (-796.243) (-799.089) (-797.398) [-794.980] -- 0:00:19
822000 -- (-798.621) [-796.192] (-799.659) (-791.476) * [-790.978] (-790.492) (-799.991) (-797.346) -- 0:00:19
822500 -- (-795.878) [-795.537] (-798.474) (-797.129) * [-804.837] (-804.499) (-800.450) (-797.871) -- 0:00:19
823000 -- [-794.746] (-799.801) (-800.324) (-792.755) * (-801.838) (-801.394) (-799.626) [-795.853] -- 0:00:19
823500 -- (-793.487) (-798.343) (-801.111) [-799.001] * (-795.797) (-806.262) [-797.668] (-795.452) -- 0:00:19
824000 -- [-792.211] (-798.789) (-804.278) (-801.120) * [-797.204] (-806.807) (-792.151) (-801.022) -- 0:00:19
824500 -- (-798.695) [-793.962] (-798.471) (-795.788) * (-795.896) (-800.780) (-797.658) [-795.284] -- 0:00:19
825000 -- [-792.330] (-798.478) (-794.716) (-792.088) * (-802.063) (-795.987) [-797.528] (-795.645) -- 0:00:19
Average standard deviation of split frequencies: 0.007533
825500 -- (-798.930) [-798.548] (-800.960) (-795.721) * [-798.483] (-802.869) (-797.359) (-801.348) -- 0:00:19
826000 -- (-796.085) (-797.696) [-801.181] (-797.970) * (-802.194) (-794.333) (-803.321) [-791.447] -- 0:00:19
826500 -- [-799.782] (-800.372) (-796.187) (-800.776) * (-800.951) (-798.631) (-794.754) [-795.213] -- 0:00:19
827000 -- (-796.729) (-796.214) (-798.623) [-793.836] * (-798.317) [-797.683] (-798.759) (-800.685) -- 0:00:19
827500 -- (-797.609) (-803.728) (-802.445) [-797.322] * (-793.624) [-800.220] (-807.525) (-805.563) -- 0:00:19
828000 -- (-801.505) (-805.113) (-797.202) [-800.837] * (-802.879) (-801.482) [-795.413] (-806.420) -- 0:00:19
828500 -- (-799.958) (-797.634) [-796.225] (-798.952) * (-794.737) [-802.828] (-798.729) (-805.869) -- 0:00:19
829000 -- (-799.876) [-794.396] (-794.416) (-790.559) * [-796.277] (-795.756) (-801.937) (-803.770) -- 0:00:19
829500 -- [-795.360] (-800.508) (-808.073) (-796.993) * (-799.186) (-798.008) [-790.976] (-805.229) -- 0:00:19
830000 -- (-792.754) (-803.573) (-801.241) [-793.799] * (-796.680) [-797.201] (-798.391) (-801.513) -- 0:00:19
Average standard deviation of split frequencies: 0.007832
830500 -- (-802.029) (-796.126) [-792.707] (-794.103) * (-799.354) [-799.436] (-794.158) (-802.352) -- 0:00:18
831000 -- (-796.950) [-793.807] (-802.488) (-804.988) * (-798.873) [-796.631] (-792.779) (-798.305) -- 0:00:18
831500 -- (-794.541) (-794.066) (-803.644) [-794.868] * (-801.819) (-797.708) [-796.327] (-799.891) -- 0:00:18
832000 -- (-798.093) (-799.765) (-800.873) [-795.233] * (-804.833) [-794.691] (-797.808) (-800.580) -- 0:00:18
832500 -- [-799.273] (-801.444) (-798.618) (-806.077) * (-799.798) [-806.640] (-799.062) (-795.568) -- 0:00:18
833000 -- [-799.558] (-796.855) (-795.163) (-794.801) * (-797.602) (-793.874) [-798.631] (-799.142) -- 0:00:18
833500 -- (-797.052) (-797.192) [-801.122] (-802.410) * (-796.099) (-799.280) (-803.303) [-798.289] -- 0:00:18
834000 -- (-801.976) (-798.424) (-790.667) [-797.188] * [-797.398] (-798.662) (-800.374) (-793.296) -- 0:00:18
834500 -- (-798.335) (-794.834) (-799.141) [-799.729] * (-798.056) [-795.788] (-803.232) (-799.212) -- 0:00:18
835000 -- (-796.351) [-799.440] (-801.338) (-794.076) * (-796.532) [-800.906] (-799.282) (-802.035) -- 0:00:18
Average standard deviation of split frequencies: 0.007443
835500 -- (-803.515) (-800.945) [-796.310] (-795.334) * (-795.698) [-797.623] (-805.286) (-796.230) -- 0:00:18
836000 -- [-793.742] (-796.748) (-799.360) (-802.033) * (-798.740) (-792.645) (-801.306) [-793.734] -- 0:00:18
836500 -- (-797.751) [-806.733] (-813.250) (-797.659) * (-800.419) [-796.733] (-799.230) (-793.282) -- 0:00:18
837000 -- [-804.397] (-796.911) (-798.166) (-798.669) * [-798.541] (-795.998) (-800.777) (-799.230) -- 0:00:18
837500 -- [-797.276] (-793.716) (-797.455) (-797.969) * (-798.141) (-799.233) (-795.903) [-801.392] -- 0:00:18
838000 -- (-795.148) [-796.149] (-802.226) (-796.729) * (-797.696) [-794.491] (-798.239) (-798.208) -- 0:00:18
838500 -- (-798.078) (-794.405) (-794.227) [-799.590] * (-796.232) (-795.681) [-793.934] (-795.214) -- 0:00:18
839000 -- (-802.418) (-793.815) [-792.906] (-797.619) * (-802.203) (-796.939) [-796.997] (-797.389) -- 0:00:18
839500 -- (-805.287) [-799.956] (-801.760) (-793.995) * (-796.894) (-796.276) (-798.029) [-796.698] -- 0:00:17
840000 -- (-803.533) (-796.398) (-798.871) [-793.621] * (-796.213) [-804.233] (-795.419) (-794.824) -- 0:00:17
Average standard deviation of split frequencies: 0.008523
840500 -- (-793.730) (-797.381) [-795.253] (-796.728) * (-796.903) [-800.118] (-796.667) (-801.147) -- 0:00:17
841000 -- [-800.790] (-796.943) (-798.043) (-797.069) * (-794.004) (-801.119) [-803.896] (-804.503) -- 0:00:17
841500 -- (-801.816) [-801.923] (-802.144) (-793.741) * (-801.079) [-795.664] (-795.270) (-802.522) -- 0:00:17
842000 -- (-804.072) [-795.205] (-804.489) (-797.162) * [-795.068] (-800.353) (-797.507) (-791.920) -- 0:00:17
842500 -- (-796.564) (-797.869) [-797.959] (-795.554) * (-798.152) (-801.728) (-798.904) [-793.368] -- 0:00:17
843000 -- (-800.807) (-800.533) [-797.823] (-800.052) * (-796.694) [-799.777] (-796.927) (-793.071) -- 0:00:17
843500 -- (-803.262) (-796.166) [-795.896] (-797.933) * (-796.391) [-795.264] (-803.227) (-795.820) -- 0:00:17
844000 -- (-794.936) (-795.130) (-794.310) [-796.081] * (-800.552) (-795.238) [-795.562] (-793.403) -- 0:00:17
844500 -- [-796.304] (-795.035) (-799.193) (-796.314) * (-798.967) [-794.128] (-805.678) (-796.931) -- 0:00:17
845000 -- (-800.660) (-796.165) (-800.642) [-799.067] * (-795.336) (-798.016) [-795.469] (-798.675) -- 0:00:17
Average standard deviation of split frequencies: 0.008915
845500 -- (-798.701) (-795.604) (-805.445) [-798.725] * [-795.088] (-798.668) (-800.034) (-800.373) -- 0:00:17
846000 -- (-796.667) (-790.293) [-796.315] (-791.103) * (-796.151) (-794.822) [-797.284] (-797.081) -- 0:00:17
846500 -- [-791.461] (-793.211) (-793.277) (-797.767) * [-803.089] (-796.541) (-801.585) (-797.260) -- 0:00:17
847000 -- (-797.995) (-795.214) (-797.073) [-797.201] * [-800.935] (-795.511) (-793.653) (-800.737) -- 0:00:17
847500 -- (-807.227) (-799.345) [-794.128] (-800.534) * [-793.822] (-796.888) (-796.331) (-796.902) -- 0:00:17
848000 -- (-796.258) (-793.882) [-795.647] (-797.420) * [-795.556] (-808.016) (-794.158) (-801.649) -- 0:00:17
848500 -- (-799.660) [-795.858] (-797.828) (-793.827) * (-800.782) (-802.485) (-804.806) [-796.626] -- 0:00:16
849000 -- (-797.995) [-792.120] (-800.657) (-791.493) * (-796.251) (-794.344) (-798.394) [-799.971] -- 0:00:16
849500 -- [-802.193] (-796.615) (-800.674) (-801.485) * (-795.198) (-794.535) [-793.144] (-801.905) -- 0:00:16
850000 -- (-797.560) [-792.551] (-802.101) (-802.839) * (-798.623) [-793.788] (-794.969) (-794.242) -- 0:00:16
Average standard deviation of split frequencies: 0.008756
850500 -- (-795.987) [-790.397] (-796.271) (-801.141) * [-794.069] (-804.001) (-804.516) (-799.651) -- 0:00:16
851000 -- [-797.335] (-795.477) (-799.868) (-796.238) * (-797.517) [-794.250] (-802.665) (-798.061) -- 0:00:16
851500 -- (-798.899) [-805.281] (-801.747) (-802.907) * (-797.749) (-791.686) [-796.488] (-795.739) -- 0:00:16
852000 -- (-801.549) (-792.838) (-805.016) [-794.965] * (-795.822) (-797.610) [-796.069] (-810.179) -- 0:00:16
852500 -- [-797.195] (-796.479) (-797.223) (-794.969) * (-802.700) (-792.798) [-794.833] (-798.019) -- 0:00:16
853000 -- (-804.459) (-799.153) (-796.893) [-791.806] * (-797.353) (-797.681) (-801.613) [-793.326] -- 0:00:16
853500 -- (-802.119) (-795.995) (-796.251) [-792.799] * (-799.177) (-801.640) [-799.344] (-797.560) -- 0:00:16
854000 -- (-796.836) (-797.153) (-799.103) [-796.409] * (-798.754) (-799.671) [-794.640] (-803.587) -- 0:00:16
854500 -- [-796.444] (-794.428) (-797.385) (-792.667) * (-794.014) (-796.853) [-796.815] (-791.610) -- 0:00:16
855000 -- (-797.117) (-800.439) (-800.101) [-796.885] * (-803.942) [-792.735] (-797.335) (-791.254) -- 0:00:16
Average standard deviation of split frequencies: 0.009032
855500 -- (-791.554) (-804.813) (-796.458) [-800.725] * [-797.231] (-795.879) (-794.205) (-796.940) -- 0:00:16
856000 -- (-796.971) [-800.214] (-798.103) (-802.348) * (-802.097) (-791.294) [-793.792] (-796.601) -- 0:00:16
856500 -- (-801.310) (-792.671) (-797.835) [-797.670] * (-797.203) [-795.092] (-798.269) (-799.171) -- 0:00:16
857000 -- [-797.660] (-792.860) (-801.390) (-803.631) * (-803.493) (-800.059) (-800.347) [-791.144] -- 0:00:16
857500 -- (-805.931) [-791.994] (-804.041) (-810.703) * (-801.329) [-797.470] (-792.304) (-804.812) -- 0:00:15
858000 -- (-803.163) (-799.665) (-794.267) [-795.754] * (-794.947) [-798.043] (-798.780) (-797.475) -- 0:00:15
858500 -- [-798.467] (-797.569) (-804.039) (-792.563) * (-796.325) (-804.116) (-799.319) [-792.852] -- 0:00:15
859000 -- (-792.993) [-796.254] (-799.429) (-804.237) * (-797.142) (-798.990) (-800.363) [-796.196] -- 0:00:15
859500 -- [-800.015] (-793.878) (-793.508) (-796.590) * (-799.465) (-796.417) [-797.057] (-805.311) -- 0:00:15
860000 -- (-800.773) [-804.861] (-800.056) (-800.719) * (-800.564) (-799.154) (-800.355) [-802.012] -- 0:00:15
Average standard deviation of split frequencies: 0.009092
860500 -- (-797.871) (-798.350) [-792.343] (-795.549) * (-793.406) (-792.996) (-798.220) [-799.040] -- 0:00:15
861000 -- (-799.860) (-793.693) (-796.706) [-798.554] * [-793.312] (-791.406) (-795.422) (-802.081) -- 0:00:15
861500 -- [-796.751] (-801.933) (-802.481) (-805.932) * (-796.015) (-791.280) [-792.168] (-795.840) -- 0:00:15
862000 -- (-798.601) (-795.757) (-797.684) [-796.262] * (-800.254) [-794.290] (-798.861) (-794.961) -- 0:00:15
862500 -- (-797.606) (-791.884) [-800.034] (-801.605) * (-797.216) [-796.289] (-795.162) (-797.882) -- 0:00:15
863000 -- [-796.748] (-801.704) (-793.675) (-794.059) * (-799.558) (-796.880) [-795.109] (-794.000) -- 0:00:15
863500 -- (-796.957) (-797.405) [-796.684] (-794.405) * (-808.759) (-792.968) [-794.155] (-801.528) -- 0:00:15
864000 -- (-801.138) [-795.515] (-797.665) (-795.579) * (-798.822) (-795.893) [-801.106] (-796.602) -- 0:00:15
864500 -- (-798.942) (-800.229) (-800.192) [-795.009] * [-797.490] (-796.251) (-795.918) (-795.626) -- 0:00:15
865000 -- (-800.191) (-797.211) [-796.725] (-798.452) * (-804.556) (-794.144) [-797.472] (-796.871) -- 0:00:15
Average standard deviation of split frequencies: 0.009581
865500 -- (-795.276) [-794.132] (-801.425) (-804.602) * [-796.137] (-796.470) (-800.160) (-791.985) -- 0:00:15
866000 -- (-799.855) (-797.998) [-796.158] (-797.153) * (-795.357) (-796.391) (-794.152) [-793.973] -- 0:00:15
866500 -- (-800.054) (-805.254) [-798.776] (-799.623) * (-800.213) (-794.218) [-791.283] (-797.339) -- 0:00:14
867000 -- [-796.753] (-799.837) (-797.537) (-803.911) * (-797.378) (-798.552) [-797.705] (-796.046) -- 0:00:14
867500 -- (-801.075) (-798.624) (-795.576) [-795.673] * [-791.940] (-806.997) (-795.936) (-804.702) -- 0:00:14
868000 -- (-807.543) (-796.101) (-795.789) [-797.476] * (-801.034) (-792.757) (-797.497) [-795.747] -- 0:00:14
868500 -- (-800.572) (-804.624) [-795.745] (-804.190) * (-799.895) (-793.609) [-796.061] (-797.091) -- 0:00:14
869000 -- (-803.062) (-799.285) (-794.806) [-793.671] * [-795.323] (-798.599) (-798.993) (-793.671) -- 0:00:14
869500 -- (-797.314) (-801.163) (-797.120) [-799.372] * (-799.615) (-797.353) [-800.951] (-796.890) -- 0:00:14
870000 -- (-794.104) (-801.708) (-794.833) [-793.816] * (-797.346) [-793.633] (-799.365) (-797.374) -- 0:00:14
Average standard deviation of split frequencies: 0.009204
870500 -- [-794.478] (-800.784) (-799.392) (-799.847) * (-802.233) (-796.232) (-800.931) [-797.935] -- 0:00:14
871000 -- (-796.068) (-803.791) (-796.421) [-800.307] * (-799.873) [-800.247] (-795.928) (-799.591) -- 0:00:14
871500 -- (-803.151) [-798.113] (-806.984) (-799.503) * (-794.213) (-798.341) [-795.649] (-793.620) -- 0:00:14
872000 -- (-802.071) (-800.096) [-802.804] (-804.220) * (-796.556) [-794.319] (-793.586) (-797.640) -- 0:00:14
872500 -- (-803.453) (-797.990) [-796.017] (-804.422) * (-799.149) (-801.821) [-797.463] (-804.292) -- 0:00:14
873000 -- (-793.939) [-795.893] (-803.892) (-801.073) * [-798.784] (-798.582) (-796.161) (-792.554) -- 0:00:14
873500 -- (-803.700) [-794.988] (-799.565) (-801.983) * (-796.540) (-796.440) [-793.993] (-796.055) -- 0:00:14
874000 -- (-799.229) (-799.043) [-792.254] (-797.354) * (-793.610) (-796.900) [-797.430] (-799.551) -- 0:00:14
874500 -- (-797.056) (-805.684) [-794.942] (-794.892) * (-800.601) [-791.836] (-792.125) (-796.625) -- 0:00:14
875000 -- (-798.251) (-796.529) [-793.889] (-798.159) * (-804.573) (-796.926) [-793.083] (-800.409) -- 0:00:14
Average standard deviation of split frequencies: 0.008933
875500 -- [-798.878] (-799.987) (-796.983) (-800.475) * [-798.986] (-796.361) (-797.715) (-798.133) -- 0:00:13
876000 -- (-804.161) (-794.759) [-794.213] (-790.140) * (-804.925) (-798.427) (-793.248) [-799.951] -- 0:00:13
876500 -- (-799.940) (-799.274) (-793.849) [-791.376] * [-798.713] (-799.254) (-798.816) (-794.349) -- 0:00:13
877000 -- (-801.111) (-797.809) (-798.085) [-800.922] * [-797.160] (-796.053) (-792.685) (-801.715) -- 0:00:13
877500 -- (-808.100) (-796.666) [-795.846] (-796.402) * (-803.995) [-793.929] (-793.792) (-802.364) -- 0:00:13
878000 -- (-796.506) (-796.256) (-796.532) [-791.270] * (-799.357) [-807.852] (-799.256) (-799.043) -- 0:00:13
878500 -- [-798.126] (-792.750) (-800.742) (-795.438) * (-802.460) (-796.175) [-799.988] (-799.814) -- 0:00:13
879000 -- [-795.858] (-798.674) (-803.311) (-791.615) * (-797.191) (-801.648) (-806.389) [-794.487] -- 0:00:13
879500 -- (-798.124) (-804.221) [-790.629] (-799.516) * (-792.727) (-798.757) (-795.592) [-793.265] -- 0:00:13
880000 -- (-803.932) (-803.238) (-798.460) [-804.929] * (-795.748) [-790.598] (-795.769) (-793.218) -- 0:00:13
Average standard deviation of split frequencies: 0.008350
880500 -- [-793.878] (-800.534) (-801.301) (-802.121) * (-795.634) (-796.769) (-795.880) [-799.958] -- 0:00:13
881000 -- (-807.307) (-798.118) (-809.217) [-797.588] * (-792.533) (-797.436) [-797.062] (-808.562) -- 0:00:13
881500 -- (-793.919) [-794.740] (-796.043) (-794.775) * (-793.684) (-797.253) (-809.590) [-795.658] -- 0:00:13
882000 -- [-794.520] (-797.035) (-795.762) (-801.971) * (-800.491) (-798.255) (-795.093) [-790.358] -- 0:00:13
882500 -- (-813.058) (-800.740) [-791.933] (-799.420) * [-798.003] (-798.254) (-802.566) (-796.654) -- 0:00:13
883000 -- (-797.296) (-797.034) [-793.728] (-801.941) * (-794.675) (-797.287) (-794.620) [-792.594] -- 0:00:13
883500 -- [-796.465] (-800.788) (-791.726) (-801.246) * (-798.834) (-798.696) [-796.435] (-795.124) -- 0:00:13
884000 -- (-796.437) (-799.192) [-792.211] (-805.178) * (-801.989) (-795.745) [-795.396] (-794.519) -- 0:00:12
884500 -- (-805.187) [-793.908] (-795.901) (-797.609) * (-797.463) (-794.203) [-798.224] (-798.179) -- 0:00:12
885000 -- [-795.657] (-794.463) (-801.660) (-797.122) * (-813.590) [-798.474] (-803.147) (-796.114) -- 0:00:12
Average standard deviation of split frequencies: 0.008726
885500 -- (-796.419) [-792.931] (-797.719) (-797.858) * (-794.728) (-802.153) (-798.793) [-795.386] -- 0:00:12
886000 -- (-801.141) (-799.450) (-794.758) [-793.610] * [-792.711] (-799.723) (-802.336) (-800.015) -- 0:00:12
886500 -- (-791.524) [-796.924] (-804.995) (-797.640) * (-794.315) [-793.616] (-795.411) (-795.330) -- 0:00:12
887000 -- [-794.483] (-797.881) (-797.228) (-793.269) * (-800.305) [-795.834] (-792.570) (-797.788) -- 0:00:12
887500 -- (-801.790) [-793.435] (-810.077) (-801.811) * (-800.851) (-801.623) [-796.354] (-798.070) -- 0:00:12
888000 -- [-793.768] (-793.939) (-804.059) (-796.565) * (-794.219) (-796.767) [-793.490] (-792.471) -- 0:00:12
888500 -- (-794.118) (-793.309) (-801.632) [-796.760] * (-802.216) (-795.725) [-798.981] (-797.685) -- 0:00:12
889000 -- (-795.548) [-796.107] (-802.080) (-805.137) * (-794.637) (-803.251) [-790.266] (-804.859) -- 0:00:12
889500 -- (-795.171) (-794.120) [-803.093] (-799.945) * (-793.545) (-797.636) [-800.071] (-805.464) -- 0:00:12
890000 -- [-796.792] (-796.043) (-805.413) (-805.141) * (-797.424) (-795.374) [-803.419] (-798.777) -- 0:00:12
Average standard deviation of split frequencies: 0.008362
890500 -- (-798.731) (-799.254) [-801.677] (-797.582) * (-800.172) (-792.965) [-801.153] (-798.762) -- 0:00:12
891000 -- [-794.096] (-797.468) (-811.787) (-800.900) * (-802.924) [-789.592] (-792.183) (-798.092) -- 0:00:12
891500 -- (-795.988) (-801.081) (-799.434) [-792.805] * (-811.253) (-792.545) [-792.362] (-802.505) -- 0:00:12
892000 -- (-800.819) (-797.807) (-798.197) [-792.539] * (-794.776) [-795.961] (-799.931) (-792.611) -- 0:00:12
892500 -- (-792.611) [-798.430] (-799.265) (-805.819) * (-792.734) (-795.596) (-801.665) [-797.403] -- 0:00:12
893000 -- (-795.823) (-796.230) [-794.612] (-799.401) * [-798.953] (-796.038) (-795.793) (-800.513) -- 0:00:11
893500 -- (-794.681) (-800.774) [-793.325] (-803.163) * (-796.876) (-791.828) [-798.567] (-798.220) -- 0:00:11
894000 -- [-802.646] (-801.503) (-794.439) (-798.333) * (-795.931) (-799.396) [-797.373] (-796.260) -- 0:00:11
894500 -- (-797.521) (-801.637) (-795.712) [-803.344] * (-793.071) [-793.803] (-793.926) (-800.293) -- 0:00:11
895000 -- (-795.938) (-801.246) (-796.072) [-796.172] * (-794.542) (-792.770) [-794.568] (-794.043) -- 0:00:11
Average standard deviation of split frequencies: 0.009049
895500 -- (-801.132) [-796.928] (-795.432) (-803.515) * (-796.128) [-806.095] (-800.544) (-799.098) -- 0:00:11
896000 -- (-799.134) (-795.269) [-797.359] (-797.957) * (-794.983) [-793.134] (-797.693) (-798.940) -- 0:00:11
896500 -- (-797.893) (-791.919) [-794.325] (-799.284) * (-801.850) [-796.358] (-797.298) (-805.226) -- 0:00:11
897000 -- (-804.217) (-796.357) [-794.182] (-794.335) * (-797.594) (-796.605) [-798.825] (-792.877) -- 0:00:11
897500 -- (-799.214) [-798.933] (-796.560) (-792.771) * (-803.201) [-798.291] (-796.368) (-798.202) -- 0:00:11
898000 -- [-795.846] (-797.120) (-795.529) (-796.027) * (-796.540) [-795.287] (-799.213) (-802.261) -- 0:00:11
898500 -- [-797.448] (-800.501) (-795.888) (-796.673) * (-803.316) [-791.440] (-796.654) (-795.858) -- 0:00:11
899000 -- (-794.174) (-798.807) (-801.652) [-796.842] * (-792.703) (-795.187) (-799.304) [-799.442] -- 0:00:11
899500 -- [-801.204] (-793.306) (-805.664) (-798.842) * (-797.305) [-795.903] (-799.231) (-804.853) -- 0:00:11
900000 -- (-799.147) [-795.323] (-799.185) (-796.462) * (-792.749) [-796.467] (-802.131) (-804.688) -- 0:00:11
Average standard deviation of split frequencies: 0.009212
900500 -- [-795.693] (-796.169) (-801.455) (-797.649) * (-793.287) [-797.335] (-794.034) (-794.655) -- 0:00:11
901000 -- (-797.529) (-802.155) [-802.956] (-798.962) * [-800.794] (-803.117) (-798.331) (-801.812) -- 0:00:11
901500 -- (-795.488) (-801.101) [-796.868] (-803.590) * (-797.867) (-794.962) [-801.098] (-796.230) -- 0:00:11
902000 -- [-794.884] (-790.866) (-797.165) (-792.735) * [-794.052] (-796.740) (-797.986) (-797.264) -- 0:00:10
902500 -- (-800.309) [-797.278] (-797.400) (-801.621) * (-793.515) (-806.910) (-807.751) [-797.341] -- 0:00:10
903000 -- [-792.787] (-808.414) (-793.707) (-796.664) * (-796.311) [-796.722] (-796.600) (-799.343) -- 0:00:10
903500 -- (-798.860) [-796.270] (-799.046) (-799.165) * (-804.445) (-807.557) [-799.550] (-797.265) -- 0:00:10
904000 -- [-794.814] (-794.795) (-795.013) (-795.992) * (-802.184) (-804.296) (-793.472) [-801.851] -- 0:00:10
904500 -- (-791.797) [-794.608] (-793.220) (-798.640) * (-795.301) [-796.933] (-795.966) (-798.557) -- 0:00:10
905000 -- (-804.252) (-803.065) (-800.891) [-794.916] * [-795.828] (-798.758) (-799.121) (-804.057) -- 0:00:10
Average standard deviation of split frequencies: 0.009262
905500 -- (-798.463) (-798.583) [-795.504] (-794.774) * [-800.039] (-797.536) (-804.232) (-797.265) -- 0:00:10
906000 -- (-796.667) (-802.403) (-805.199) [-793.005] * (-795.047) (-793.759) (-800.581) [-792.171] -- 0:00:10
906500 -- [-797.068] (-801.645) (-793.929) (-798.477) * [-796.254] (-796.100) (-802.647) (-797.922) -- 0:00:10
907000 -- (-800.961) (-797.388) (-797.012) [-799.475] * (-795.485) (-797.257) (-802.804) [-802.380] -- 0:00:10
907500 -- [-794.237] (-800.633) (-793.607) (-796.368) * (-801.175) (-796.334) (-793.653) [-796.572] -- 0:00:10
908000 -- (-794.368) (-799.929) (-801.189) [-794.956] * (-806.125) (-795.996) (-800.285) [-798.511] -- 0:00:10
908500 -- (-797.101) (-800.286) [-794.106] (-799.181) * (-800.612) [-798.386] (-808.021) (-797.095) -- 0:00:10
909000 -- [-795.502] (-798.018) (-799.542) (-799.625) * (-800.592) (-799.515) (-803.060) [-800.376] -- 0:00:10
909500 -- (-793.882) [-797.258] (-792.542) (-798.304) * (-796.076) [-794.026] (-795.120) (-799.367) -- 0:00:10
910000 -- (-802.077) (-804.789) (-796.337) [-802.438] * [-799.394] (-795.692) (-805.585) (-793.900) -- 0:00:10
Average standard deviation of split frequencies: 0.008489
910500 -- (-796.020) [-801.174] (-796.077) (-793.575) * [-798.506] (-798.750) (-796.641) (-797.621) -- 0:00:10
911000 -- (-792.109) (-817.154) [-794.835] (-798.444) * (-797.091) [-794.696] (-801.300) (-806.036) -- 0:00:09
911500 -- (-796.824) [-796.200] (-800.305) (-795.701) * (-797.216) (-793.932) (-800.240) [-794.798] -- 0:00:09
912000 -- (-798.824) (-804.461) (-798.054) [-792.085] * (-794.015) (-799.774) (-796.409) [-793.497] -- 0:00:09
912500 -- (-794.419) (-799.698) [-797.861] (-796.356) * (-800.563) (-793.041) (-799.594) [-796.614] -- 0:00:09
913000 -- (-800.954) [-796.874] (-799.621) (-800.385) * (-805.368) [-796.210] (-796.466) (-800.053) -- 0:00:09
913500 -- (-797.129) (-794.338) [-802.675] (-796.375) * (-796.013) (-798.026) [-796.676] (-802.473) -- 0:00:09
914000 -- (-795.687) [-797.982] (-794.978) (-796.405) * (-797.480) (-794.694) [-799.609] (-791.758) -- 0:00:09
914500 -- (-792.910) (-797.473) [-796.068] (-792.244) * (-797.257) [-795.076] (-801.797) (-805.367) -- 0:00:09
915000 -- (-798.806) (-798.494) (-796.490) [-797.160] * [-796.168] (-793.668) (-799.955) (-799.440) -- 0:00:09
Average standard deviation of split frequencies: 0.008955
915500 -- (-800.071) (-793.159) [-803.322] (-795.783) * [-797.878] (-805.530) (-799.571) (-793.951) -- 0:00:09
916000 -- [-794.269] (-794.522) (-797.275) (-795.985) * (-804.239) [-795.875] (-795.582) (-792.645) -- 0:00:09
916500 -- (-796.733) [-793.707] (-798.414) (-802.998) * (-794.123) (-797.176) (-795.804) [-798.841] -- 0:00:09
917000 -- (-797.182) [-797.186] (-796.470) (-799.964) * (-801.629) [-792.979] (-802.139) (-791.127) -- 0:00:09
917500 -- (-804.974) (-798.945) [-799.259] (-794.371) * (-797.902) [-796.832] (-800.454) (-798.637) -- 0:00:09
918000 -- (-797.192) (-796.807) (-800.211) [-796.906] * (-806.351) [-792.123] (-794.630) (-798.825) -- 0:00:09
918500 -- (-795.136) [-801.867] (-793.768) (-795.508) * (-795.285) (-800.264) (-797.616) [-794.917] -- 0:00:09
919000 -- (-797.027) [-796.185] (-793.727) (-798.508) * (-803.268) (-795.915) (-797.313) [-794.694] -- 0:00:09
919500 -- (-801.267) (-800.027) (-793.088) [-794.912] * (-793.166) (-797.201) [-794.013] (-800.120) -- 0:00:09
920000 -- (-805.249) [-797.716] (-797.378) (-796.327) * [-793.878] (-804.951) (-798.663) (-799.063) -- 0:00:08
Average standard deviation of split frequencies: 0.009524
920500 -- (-799.791) [-796.982] (-799.430) (-793.892) * [-795.263] (-803.254) (-800.307) (-799.541) -- 0:00:08
921000 -- (-799.735) [-798.458] (-796.236) (-801.260) * [-799.210] (-799.289) (-794.588) (-800.451) -- 0:00:08
921500 -- (-797.209) [-794.611] (-800.289) (-795.517) * [-797.677] (-800.692) (-795.752) (-798.851) -- 0:00:08
922000 -- (-805.031) (-798.703) (-800.340) [-792.828] * [-792.109] (-796.431) (-794.262) (-807.236) -- 0:00:08
922500 -- (-795.130) (-800.663) [-795.819] (-797.279) * (-795.964) (-796.765) (-803.102) [-796.004] -- 0:00:08
923000 -- [-795.004] (-796.525) (-792.137) (-795.895) * (-798.516) (-800.786) [-795.070] (-800.575) -- 0:00:08
923500 -- (-793.101) (-802.041) [-796.601] (-794.312) * (-795.052) (-792.924) [-794.971] (-795.372) -- 0:00:08
924000 -- (-796.350) (-798.700) (-793.759) [-799.034] * (-802.033) (-798.427) [-796.672] (-794.103) -- 0:00:08
924500 -- (-805.473) (-800.308) [-793.868] (-804.872) * (-793.114) (-797.467) [-794.292] (-793.975) -- 0:00:08
925000 -- (-794.360) (-795.781) (-794.672) [-795.231] * (-795.348) (-792.798) (-802.049) [-797.337] -- 0:00:08
Average standard deviation of split frequencies: 0.009163
925500 -- (-800.554) [-795.428] (-794.901) (-797.846) * (-805.113) (-804.173) (-795.700) [-797.442] -- 0:00:08
926000 -- (-795.046) (-801.699) (-797.812) [-794.437] * (-796.719) (-797.873) [-795.263] (-798.319) -- 0:00:08
926500 -- (-794.767) (-798.541) (-795.823) [-796.657] * [-792.791] (-797.003) (-799.874) (-794.704) -- 0:00:08
927000 -- (-802.319) (-792.186) (-794.101) [-796.718] * (-799.712) (-802.574) (-799.030) [-792.355] -- 0:00:08
927500 -- [-797.267] (-797.823) (-802.945) (-805.362) * (-796.790) (-797.552) (-797.951) [-794.473] -- 0:00:08
928000 -- [-794.860] (-794.760) (-799.109) (-802.464) * [-795.504] (-799.028) (-792.673) (-793.192) -- 0:00:08
928500 -- (-796.773) [-796.823] (-801.248) (-798.786) * (-798.613) (-796.214) [-795.075] (-796.727) -- 0:00:08
929000 -- (-796.742) [-797.802] (-797.642) (-795.462) * (-799.286) (-796.573) (-800.454) [-801.828] -- 0:00:07
929500 -- (-804.834) (-798.145) [-797.717] (-792.829) * (-793.908) (-801.921) [-794.044] (-807.975) -- 0:00:07
930000 -- (-795.664) (-794.580) (-796.460) [-800.640] * (-799.857) (-798.215) [-799.003] (-800.456) -- 0:00:07
Average standard deviation of split frequencies: 0.008814
930500 -- (-797.609) [-792.751] (-797.721) (-800.307) * (-794.486) (-797.919) [-793.810] (-791.943) -- 0:00:07
931000 -- [-799.894] (-796.565) (-792.176) (-800.691) * [-796.647] (-804.886) (-798.915) (-796.684) -- 0:00:07
931500 -- (-799.526) (-797.514) [-792.163] (-797.955) * (-795.481) [-795.454] (-797.777) (-798.658) -- 0:00:07
932000 -- (-796.060) [-790.807] (-802.849) (-800.494) * [-796.991] (-797.656) (-800.551) (-796.324) -- 0:00:07
932500 -- [-794.847] (-793.896) (-802.521) (-798.132) * (-798.135) (-795.055) [-795.630] (-795.171) -- 0:00:07
933000 -- (-796.178) (-792.134) [-794.588] (-796.136) * [-791.954] (-790.927) (-795.090) (-801.144) -- 0:00:07
933500 -- [-799.475] (-797.104) (-798.185) (-793.910) * (-791.916) (-799.903) [-792.365] (-797.226) -- 0:00:07
934000 -- (-795.296) (-798.342) [-796.634] (-795.228) * (-800.355) (-800.712) (-804.769) [-794.613] -- 0:00:07
934500 -- (-806.797) [-792.532] (-797.944) (-799.287) * [-797.168] (-805.178) (-794.944) (-796.213) -- 0:00:07
935000 -- [-799.009] (-792.117) (-800.771) (-798.819) * [-801.420] (-800.547) (-793.810) (-801.301) -- 0:00:07
Average standard deviation of split frequencies: 0.008663
935500 -- (-803.798) (-796.119) [-796.483] (-791.241) * (-798.488) (-795.578) [-798.667] (-795.045) -- 0:00:07
936000 -- (-795.271) (-801.533) (-795.529) [-793.344] * (-795.077) (-799.706) [-799.646] (-796.839) -- 0:00:07
936500 -- (-798.840) (-798.615) (-797.074) [-805.588] * (-802.534) (-805.898) [-794.910] (-795.211) -- 0:00:07
937000 -- (-795.969) (-800.968) [-792.623] (-794.411) * (-799.123) (-794.770) (-793.666) [-798.446] -- 0:00:07
937500 -- (-797.400) (-797.174) [-793.506] (-797.268) * (-799.745) (-804.064) (-793.721) [-796.736] -- 0:00:07
938000 -- (-799.394) [-797.976] (-801.510) (-796.602) * (-794.817) (-796.981) [-794.306] (-800.648) -- 0:00:06
938500 -- [-798.362] (-802.905) (-798.420) (-799.926) * (-798.584) (-794.214) [-796.104] (-800.336) -- 0:00:06
939000 -- (-795.901) [-798.761] (-800.577) (-796.795) * [-802.092] (-804.322) (-797.881) (-798.201) -- 0:00:06
939500 -- (-799.464) [-798.348] (-801.833) (-797.466) * (-799.804) (-796.333) (-790.794) [-795.813] -- 0:00:06
940000 -- [-793.716] (-802.418) (-800.932) (-793.936) * (-801.379) (-796.586) [-793.569] (-797.114) -- 0:00:06
Average standard deviation of split frequencies: 0.008920
940500 -- (-800.357) [-802.214] (-796.285) (-802.637) * (-805.641) [-797.101] (-795.832) (-792.615) -- 0:00:06
941000 -- [-803.217] (-793.502) (-794.732) (-802.041) * (-796.033) (-797.627) (-795.693) [-791.595] -- 0:00:06
941500 -- (-797.280) (-802.170) (-803.703) [-798.115] * (-806.322) (-794.451) [-792.474] (-797.406) -- 0:00:06
942000 -- [-797.531] (-799.098) (-799.422) (-798.286) * [-801.317] (-793.696) (-798.047) (-796.333) -- 0:00:06
942500 -- (-794.423) [-798.951] (-797.703) (-801.741) * (-792.133) [-795.120] (-804.505) (-798.429) -- 0:00:06
943000 -- (-795.484) (-797.221) [-800.472] (-797.558) * (-795.732) (-798.300) (-797.124) [-802.287] -- 0:00:06
943500 -- (-802.171) (-802.128) (-802.208) [-792.479] * [-794.841] (-810.465) (-792.859) (-796.750) -- 0:00:06
944000 -- (-809.264) (-797.531) (-799.513) [-790.036] * (-793.569) [-800.862] (-795.574) (-801.470) -- 0:00:06
944500 -- (-799.992) [-797.915] (-800.601) (-792.239) * (-798.551) (-803.477) (-797.207) [-795.591] -- 0:00:06
945000 -- (-802.978) (-797.922) (-798.426) [-798.221] * [-797.349] (-792.926) (-799.920) (-800.101) -- 0:00:06
Average standard deviation of split frequencies: 0.008671
945500 -- (-801.356) (-798.087) [-800.486] (-793.118) * (-804.743) [-798.123] (-799.931) (-797.929) -- 0:00:06
946000 -- (-800.786) [-800.379] (-803.136) (-797.282) * (-805.560) [-794.112] (-801.503) (-802.963) -- 0:00:06
946500 -- (-797.880) [-794.108] (-801.358) (-802.956) * (-801.264) [-793.666] (-798.843) (-799.884) -- 0:00:05
947000 -- [-793.434] (-792.990) (-797.215) (-799.113) * [-790.541] (-807.554) (-801.577) (-796.381) -- 0:00:05
947500 -- (-806.286) [-803.744] (-794.040) (-797.708) * [-793.170] (-798.192) (-798.036) (-795.047) -- 0:00:05
948000 -- [-793.066] (-798.375) (-794.264) (-800.730) * [-794.369] (-800.131) (-800.902) (-796.736) -- 0:00:05
948500 -- (-795.731) [-797.700] (-798.844) (-796.250) * (-797.718) (-802.862) (-794.445) [-796.323] -- 0:00:05
949000 -- (-799.271) [-796.433] (-804.667) (-797.402) * [-798.514] (-799.853) (-801.168) (-804.453) -- 0:00:05
949500 -- (-801.774) (-798.825) (-798.244) [-792.642] * (-796.104) [-794.320] (-800.738) (-800.483) -- 0:00:05
950000 -- (-792.690) (-792.703) [-803.984] (-794.675) * [-796.066] (-794.495) (-800.738) (-800.264) -- 0:00:05
Average standard deviation of split frequencies: 0.008727
950500 -- (-803.843) [-797.219] (-796.838) (-798.034) * (-791.664) (-796.667) [-799.351] (-799.108) -- 0:00:05
951000 -- (-792.890) (-794.150) [-795.529] (-797.092) * [-795.846] (-802.420) (-800.831) (-792.547) -- 0:00:05
951500 -- (-799.977) (-799.571) (-807.945) [-791.706] * [-794.156] (-796.029) (-797.647) (-795.744) -- 0:00:05
952000 -- [-797.932] (-794.329) (-801.228) (-794.126) * (-804.772) (-797.433) [-796.278] (-796.694) -- 0:00:05
952500 -- [-797.766] (-797.427) (-796.934) (-799.975) * (-800.034) (-794.541) (-798.552) [-793.040] -- 0:00:05
953000 -- (-794.701) (-797.043) (-800.169) [-799.262] * (-799.606) [-796.823] (-796.312) (-797.979) -- 0:00:05
953500 -- [-791.906] (-796.217) (-800.603) (-798.678) * (-798.151) [-794.381] (-805.564) (-790.874) -- 0:00:05
954000 -- (-796.579) (-797.815) [-795.262] (-798.824) * [-797.116] (-799.206) (-805.636) (-797.518) -- 0:00:05
954500 -- (-795.652) [-797.045] (-793.732) (-798.312) * [-795.529] (-799.746) (-797.199) (-796.351) -- 0:00:05
955000 -- (-794.863) (-791.622) (-795.342) [-793.325] * (-802.687) (-800.460) [-795.869] (-800.927) -- 0:00:05
Average standard deviation of split frequencies: 0.008679
955500 -- (-798.125) [-795.220] (-796.561) (-801.341) * [-794.029] (-805.033) (-798.012) (-799.499) -- 0:00:04
956000 -- (-795.176) (-799.185) (-800.003) [-797.658] * (-796.853) (-802.905) (-798.762) [-796.874] -- 0:00:04
956500 -- (-802.542) (-796.496) [-794.958] (-802.755) * (-796.171) (-797.740) [-796.650] (-797.203) -- 0:00:04
957000 -- (-798.780) (-800.326) [-804.401] (-804.793) * (-801.013) (-797.141) (-799.832) [-792.900] -- 0:00:04
957500 -- (-799.226) (-794.156) [-798.911] (-794.546) * (-799.071) [-793.851] (-796.831) (-798.856) -- 0:00:04
958000 -- (-794.364) (-793.957) (-797.623) [-793.569] * (-795.969) (-795.700) (-794.577) [-795.218] -- 0:00:04
958500 -- (-802.070) (-796.913) [-795.431] (-796.325) * (-797.474) (-799.540) (-801.682) [-799.242] -- 0:00:04
959000 -- (-796.711) (-802.234) (-799.874) [-796.309] * [-798.053] (-796.134) (-801.728) (-794.574) -- 0:00:04
959500 -- (-799.134) (-795.784) (-797.504) [-801.103] * (-798.988) [-792.544] (-800.955) (-801.607) -- 0:00:04
960000 -- (-801.098) (-798.611) [-800.488] (-794.490) * [-793.065] (-794.203) (-800.157) (-795.164) -- 0:00:04
Average standard deviation of split frequencies: 0.008636
960500 -- (-795.158) (-797.290) [-802.231] (-802.616) * (-800.683) (-793.610) (-797.592) [-797.352] -- 0:00:04
961000 -- (-811.291) [-792.787] (-799.325) (-802.356) * (-801.067) (-795.333) [-797.647] (-791.593) -- 0:00:04
961500 -- (-799.228) [-792.200] (-795.405) (-795.379) * (-806.287) (-795.383) [-795.118] (-797.199) -- 0:00:04
962000 -- [-793.214] (-796.739) (-795.964) (-796.322) * (-797.177) (-796.870) [-801.202] (-796.594) -- 0:00:04
962500 -- (-795.945) (-802.014) [-797.974] (-809.924) * [-795.560] (-793.239) (-796.998) (-804.870) -- 0:00:04
963000 -- (-793.065) [-796.987] (-795.807) (-803.787) * [-793.887] (-801.990) (-796.146) (-802.515) -- 0:00:04
963500 -- (-793.649) [-797.821] (-799.000) (-796.827) * [-795.864] (-797.236) (-798.108) (-794.531) -- 0:00:04
964000 -- (-792.672) [-797.227] (-800.192) (-799.071) * (-797.126) (-794.661) (-800.497) [-797.241] -- 0:00:04
964500 -- (-793.932) (-814.211) [-797.800] (-801.134) * (-801.794) [-807.167] (-802.048) (-792.026) -- 0:00:03
965000 -- (-799.821) (-797.066) (-795.709) [-795.440] * (-800.285) (-794.384) (-798.828) [-794.580] -- 0:00:03
Average standard deviation of split frequencies: 0.008198
965500 -- (-801.927) (-796.124) (-797.743) [-798.922] * [-795.524] (-794.611) (-801.226) (-797.267) -- 0:00:03
966000 -- (-797.151) [-798.997] (-795.213) (-802.193) * (-805.268) (-808.270) (-793.172) [-794.409] -- 0:00:03
966500 -- (-800.377) [-800.461] (-793.119) (-797.274) * [-797.406] (-794.514) (-800.230) (-801.743) -- 0:00:03
967000 -- (-798.158) (-803.684) [-794.575] (-804.516) * (-792.858) (-794.951) [-793.266] (-797.443) -- 0:00:03
967500 -- (-797.687) [-796.198] (-796.132) (-796.792) * [-802.373] (-799.098) (-800.637) (-798.074) -- 0:00:03
968000 -- (-799.852) (-793.827) [-794.792] (-798.137) * (-800.073) (-796.752) (-799.415) [-799.049] -- 0:00:03
968500 -- (-811.055) (-803.610) (-792.905) [-797.648] * [-797.150] (-795.550) (-803.432) (-798.746) -- 0:00:03
969000 -- (-801.519) (-800.769) (-799.338) [-794.165] * (-798.665) [-800.201] (-796.534) (-801.294) -- 0:00:03
969500 -- [-800.861] (-808.063) (-793.302) (-803.467) * (-794.140) (-796.138) (-796.625) [-797.619] -- 0:00:03
970000 -- (-804.063) (-799.801) (-799.382) [-803.009] * [-805.884] (-798.621) (-807.427) (-799.889) -- 0:00:03
Average standard deviation of split frequencies: 0.008062
970500 -- [-798.659] (-797.105) (-798.772) (-794.918) * (-804.560) (-794.747) [-794.013] (-796.300) -- 0:00:03
971000 -- [-794.070] (-800.658) (-798.510) (-794.971) * (-797.815) (-797.524) [-798.640] (-793.986) -- 0:00:03
971500 -- (-796.168) (-797.215) (-795.728) [-791.126] * (-805.218) (-804.770) (-794.729) [-792.292] -- 0:00:03
972000 -- (-798.066) (-795.455) (-803.482) [-794.737] * (-799.576) (-805.405) (-797.990) [-792.846] -- 0:00:03
972500 -- (-802.931) (-797.775) (-804.781) [-794.956] * [-793.672] (-797.098) (-798.821) (-807.029) -- 0:00:03
973000 -- (-795.969) (-797.931) [-805.470] (-802.428) * [-792.980] (-794.561) (-800.082) (-797.904) -- 0:00:03
973500 -- (-797.059) (-796.865) (-798.014) [-798.121] * [-792.487] (-791.816) (-790.906) (-805.863) -- 0:00:02
974000 -- (-798.562) (-799.435) (-795.658) [-792.759] * (-798.512) [-795.472] (-791.522) (-799.910) -- 0:00:02
974500 -- [-801.549] (-803.881) (-789.404) (-797.874) * (-801.003) (-801.582) (-794.570) [-799.516] -- 0:00:02
975000 -- (-795.125) (-794.233) (-794.684) [-798.595] * (-804.892) [-801.133] (-801.292) (-802.717) -- 0:00:02
Average standard deviation of split frequencies: 0.007728
975500 -- (-794.706) [-791.100] (-795.650) (-800.978) * (-795.866) (-797.112) [-797.912] (-798.462) -- 0:00:02
976000 -- [-793.125] (-797.081) (-800.964) (-795.175) * (-798.489) (-793.871) [-801.314] (-802.811) -- 0:00:02
976500 -- (-795.167) [-797.240] (-794.514) (-796.404) * (-800.446) [-791.381] (-803.895) (-795.453) -- 0:00:02
977000 -- (-803.170) (-797.016) [-797.672] (-796.376) * (-794.689) (-796.500) (-800.585) [-796.126] -- 0:00:02
977500 -- (-796.797) (-799.867) [-797.701] (-814.184) * (-795.097) (-797.477) [-794.857] (-800.544) -- 0:00:02
978000 -- [-794.909] (-798.204) (-793.735) (-795.637) * [-799.298] (-797.987) (-791.937) (-800.312) -- 0:00:02
978500 -- (-800.286) [-794.092] (-797.167) (-799.484) * [-798.749] (-798.932) (-802.252) (-794.853) -- 0:00:02
979000 -- (-792.981) (-798.211) (-796.052) [-790.784] * [-792.975] (-793.890) (-793.455) (-792.945) -- 0:00:02
979500 -- [-796.697] (-793.636) (-801.887) (-800.490) * [-795.449] (-791.073) (-797.003) (-799.740) -- 0:00:02
980000 -- (-797.071) (-795.768) [-796.197] (-792.067) * (-798.935) (-799.936) [-793.097] (-797.224) -- 0:00:02
Average standard deviation of split frequencies: 0.007210
980500 -- (-798.443) [-795.299] (-799.116) (-797.798) * (-797.778) [-799.630] (-795.967) (-796.258) -- 0:00:02
981000 -- (-799.488) (-800.699) (-797.878) [-797.006] * (-794.022) [-795.660] (-798.427) (-799.186) -- 0:00:02
981500 -- (-799.267) [-801.696] (-794.473) (-798.074) * (-791.381) (-806.229) [-798.689] (-794.194) -- 0:00:02
982000 -- [-795.599] (-799.142) (-808.617) (-797.857) * [-796.386] (-802.345) (-795.952) (-796.205) -- 0:00:02
982500 -- (-791.250) (-798.451) (-799.298) [-799.065] * (-794.823) (-797.819) [-796.097] (-799.646) -- 0:00:01
983000 -- (-793.296) (-798.852) (-796.886) [-800.093] * [-797.479] (-797.170) (-794.823) (-798.223) -- 0:00:01
983500 -- [-793.738] (-800.003) (-797.975) (-811.893) * (-800.151) (-794.709) [-800.925] (-794.466) -- 0:00:01
984000 -- [-794.105] (-799.267) (-795.314) (-799.820) * (-800.779) [-795.873] (-802.575) (-801.415) -- 0:00:01
984500 -- [-791.901] (-791.972) (-800.265) (-795.708) * (-791.891) (-794.271) [-796.833] (-800.896) -- 0:00:01
985000 -- (-799.274) [-793.297] (-798.265) (-798.412) * (-793.105) [-799.025] (-794.933) (-794.394) -- 0:00:01
Average standard deviation of split frequencies: 0.007267
985500 -- [-801.855] (-798.892) (-804.694) (-799.464) * [-794.596] (-798.038) (-800.744) (-794.690) -- 0:00:01
986000 -- [-800.157] (-792.455) (-806.890) (-798.599) * (-797.088) (-798.243) (-798.176) [-797.395] -- 0:00:01
986500 -- (-797.157) [-793.807] (-794.128) (-798.266) * [-803.078] (-797.420) (-807.314) (-799.763) -- 0:00:01
987000 -- (-805.357) [-800.520] (-798.123) (-803.745) * (-795.364) (-797.429) [-791.274] (-804.041) -- 0:00:01
987500 -- (-804.470) (-792.671) (-802.165) [-797.594] * (-798.361) [-796.679] (-796.655) (-801.064) -- 0:00:01
988000 -- (-806.018) (-796.095) [-795.104] (-799.625) * (-799.572) [-798.277] (-802.238) (-792.968) -- 0:00:01
988500 -- (-799.911) (-798.143) [-801.007] (-796.106) * (-799.029) (-796.069) [-800.162] (-795.096) -- 0:00:01
989000 -- (-794.930) [-795.954] (-799.825) (-796.096) * (-807.780) [-798.907] (-797.101) (-799.780) -- 0:00:01
989500 -- [-795.602] (-797.586) (-796.823) (-806.096) * (-798.196) (-803.699) (-801.984) [-800.733] -- 0:00:01
990000 -- (-797.851) [-794.727] (-800.489) (-797.842) * (-800.812) [-801.507] (-804.176) (-800.464) -- 0:00:01
Average standard deviation of split frequencies: 0.007328
990500 -- (-797.549) [-794.594] (-795.493) (-798.540) * (-798.244) [-800.168] (-797.144) (-799.612) -- 0:00:01
991000 -- (-801.530) (-792.257) (-797.085) [-797.897] * (-798.468) [-790.834] (-793.010) (-792.047) -- 0:00:01
991500 -- [-797.926] (-801.889) (-797.296) (-798.979) * (-799.556) (-799.454) (-795.251) [-799.521] -- 0:00:00
992000 -- (-800.584) [-797.981] (-797.320) (-797.790) * (-798.403) (-795.136) (-796.697) [-791.046] -- 0:00:00
992500 -- (-796.596) (-805.513) [-795.547] (-797.579) * [-797.169] (-802.347) (-804.809) (-792.303) -- 0:00:00
993000 -- [-794.427] (-801.019) (-793.498) (-798.540) * (-793.908) (-797.175) (-795.208) [-793.597] -- 0:00:00
993500 -- (-794.645) (-795.766) [-793.327] (-795.699) * (-796.429) (-798.017) [-796.436] (-797.022) -- 0:00:00
994000 -- (-800.434) (-806.897) (-794.941) [-801.645] * (-806.198) (-802.069) (-799.821) [-793.236] -- 0:00:00
994500 -- (-799.248) (-796.904) (-802.611) [-796.424] * [-795.681] (-796.879) (-806.357) (-792.868) -- 0:00:00
995000 -- (-793.404) [-798.059] (-798.824) (-793.487) * (-798.726) (-795.957) [-797.043] (-803.982) -- 0:00:00
Average standard deviation of split frequencies: 0.008046
995500 -- (-796.498) (-805.563) (-798.386) [-794.796] * (-798.318) [-794.066] (-795.460) (-797.492) -- 0:00:00
996000 -- [-798.305] (-799.732) (-798.827) (-799.839) * [-792.074] (-804.722) (-804.595) (-799.240) -- 0:00:00
996500 -- (-802.253) [-796.628] (-794.405) (-801.959) * [-799.751] (-806.605) (-796.792) (-795.915) -- 0:00:00
997000 -- (-800.084) (-803.449) (-792.704) [-795.319] * (-797.207) [-793.161] (-799.143) (-793.167) -- 0:00:00
997500 -- (-796.868) [-795.453] (-795.102) (-790.028) * [-796.415] (-803.782) (-801.532) (-793.687) -- 0:00:00
998000 -- (-796.630) (-801.818) [-795.881] (-793.374) * (-795.099) (-797.328) (-795.458) [-792.454] -- 0:00:00
998500 -- (-795.822) (-795.163) [-797.424] (-798.718) * (-797.924) [-792.324] (-798.620) (-798.199) -- 0:00:00
999000 -- (-799.102) (-796.546) (-799.497) [-798.148] * [-794.197] (-805.252) (-796.338) (-797.774) -- 0:00:00
999500 -- (-799.131) (-794.043) [-796.066] (-793.737) * [-791.776] (-808.561) (-791.353) (-794.412) -- 0:00:00
1000000 -- (-800.744) [-799.200] (-793.019) (-797.336) * (-800.474) (-794.432) (-797.273) [-794.417] -- 0:00:00
Average standard deviation of split frequencies: 0.008574
Analysis completed in 1 mins 52 seconds
Analysis used 110.68 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -788.38
Likelihood of best state for "cold" chain of run 2 was -788.34
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 60 %) Dirichlet(Revmat{all})
87.0 % ( 76 %) Slider(Revmat{all})
32.1 % ( 31 %) Dirichlet(Pi{all})
32.9 % ( 21 %) Slider(Pi{all})
57.5 % ( 32 %) Multiplier(Alpha{1,2})
60.7 % ( 34 %) Multiplier(Alpha{3})
76.2 % ( 54 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
97.4 % ( 96 %) ExtTBR(Tau{all},V{all})
99.9 % (100 %) NNI(Tau{all},V{all})
84.1 % ( 85 %) ParsSPR(Tau{all},V{all})
27.8 % ( 19 %) Multiplier(V{all})
81.4 % ( 86 %) Nodeslider(V{all})
26.6 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 60 %) Dirichlet(Revmat{all})
88.6 % ( 77 %) Slider(Revmat{all})
32.2 % ( 36 %) Dirichlet(Pi{all})
32.9 % ( 34 %) Slider(Pi{all})
57.9 % ( 34 %) Multiplier(Alpha{1,2})
60.9 % ( 38 %) Multiplier(Alpha{3})
76.0 % ( 51 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
97.4 % ( 98 %) ExtTBR(Tau{all},V{all})
99.9 % (100 %) NNI(Tau{all},V{all})
84.2 % ( 83 %) ParsSPR(Tau{all},V{all})
27.7 % ( 24 %) Multiplier(V{all})
81.4 % ( 83 %) Nodeslider(V{all})
26.7 % ( 16 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.52
2 | 167253 0.83 0.69
3 | 167530 166732 0.85
4 | 166155 166337 165993
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.51
2 | 166865 0.83 0.68
3 | 166040 167066 0.84
4 | 167038 166661 166330
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -795.11
| 2 2 1 |
| 2 2 1 2 |
| 1 2 2 1 2 |
| 2 1 2 2 2|
| 1 * 1 1 12 122 1 1 2 22 * 2 1 *2 |
| 12 22 2 1 1 1 2 1 |
| 1 1 2 2 1 * 1 1 2 1 |
| 1 2 11 1 22 * 1 2 2 2 1 11 2 12 1|
|*2 11 1 2 2 *22 1 1 2 |
| 2 1 2 1 1 2 1 2 1 2 1 |
| 2 * 1 2 * 2 1 |
| 1 1 1 |
| |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -798.47
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -793.58 -804.17
2 -793.50 -802.53
--------------------------------------
TOTAL -793.54 -803.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.487624 0.021391 0.250237 0.784408 0.462857 1012.61 1033.21 1.000
r(A<->C){all} 0.196741 0.007553 0.038111 0.374036 0.189678 345.86 366.64 1.006
r(A<->G){all} 0.154648 0.007222 0.003059 0.313911 0.145565 387.79 395.13 1.001
r(A<->T){all} 0.148796 0.008933 0.000078 0.324711 0.132040 293.44 303.84 1.003
r(C<->G){all} 0.154041 0.005491 0.016580 0.301218 0.144143 414.43 527.32 1.002
r(C<->T){all} 0.163000 0.007786 0.001919 0.320482 0.151843 299.81 301.99 1.000
r(G<->T){all} 0.182775 0.008911 0.012579 0.365232 0.170372 346.91 376.68 1.000
pi(A){all} 0.212980 0.000358 0.172903 0.247616 0.212722 1135.90 1158.40 1.000
pi(C){all} 0.341704 0.000494 0.301100 0.386449 0.341501 918.66 1135.63 1.000
pi(G){all} 0.264377 0.000421 0.222608 0.304003 0.263726 781.97 964.21 1.000
pi(T){all} 0.180938 0.000322 0.145360 0.215894 0.180304 1253.87 1377.43 1.001
alpha{1,2} 0.429927 0.130436 0.000215 1.168301 0.328636 798.06 962.37 1.000
alpha{3} 0.752371 0.274558 0.003497 1.772511 0.628114 1094.00 1219.19 1.000
pinvar{all} 0.246029 0.029140 0.000213 0.560261 0.222741 859.75 952.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- .*..*
7 -- ..**.
8 -- .*.**
9 -- .**.*
10 -- ..***
11 -- ..*.*
12 -- .*.*.
13 -- ...**
14 -- .**..
15 -- .***.
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 629 0.209527 0.008951 0.203198 0.215856 2
7 626 0.208528 0.008480 0.202532 0.214524 2
8 611 0.203531 0.012719 0.194537 0.212525 2
9 607 0.202199 0.015546 0.191206 0.213191 2
10 606 0.201865 0.001884 0.200533 0.203198 2
11 604 0.201199 0.014133 0.191206 0.211193 2
12 600 0.199867 0.005653 0.195869 0.203864 2
13 578 0.192538 0.008480 0.186542 0.198534 2
14 575 0.191539 0.008009 0.185876 0.197202 2
15 568 0.189207 0.001884 0.187875 0.190540 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.002600 0.000007 0.000000 0.007761 0.001775 1.000 2
length{all}[2] 0.002672 0.000007 0.000000 0.007805 0.001872 1.000 2
length{all}[3] 0.002697 0.000008 0.000002 0.008262 0.001829 1.000 2
length{all}[4] 0.471756 0.021304 0.230816 0.762087 0.446316 1.000 2
length{all}[5] 0.002632 0.000007 0.000001 0.008086 0.001755 1.000 2
length{all}[6] 0.002736 0.000007 0.000018 0.007867 0.001909 0.999 2
length{all}[7] 0.002765 0.000007 0.000008 0.008079 0.001869 0.998 2
length{all}[8] 0.002519 0.000007 0.000000 0.007705 0.001653 1.001 2
length{all}[9] 0.002620 0.000007 0.000008 0.007861 0.001881 0.998 2
length{all}[10] 0.002661 0.000007 0.000004 0.007984 0.001791 0.999 2
length{all}[11] 0.002739 0.000008 0.000003 0.008121 0.001856 1.002 2
length{all}[12] 0.002551 0.000007 0.000002 0.007843 0.001681 0.999 2
length{all}[13] 0.002527 0.000006 0.000009 0.007698 0.001716 0.998 2
length{all}[14] 0.002578 0.000007 0.000014 0.007994 0.001729 1.002 2
length{all}[15] 0.002626 0.000007 0.000018 0.008110 0.001802 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008574
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/ C1 (1)
|
| C2 (2)
|
+ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\ C5 (5)
|---------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 8 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 15 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 5 ls = 417
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
48 ambiguity characters in seq. 1
48 ambiguity characters in seq. 2
48 ambiguity characters in seq. 3
57 ambiguity characters in seq. 4
48 ambiguity characters in seq. 5
32 sites are removed. 1 2 3 4 5 6 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 51 60 61 62 63 64 65 66 137 138 139
Sequences read..
Counting site patterns.. 0:00
Compressing, 74 patterns at 107 / 107 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 74 patterns at 107 / 107 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
72224 bytes for conP
6512 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5); MP score: 36
0.085100 0.087353 0.026319 0.017770 0.088024 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -883.670438
Iterating by ming2
Initial: fx= 883.670438
x= 0.08510 0.08735 0.02632 0.01777 0.08802 0.30000 1.30000
1 h-m-p 0.0000 0.0002 3627.3670 +++ 691.085513 m 0.0002 13 | 1/7
2 h-m-p 0.0001 0.0006 183.1935 ++ 672.222781 m 0.0006 23 | 2/7
3 h-m-p 0.0000 0.0001 86.9132 ++ 671.541991 m 0.0001 33 | 3/7
4 h-m-p 0.0000 0.0000 54.2643 ++ 671.468131 m 0.0000 43 | 4/7
5 h-m-p 0.0020 0.9910 1.3228 ++++YYYYYYYCCC 667.738211 10 0.5388 69 | 4/7
6 h-m-p 0.9026 8.0000 0.7895 YCYCCC 666.732970 5 0.4387 87 | 4/7
7 h-m-p 0.7972 3.9862 0.2607 YCCCCC 666.166625 5 0.9358 109 | 4/7
8 h-m-p 1.6000 8.0000 0.0447 YCCC 666.045519 3 3.2111 127 | 4/7
9 h-m-p 1.6000 8.0000 0.0365 YCCC 665.880286 3 3.6498 145 | 4/7
10 h-m-p 1.6000 8.0000 0.0251 +CYC 665.258478 2 6.3596 162 | 4/7
11 h-m-p 1.2216 8.0000 0.1308 YYCC 665.141957 3 1.1236 179 | 4/7
12 h-m-p 1.6000 8.0000 0.0180 YC 665.138712 1 0.9642 193 | 4/7
13 h-m-p 1.6000 8.0000 0.0003 Y 665.138711 0 0.8650 206 | 4/7
14 h-m-p 1.6000 8.0000 0.0000 Y 665.138711 0 0.9466 219 | 4/7
15 h-m-p 1.6000 8.0000 0.0000 --C 665.138711 0 0.0250 234
Out..
lnL = -665.138711
235 lfun, 235 eigenQcodon, 1175 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5); MP score: 36
0.046242 0.099939 0.035187 0.046648 0.058903 0.876419 0.777912 0.451736
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.911706
np = 8
lnL0 = -808.004454
Iterating by ming2
Initial: fx= 808.004454
x= 0.04624 0.09994 0.03519 0.04665 0.05890 0.87642 0.77791 0.45174
1 h-m-p 0.0000 0.0003 1333.2731 +++ 680.371081 m 0.0003 14 | 1/8
2 h-m-p 0.0000 0.0001 186.9305 ++ 676.844390 m 0.0001 25 | 2/8
3 h-m-p 0.0002 0.0011 56.5062 ++ 674.294593 m 0.0011 36 | 3/8
4 h-m-p 0.0001 0.0004 309.1189 ++ 670.089466 m 0.0004 47 | 4/8
5 h-m-p 0.0982 7.1180 1.1138 CYC 670.041765 2 0.0776 61 | 4/8
6 h-m-p 0.2744 1.3718 0.3066 +CCC 669.838356 2 1.1195 77 | 4/8
7 h-m-p 0.0682 0.3408 0.2471 ------------C 669.838356 0 0.0000 104 | 4/8
8 h-m-p 0.0160 8.0000 0.0084 +++++ 669.727418 m 8.0000 122 | 4/8
9 h-m-p 0.0309 0.4009 2.1889 ++ 668.530475 m 0.4009 137 | 4/8
10 h-m-p -0.0000 -0.0000 1.2707
h-m-p: -7.21418013e-18 -3.60709007e-17 1.27074503e+00 668.530475
.. | 4/8
11 h-m-p 0.0032 1.6025 30.7129 YCCCC 665.729423 4 0.0067 163 | 4/8
12 h-m-p 0.2571 1.4860 0.8046 YCCC 665.682143 3 0.1405 179 | 4/8
13 h-m-p 0.1205 1.1242 0.9384 +CCCCC 664.500144 4 0.8128 204 | 4/8
14 h-m-p 0.0026 0.0132 24.2302 CCC 664.493891 2 0.0009 223 | 4/8
15 h-m-p 0.2314 6.1459 0.0990 +++ 660.380405 m 6.1459 235 | 5/8
16 h-m-p 0.5019 8.0000 0.5188 ----------------.. | 5/8
17 h-m-p 0.0002 0.1239 7.5710 +++YCCC 660.035621 3 0.0123 286 | 5/8
18 h-m-p 0.0613 0.5088 1.5246 CCC 660.020324 2 0.0136 301 | 5/8
19 h-m-p 0.0441 1.6561 0.4687 YC 660.011752 1 0.0830 313 | 5/8
20 h-m-p 1.6000 8.0000 0.0015 YC 660.011673 1 1.1064 328 | 5/8
21 h-m-p 1.6000 8.0000 0.0001 Y 660.011673 0 0.9662 342 | 5/8
22 h-m-p 1.6000 8.0000 0.0000 Y 660.011673 0 0.9742 356 | 5/8
23 h-m-p 1.6000 8.0000 0.0000 C 660.011673 0 1.6000 370 | 5/8
24 h-m-p 1.6000 8.0000 0.0000 --------------Y 660.011673 0 0.0000 398
Out..
lnL = -660.011673
399 lfun, 1197 eigenQcodon, 3990 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5); MP score: 36
initial w for M2:NSpselection reset.
0.022238 0.107862 0.013181 0.027186 0.051627 0.736132 0.943310 0.233742 0.434692 2.968085
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.084062
np = 10
lnL0 = -834.041367
Iterating by ming2
Initial: fx= 834.041367
x= 0.02224 0.10786 0.01318 0.02719 0.05163 0.73613 0.94331 0.23374 0.43469 2.96809
1 h-m-p 0.0000 0.0001 2334.2841 ++ 698.806084 m 0.0001 15 | 1/10
2 h-m-p 0.0000 0.0001 194.4227 ++ 695.775316 m 0.0001 28 | 2/10
3 h-m-p 0.0007 0.0283 19.1977 +++ 690.019972 m 0.0283 42 | 3/10
4 h-m-p 0.0001 0.0006 84.8457 ++ 686.045817 m 0.0006 55 | 4/10
5 h-m-p 0.0038 0.1354 8.6689 +++ 678.799477 m 0.1354 69 | 5/10
6 h-m-p 0.3788 8.0000 1.8512 YCCC 678.340211 3 0.1824 87 | 5/10
7 h-m-p 0.0763 1.3892 4.4283 ++YCYCCC 669.940713 5 0.9237 110 | 5/10
8 h-m-p 1.6000 8.0000 1.6281 CYCCC 668.130036 4 0.9771 131 | 4/10
9 h-m-p 0.0416 0.2082 5.8477 CYCCC 667.797791 4 0.0287 151 | 4/10
10 h-m-p 0.0953 3.0448 1.7594 ++YCCC 662.272740 3 1.9527 171 | 4/10
11 h-m-p 1.0693 8.0000 3.2130 +YCCC 653.889704 3 5.0538 190 | 4/10
12 h-m-p 1.2757 6.3786 1.2668 +CCCCC 652.217360 4 4.3255 212 | 4/10
13 h-m-p 1.0708 5.3540 5.0973 YCCC 650.878832 3 0.5949 230 | 4/10
14 h-m-p 0.8085 8.0000 3.7509 ++ 645.438344 m 8.0000 243 | 4/10
15 h-m-p 0.7341 3.6706 17.7504 YCCCC 643.660570 4 1.7493 263 | 4/10
16 h-m-p 1.1367 5.6836 18.8696 CC 642.536488 1 1.3076 278 | 4/10
17 h-m-p 1.2989 7.6618 18.9969 YCCC 640.264493 3 2.7568 296 | 4/10
18 h-m-p 1.6000 8.0000 29.8223 CC 639.570967 1 1.6000 311 | 4/10
19 h-m-p 1.6000 8.0000 23.9320 +CCCC 638.827556 3 5.3542 331 | 4/10
20 h-m-p 0.7719 3.8593 31.7611 YC 638.657467 1 1.4607 345 | 4/10
21 h-m-p 0.7160 3.5800 21.6702 ++ 638.534552 m 3.5800 358 | 4/10
22 h-m-p -0.0000 -0.0000 51.2995
h-m-p: -0.00000000e+00 -0.00000000e+00 5.12995269e+01 638.534552
.. | 4/10
23 h-m-p 0.0031 1.5612 0.3871 +++YC 638.524519 1 0.1363 385 | 4/10
24 h-m-p 0.1829 3.6234 0.2885 +YCC 638.509635 2 0.4760 408 | 4/10
25 h-m-p 1.6000 8.0000 0.0837 -CC 638.509377 1 0.0810 430 | 4/10
26 h-m-p 0.2083 8.0000 0.0326 ++YC 638.506910 1 4.5708 452 | 4/10
27 h-m-p 1.0571 8.0000 0.1408 ++ 638.488819 m 8.0000 471 | 4/10
28 h-m-p 1.6000 8.0000 0.3575 YC 638.487318 1 1.1237 491 | 4/10
29 h-m-p 1.6000 8.0000 0.0265 YC 638.487296 1 0.9158 511 | 4/10
30 h-m-p 1.6000 8.0000 0.0007 +Y 638.487295 0 4.7931 531 | 4/10
31 h-m-p 1.1968 8.0000 0.0028 ++ 638.487284 m 8.0000 550 | 4/10
32 h-m-p 0.0374 8.0000 0.6064 +++C 638.486969 0 2.2033 572 | 4/10
33 h-m-p 1.6000 8.0000 0.6689 ++ 638.484338 m 8.0000 591 | 4/10
34 h-m-p 0.0459 4.5464 116.5509 +++CYC 638.437016 2 2.4008 616 | 4/10
35 h-m-p 1.6000 8.0000 14.1173 CYC 638.432144 2 1.4704 632 | 4/10
36 h-m-p 0.7812 8.0000 26.5712 ++ 638.428633 m 8.0000 645 | 4/10
37 h-m-p 0.1070 0.5348 31.4157 ++ 638.428139 m 0.5348 658 | 4/10
38 h-m-p 0.0000 0.0000 58.6603
h-m-p: 0.00000000e+00 0.00000000e+00 5.86602675e+01 638.428139
.. | 4/10
39 h-m-p 0.0160 8.0000 0.0424 +C 638.428061 0 0.0867 682 | 4/10
40 h-m-p 0.1714 8.0000 0.0214 +YC 638.427965 1 0.5042 703 | 4/10
41 h-m-p 0.9218 8.0000 0.0117 -Y 638.427960 0 0.0973 723 | 4/10
42 h-m-p 1.6000 8.0000 0.0005 ++ 638.427958 m 8.0000 742 | 4/10
43 h-m-p 0.0197 8.0000 0.2065 +++Y 638.427906 0 1.0093 764 | 4/10
44 h-m-p 1.6000 8.0000 0.0007 Y 638.427906 0 0.9939 783 | 4/10
45 h-m-p 1.6000 8.0000 0.0000 ++ 638.427906 m 8.0000 802 | 4/10
46 h-m-p 0.0351 3.1743 0.0015 +++C 638.427906 0 2.1118 824 | 4/10
47 h-m-p 0.1952 0.9760 0.0016 ++ 638.427906 m 0.9760 843 | 5/10
48 h-m-p 0.0160 8.0000 0.0201 --------Y 638.427906 0 0.0000 870 | 5/10
49 h-m-p 0.0160 8.0000 0.0010 +++Y 638.427906 0 0.7601 891 | 5/10
50 h-m-p 1.6000 8.0000 0.0002 Y 638.427906 0 0.7272 909 | 5/10
51 h-m-p 1.6000 8.0000 0.0000 ++ 638.427906 m 8.0000 927 | 5/10
52 h-m-p 0.0819 8.0000 0.0016 ++Y 638.427906 0 1.0047 947 | 5/10
53 h-m-p 1.6000 8.0000 0.0000 Y 638.427906 0 0.4000 965 | 5/10
54 h-m-p 0.6464 8.0000 0.0000 ---------------Y 638.427906 0 0.0000 998
Out..
lnL = -638.427906
999 lfun, 3996 eigenQcodon, 14985 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -670.697870 S = -614.387206 -90.710657
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 74 patterns 0:05
did 20 / 74 patterns 0:06
did 30 / 74 patterns 0:06
did 40 / 74 patterns 0:06
did 50 / 74 patterns 0:06
did 60 / 74 patterns 0:06
did 70 / 74 patterns 0:06
did 74 / 74 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5); MP score: 36
0.077988 0.094928 0.013762 0.014576 0.091456 0.923737 0.273404 1.911923
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.016303
np = 8
lnL0 = -903.321072
Iterating by ming2
Initial: fx= 903.321072
x= 0.07799 0.09493 0.01376 0.01458 0.09146 0.92374 0.27340 1.91192
1 h-m-p 0.0000 0.0001 4428.4975 ++ 708.453438 m 0.0001 13 | 1/8
2 h-m-p 0.0001 0.0006 202.5506 ++ 684.549809 m 0.0006 24 | 2/8
3 h-m-p 0.0000 0.0000 14037.0692 ++ 681.101130 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 922.1901 ++ 680.636040 m 0.0000 46 | 4/8
5 h-m-p 0.0005 0.2641 7.5122 ++++YCYYCCC 667.155389 6 0.2217 71 | 4/8
6 h-m-p 0.0037 0.0185 17.7056 CYCCC 666.712404 4 0.0067 89 | 4/8
7 h-m-p 0.1053 8.0000 1.1226 +CYCCC 665.451705 4 0.2924 109 | 4/8
8 h-m-p 1.5099 7.5497 0.0425 CYCCC 665.060910 4 2.9603 127 | 4/8
9 h-m-p 1.6000 8.0000 0.0272 ++ 662.603707 m 8.0000 142 | 4/8
10 h-m-p 0.1496 0.7478 0.3308 +YYCYCYCYC 660.993320 8 0.6883 170 | 4/8
11 h-m-p 0.0017 0.0085 2.4699 +YYYYYCYYYY 660.933447 9 0.0076 197 | 4/8
12 h-m-p 0.0037 0.0184 0.1449 ++ 660.923472 m 0.0184 208 | 4/8
13 h-m-p -0.0000 -0.0000 0.1624
h-m-p: -0.00000000e+00 -0.00000000e+00 1.62361947e-01 660.923472
.. | 4/8
14 h-m-p 0.0000 0.0000 23.1141 +YYYYYC 660.920713 5 0.0000 241 | 4/8
15 h-m-p 0.0007 0.3620 8.1377 ++CYCC 660.508884 3 0.0148 259 | 4/8
16 h-m-p 0.0420 0.3583 2.8698 YCCCC 660.066222 4 0.1072 277 | 4/8
17 h-m-p 0.2638 1.3190 0.0026 ++ 660.066031 m 1.3190 288 | 4/8
18 h-m-p 1.2939 8.0000 0.0027 Y 660.066030 0 0.6363 303 | 4/8
19 h-m-p 1.0517 5.2587 0.0003 C 660.066029 0 1.1615 318 | 4/8
20 h-m-p 0.8373 4.1866 0.0003 +Y 660.066029 0 2.2602 334 | 4/8
21 h-m-p 0.4033 2.0164 0.0003 ++ 660.066029 m 2.0164 349 | 4/8
22 h-m-p -0.0000 -0.0000 0.0002
h-m-p: -0.00000000e+00 -0.00000000e+00 2.36564510e-04 660.066029
.. | 4/8
23 h-m-p 0.0000 0.0078 0.0577 ++++C 660.066027 0 0.0040 380 | 4/8
24 h-m-p 0.3424 8.0000 0.0007 -C 660.066027 0 0.0188 396 | 4/8
25 h-m-p 0.0674 8.0000 0.0002 C 660.066027 0 0.0789 411 | 4/8
26 h-m-p 1.1916 8.0000 0.0000 ++ 660.066027 m 8.0000 426 | 4/8
27 h-m-p 0.0575 0.2874 0.0004 ++ 660.066027 m 0.2874 441 | 4/8
28 h-m-p -0.0000 -0.0000 0.0004
h-m-p: -0.00000000e+00 -0.00000000e+00 3.96559129e-04 660.066027
.. | 4/8
29 h-m-p 0.0007 0.3459 0.0000 N 660.066027 0 0.0002 468
Out..
lnL = -660.066027
469 lfun, 5159 eigenQcodon, 23450 P(t)
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5); MP score: 36
initial w for M8:NSbetaw>1 reset.
0.072041 0.090260 0.087114 0.082197 0.094849 0.719544 0.900000 0.272199 1.716883 2.402266
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.003942
np = 10
lnL0 = -787.639385
Iterating by ming2
Initial: fx= 787.639385
x= 0.07204 0.09026 0.08711 0.08220 0.09485 0.71954 0.90000 0.27220 1.71688 2.40227
1 h-m-p 0.0000 0.0006 740.9951 +++ 673.554968 m 0.0006 16 | 1/10
2 h-m-p 0.0000 0.0001 256.0336 ++ 667.195787 m 0.0001 29 | 2/10
3 h-m-p 0.0000 0.0000 1377.3892 ++ 666.217929 m 0.0000 42 | 3/10
4 h-m-p 0.0000 0.0000 97.9124 ++ 665.562399 m 0.0000 55 | 4/10
5 h-m-p 0.0001 0.0492 7.4581 +++++ 663.630788 m 0.0492 71 | 4/10
6 h-m-p 0.0000 0.0000 0.3694
h-m-p: 2.19721047e-17 1.09860524e-16 3.69442417e-01 663.630788
.. | 4/10
7 h-m-p 0.0003 0.1693 46.5734 ++YCYCCC 655.585284 5 0.0108 110 | 4/10
8 h-m-p 0.0084 0.0421 16.2819 YCCC 655.214068 3 0.0033 128 | 4/10
9 h-m-p 0.0297 0.6780 1.7959 +YC
QuantileBeta(0.05, 0.00785, 1.75065) = 1.412166e-161 2000 rounds
CCC 654.773796 4 0.2499 149 | 4/10
10 h-m-p 0.1693 4.3185 2.6516 +YCC 653.323824 2 1.0998 166 | 4/10
11 h-m-p 0.0467 0.2337 37.5942 CYCYCCC 651.432616 6 0.1020 189 | 4/10
12 h-m-p 1.0637 5.3187 0.9589 CCCCC 650.619820 4 1.7021 210 | 4/10
13 h-m-p 0.1669 0.8344 1.5650 YCCCC 649.942590 4 0.3422 236 | 4/10
14 h-m-p 0.3932 8.0000 1.3618 +YCCCC 648.559973 4 2.8407 257 | 4/10
15 h-m-p 1.0246 8.0000 3.7756 ++ 643.678957 m 8.0000 270 | 4/10
16 h-m-p 1.6000 8.0000 10.2145 CCCC 641.994023 3 1.5400 289 | 4/10
17 h-m-p 1.6000 8.0000 9.0669 YCCC 640.859826 3 3.7194 307 | 4/10
18 h-m-p 1.6000 8.0000 14.1226 CYC 640.353762 2 1.8688 323 | 4/10
19 h-m-p 1.6000 8.0000 11.6306 +CCC 639.961147 2 6.3239 341 | 4/10
20 h-m-p 1.6000 8.0000 15.8924 CCC 639.873055 2 1.5361 358 | 4/10
21 h-m-p 1.6000 8.0000 13.5078 +CCC 639.803107 2 6.2803 376 | 4/10
22 h-m-p 1.6000 8.0000 11.8421 YC 639.787039 1 3.1236 390 | 4/10
23 h-m-p 1.4730 8.0000 25.1123 +CCC 639.758111 2 4.9783 408 | 4/10
24 h-m-p 0.7974 3.9872 45.2401 +YC 639.742530 1 3.4243 423 | 4/10
25 h-m-p 0.0620 0.3100 82.2924 ++ 639.739658 m 0.3100 436 | 4/10
26 h-m-p 0.0000 0.0000 276.3716
h-m-p: 0.00000000e+00 0.00000000e+00 2.76371598e+02 639.739658
.. | 4/10
27 h-m-p 0.0004 0.1944 1.4338 +CC 639.737293 1 0.0023 462 | 4/10
28 h-m-p 0.0399 8.0000 0.0824 +++CCC 639.727831 2 2.6926 482 | 4/10
29 h-m-p 0.3716 8.0000 0.5970 +++ 639.388486 m 8.0000 502 | 4/10
30 h-m-p 0.1760 1.3142 27.1396 +YYCCC 638.785350 4 0.6005 528 | 4/10
31 h-m-p 1.6000 8.0000 0.0694 CCC 638.778383 2 1.4396 545 | 4/10
32 h-m-p 0.7095 8.0000 0.1407 +YC 638.777514 1 2.1514 566 | 4/10
33 h-m-p 1.6000 8.0000 0.1681 YC 638.775683 1 3.9119 586 | 4/10
34 h-m-p 1.6000 8.0000 0.1839 ++ 638.749325 m 8.0000 605 | 4/10
35 h-m-p 0.0915 4.1205 16.0715 ++YCCC 638.498155 3 2.1269 631 | 4/10
36 h-m-p 1.2624 6.3120 5.5332 YC 638.461002 1 0.8934 645 | 4/10
37 h-m-p 1.0241 5.6687 4.8267 CCC 638.445544 2 1.5579 662 | 4/10
38 h-m-p 1.4679 7.3393 2.6979 CC 638.442547 1 1.7157 677 | 4/10
39 h-m-p 1.6000 8.0000 1.6972 C 638.441694 0 1.5723 690 | 4/10
40 h-m-p 1.6000 8.0000 0.2954 YC 638.441674 1 0.9564 704 | 4/10
41 h-m-p 1.6000 8.0000 0.0203 Y 638.441674 0 1.2747 723 | 4/10
42 h-m-p 1.6000 8.0000 0.0006 ++ 638.441674 m 8.0000 742 | 4/10
43 h-m-p 0.0576 8.0000 0.0804 ++Y 638.441670 0 2.0884 763 | 4/10
44 h-m-p 1.6000 8.0000 0.0372 ++ 638.441635 m 8.0000 782 | 4/10
45 h-m-p 0.0035 1.7262 121.1578 +++++ 638.430275 m 1.7262 804 | 4/10
46 h-m-p 0.0000 0.0000 40.5258
h-m-p: 0.00000000e+00 0.00000000e+00 4.05257605e+01 638.430275
.. | 4/10
47 h-m-p 0.0041 2.0416 0.1260 YC 638.430255 1 0.0025 828 | 4/10
48 h-m-p 0.0293 8.0000 0.0109 ++C 638.430217 0 0.6482 849 | 4/10
49 h-m-p 1.6000 8.0000 0.0003 ++ 638.430216 m 8.0000 868 | 4/10
50 h-m-p 0.1334 8.0000 0.0189 ++C 638.430211 0 1.8472 889 | 4/10
51 h-m-p 1.6000 8.0000 0.0091 Y 638.430207 0 2.9346 908 | 4/10
52 h-m-p 1.6000 8.0000 0.0002 ++ 638.430206 m 8.0000 927 | 4/10
53 h-m-p 0.0160 8.0000 0.5158 +++YC 638.430138 1 1.6597 950 | 4/10
54 h-m-p 1.6000 8.0000 0.2595 +YC 638.430049 1 4.2397 971 | 4/10
55 h-m-p 1.6000 8.0000 0.0107 Y 638.430049 0 1.0043 990 | 4/10
56 h-m-p 1.6000 8.0000 0.0001 ++ 638.430049 m 8.0000 1009 | 4/10
57 h-m-p 0.0613 8.0000 0.0131 ++Y 638.430048 0 2.1215 1030 | 4/10
58 h-m-p 1.6000 8.0000 0.0058 ++ 638.430047 m 8.0000 1049 | 4/10
59 h-m-p 0.0004 0.0972 110.3978 ++++ 638.429835 m 0.0972 1070 | 5/10
60 h-m-p 0.0908 1.2022 117.4092 YC 638.429676 1 0.1500 1084 | 5/10
61 h-m-p 1.6000 8.0000 7.2551 YC 638.429482 1 2.9416 1098 | 5/10
62 h-m-p 1.6000 8.0000 10.8806 ++ 638.428388 m 8.0000 1111 | 5/10
63 h-m-p 0.0376 0.1880 78.4983 ++ 638.428293 m 0.1880 1124 | 6/10
64 h-m-p 0.2043 6.4659 2.5872 -Y 638.428292 0 0.0076 1138 | 6/10
65 h-m-p 0.0594 8.0000 0.3322 ++C 638.428287 0 1.1549 1153 | 6/10
66 h-m-p 1.6000 8.0000 0.0118 Y 638.428287 0 1.0976 1170 | 6/10
67 h-m-p 1.6000 8.0000 0.0001 Y 638.428287 0 1.0235 1187 | 6/10
68 h-m-p 1.6000 8.0000 0.0000 +Y 638.428287 0 6.4000 1205 | 6/10
69 h-m-p 1.1880 8.0000 0.0000 ----------------.. | 6/10
70 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/10
71 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -638.428287
1293 lfun, 15516 eigenQcodon, 71115 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -670.408679 S = -614.393542 -79.855278
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 74 patterns 0:32
did 20 / 74 patterns 0:33
did 30 / 74 patterns 0:33
did 40 / 74 patterns 0:33
did 50 / 74 patterns 0:33
did 60 / 74 patterns 0:33
did 70 / 74 patterns 0:33
did 74 / 74 patterns 0:34
Time used: 0:34
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=139
NC_011896_1_WP_010909003_1_2812_MLBR_RS13385 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
NC_002677_1_NP_302684_1_1556_ML2630 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
NZ_CP029543_1_2843_DIJ64_RS14470 AHRRRTATRTAVRLSQQML---------------SITPAVRYRDQHQCRG
NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
.* *.: :: :*..:* . ::.*.
NC_011896_1_WP_010909003_1_2812_MLBR_RS13385 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
NC_002677_1_NP_302684_1_1556_ML2630 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
NZ_CP029543_1_2843_DIJ64_RS14470 -DVTERIEGLQRGRRPDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805 FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
:.:: : * **********************************
NC_011896_1_WP_010909003_1_2812_MLBR_RS13385 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
NC_002677_1_NP_302684_1_1556_ML2630 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
NZ_CP029543_1_2843_DIJ64_RS14470 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVRooo
NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805 PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
************************************
>NC_011896_1_WP_010909003_1_2812_MLBR_RS13385 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC TTCAACGCGGCCGACGACCTGATTGGG---------------------GA TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA ACGTCCGA--------- >NC_002677_1_NP_302684_1_1556_ML2630 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC TTCAACGCGGCCGACGACCTGATTGGG---------------------GA TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA ACGTCCGA--------- >NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC TTCAACGCGGCCGACGACCTGATTGGG---------------------GA TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA ACGTCCGA--------- >NZ_CP029543_1_2843_DIJ64_RS14470 GCTCACCGACGGCGTACTGCTACCAGAACTGCTGTTCGGCTATCTCAACA AATGCTG------------------------------------------- --TCTATTACCCCAGCTGTTCGATACCGCGATCAACACCAGTGTCGGGGT ---GACGTCACCGAACGAATCGAGGGCCTTCAACGCGGCCGACGACCTGA TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA ACGTCCGA--------- >NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805 ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC TTCAACGCGGCCGACGACCTGATTGGG---------------------GA TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA ACGTCCGA---------
>NC_011896_1_WP_010909003_1_2812_MLBR_RS13385 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR >NC_002677_1_NP_302684_1_1556_ML2630 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR >NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR >NZ_CP029543_1_2843_DIJ64_RS14470 AHRRRTATRTAVRLSQQML---------------SITPAVRYRDQHQCRG -DVTERIEGLQRGRRPDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR >NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805 ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
#NEXUS
[ID: 5257532557]
begin taxa;
dimensions ntax=5;
taxlabels
NC_011896_1_WP_010909003_1_2812_MLBR_RS13385
NC_002677_1_NP_302684_1_1556_ML2630
NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110
NZ_CP029543_1_2843_DIJ64_RS14470
NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909003_1_2812_MLBR_RS13385,
2 NC_002677_1_NP_302684_1_1556_ML2630,
3 NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110,
4 NZ_CP029543_1_2843_DIJ64_RS14470,
5 NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.001775133,2:0.00187156,3:0.00182941,4:0.4463156,5:0.001755387);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.001775133,2:0.00187156,3:0.00182941,4:0.4463156,5:0.001755387);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -793.58 -804.17
2 -793.50 -802.53
--------------------------------------
TOTAL -793.54 -803.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.487624 0.021391 0.250237 0.784408 0.462857 1012.61 1033.21 1.000
r(A<->C){all} 0.196741 0.007553 0.038111 0.374036 0.189678 345.86 366.64 1.006
r(A<->G){all} 0.154648 0.007222 0.003059 0.313911 0.145565 387.79 395.13 1.001
r(A<->T){all} 0.148796 0.008933 0.000078 0.324711 0.132040 293.44 303.84 1.003
r(C<->G){all} 0.154041 0.005491 0.016580 0.301218 0.144143 414.43 527.32 1.002
r(C<->T){all} 0.163000 0.007786 0.001919 0.320482 0.151843 299.81 301.99 1.000
r(G<->T){all} 0.182775 0.008911 0.012579 0.365232 0.170372 346.91 376.68 1.000
pi(A){all} 0.212980 0.000358 0.172903 0.247616 0.212722 1135.90 1158.40 1.000
pi(C){all} 0.341704 0.000494 0.301100 0.386449 0.341501 918.66 1135.63 1.000
pi(G){all} 0.264377 0.000421 0.222608 0.304003 0.263726 781.97 964.21 1.000
pi(T){all} 0.180938 0.000322 0.145360 0.215894 0.180304 1253.87 1377.43 1.001
alpha{1,2} 0.429927 0.130436 0.000215 1.168301 0.328636 798.06 962.37 1.000
alpha{3} 0.752371 0.274558 0.003497 1.772511 0.628114 1094.00 1219.19 1.000
pinvar{all} 0.246029 0.029140 0.000213 0.560261 0.222741 859.75 952.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2630/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 107
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 | Ser TCT 1 1 1 3 1 | Tyr TAT 1 1 1 1 1 | Cys TGT 0 0 0 1 0
TTC 1 1 1 0 1 | TCC 3 3 3 3 3 | TAC 0 0 0 1 0 | TGC 0 0 0 0 0
Leu TTA 0 0 0 0 0 | TCA 4 4 4 3 4 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 1 1 0 1 | TCG 3 3 3 2 3 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 0 0 0 0 0 | His CAT 1 1 1 1 1 | Arg CGT 2 2 2 2 2
CTC 3 3 3 2 3 | CCC 2 2 2 2 2 | CAC 1 1 1 2 1 | CGC 2 2 2 3 2
CTA 2 2 2 2 2 | CCA 3 3 3 3 3 | Gln CAA 2 2 2 5 2 | CGA 1 1 1 3 1
CTG 4 4 4 1 4 | CCG 7 7 7 6 7 | CAG 3 3 3 4 3 | CGG 1 1 1 3 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 | Thr ACT 1 1 1 2 1 | Asn AAT 0 0 0 0 0 | Ser AGT 1 1 1 0 1
ATC 1 1 1 1 1 | ACC 3 3 3 4 3 | AAC 6 6 6 3 6 | AGC 1 1 1 1 1
ATA 0 0 0 0 0 | ACA 1 1 1 1 1 | Lys AAA 0 0 0 0 0 | Arg AGA 0 0 0 1 0
Met ATG 0 0 0 1 0 | ACG 2 2 2 1 2 | AAG 0 0 0 0 0 | AGG 2 2 2 1 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 2 0 | Ala GCT 1 1 1 4 1 | Asp GAT 3 3 3 4 3 | Gly GGT 5 5 5 6 5
GTC 3 3 3 3 3 | GCC 4 4 4 2 4 | GAC 3 3 3 1 3 | GGC 2 2 2 2 2
GTA 2 2 2 1 2 | GCA 3 3 3 3 3 | Glu GAA 3 3 3 2 3 | GGA 1 1 1 1 1
GTG 1 1 1 0 1 | GCG 2 2 2 0 2 | GAG 3 3 3 4 3 | GGG 3 3 3 1 3
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385
position 1: T:0.14019 C:0.31776 A:0.17757 G:0.36449
position 2: T:0.17757 C:0.37383 A:0.24299 G:0.20561
position 3: T:0.15888 C:0.32710 A:0.20561 G:0.30841
Average T:0.15888 C:0.33956 A:0.20872 G:0.29283
#2: NC_002677_1_NP_302684_1_1556_ML2630
position 1: T:0.14019 C:0.31776 A:0.17757 G:0.36449
position 2: T:0.17757 C:0.37383 A:0.24299 G:0.20561
position 3: T:0.15888 C:0.32710 A:0.20561 G:0.30841
Average T:0.15888 C:0.33956 A:0.20872 G:0.29283
#3: NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110
position 1: T:0.14019 C:0.31776 A:0.17757 G:0.36449
position 2: T:0.17757 C:0.37383 A:0.24299 G:0.20561
position 3: T:0.15888 C:0.32710 A:0.20561 G:0.30841
Average T:0.15888 C:0.33956 A:0.20872 G:0.29283
#4: NZ_CP029543_1_2843_DIJ64_RS14470
position 1: T:0.14019 C:0.36449 A:0.15888 G:0.33645
position 2: T:0.13084 C:0.36449 A:0.26168 G:0.24299
position 3: T:0.25234 C:0.28037 A:0.23364 G:0.23364
Average T:0.17445 C:0.33645 A:0.21807 G:0.27103
#5: NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805
position 1: T:0.14019 C:0.31776 A:0.17757 G:0.36449
position 2: T:0.17757 C:0.37383 A:0.24299 G:0.20561
position 3: T:0.15888 C:0.32710 A:0.20561 G:0.30841
Average T:0.15888 C:0.33956 A:0.20872 G:0.29283
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 7 | Tyr Y TAT 5 | Cys C TGT 1
TTC 4 | TCC 15 | TAC 1 | TGC 0
Leu L TTA 0 | TCA 19 | *** * TAA 0 | *** * TGA 0
TTG 4 | TCG 14 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 5 | Arg R CGT 10
CTC 14 | CCC 10 | CAC 6 | CGC 11
CTA 10 | CCA 15 | Gln Q CAA 13 | CGA 7
CTG 17 | CCG 34 | CAG 16 | CGG 7
------------------------------------------------------------------------------
Ile I ATT 5 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 4
ATC 5 | ACC 16 | AAC 27 | AGC 5
ATA 0 | ACA 5 | Lys K AAA 0 | Arg R AGA 1
Met M ATG 1 | ACG 9 | AAG 0 | AGG 9
------------------------------------------------------------------------------
Val V GTT 2 | Ala A GCT 8 | Asp D GAT 16 | Gly G GGT 26
GTC 15 | GCC 18 | GAC 13 | GGC 10
GTA 9 | GCA 15 | Glu E GAA 14 | GGA 5
GTG 4 | GCG 8 | GAG 16 | GGG 13
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14019 C:0.32710 A:0.17383 G:0.35888
position 2: T:0.16822 C:0.37196 A:0.24673 G:0.21308
position 3: T:0.17757 C:0.31776 A:0.21121 G:0.29346
Average T:0.16199 C:0.33894 A:0.21059 G:0.28847
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5); MP score: 36
lnL(ntime: 5 np: 7): -665.138711 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.754430 0.000004 0.876419 0.718179
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.754446
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.754430, 5: 0.000004);
(NC_011896_1_WP_010909003_1_2812_MLBR_RS13385: 0.000004, NC_002677_1_NP_302684_1_1556_ML2630: 0.000004, NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110: 0.000004, NZ_CP029543_1_2843_DIJ64_RS14470: 0.754430, NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.87642
omega (dN/dS) = 0.71818
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 225.4 95.6 0.7182 0.0000 0.0000 0.0 0.0
6..2 0.000 225.4 95.6 0.7182 0.0000 0.0000 0.0 0.0
6..3 0.000 225.4 95.6 0.7182 0.0000 0.0000 0.0 0.0
6..4 0.754 225.4 95.6 0.7182 0.2252 0.3135 50.8 30.0
6..5 0.000 225.4 95.6 0.7182 0.0000 0.0000 0.0 0.0
tree length for dN: 0.2252
tree length for dS: 0.3135
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 36
lnL(ntime: 5 np: 8): -660.011673 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.850735 0.000004 0.736132 0.468045 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.850751
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.850735, 5: 0.000004);
(NC_011896_1_WP_010909003_1_2812_MLBR_RS13385: 0.000004, NC_002677_1_NP_302684_1_1556_ML2630: 0.000004, NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110: 0.000004, NZ_CP029543_1_2843_DIJ64_RS14470: 0.850735, NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.73613
MLEs of dN/dS (w) for site classes (K=2)
p: 0.46804 0.53196
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 226.5 94.5 0.5320 0.0000 0.0000 0.0 0.0
6..2 0.000 226.5 94.5 0.5320 0.0000 0.0000 0.0 0.0
6..3 0.000 226.5 94.5 0.5320 0.0000 0.0000 0.0 0.0
6..4 0.851 226.5 94.5 0.5320 0.2252 0.4234 51.0 40.0
6..5 0.000 226.5 94.5 0.5320 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 36
lnL(ntime: 5 np: 10): -638.427906 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 33.978992 0.000004 0.923737 0.743919 0.000000 0.538042 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 33.979008
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 33.978992, 5: 0.000004);
(NC_011896_1_WP_010909003_1_2812_MLBR_RS13385: 0.000004, NC_002677_1_NP_302684_1_1556_ML2630: 0.000004, NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110: 0.000004, NZ_CP029543_1_2843_DIJ64_RS14470: 33.978992, NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.92374
MLEs of dN/dS (w) for site classes (K=3)
p: 0.74392 0.00000 0.25608
w: 0.53804 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 225.1 95.9 256.2249 0.0000 0.0000 0.0 0.0
6..2 0.000 225.1 95.9 256.2249 0.0000 0.0000 0.0 0.0
6..3 0.000 225.1 95.9 256.2249 0.0000 0.0000 0.0 0.0
6..4 33.979 225.1 95.9 256.2249 16.1279 0.0629 3629.7 6.0
6..5 0.000 225.1 95.9 256.2249 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 1.000** 998.675
2 L 0.978* 976.552
3 T 0.981* 979.555
4 D 1.000** 998.509
5 G 0.953* 951.860
9 P 0.971* 970.062
11 L 0.969* 967.656
13 F 0.978* 977.024
14 A 0.963* 962.509
17 T 0.952* 951.223
18 S 0.988* 987.042
20 G 0.968* 967.058
21 V 1.000** 998.762
22 T 0.999** 998.252
23 S 1.000** 998.737
24 P 0.958* 956.921
26 E 0.963* 961.724
27 S 0.986* 985.103
29 A 0.959* 958.101
31 A 0.950* 949.078
34 D 1.000** 998.595
35 L 0.979* 977.537
36 I 1.000** 998.891
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 0.989* 9.976 +- 1.193
2 L 0.979* 9.881 +- 1.501
3 T 0.955* 9.657 +- 2.043
4 D 0.984* 9.929 +- 1.356
5 G 0.802 8.244 +- 3.735
7 L 0.813 8.348 +- 3.655
9 P 0.844 8.633 +- 3.415
10 E 0.760 7.853 +- 3.993
11 L 0.882 8.983 +- 3.059
12 L 0.790 8.130 +- 3.815
13 F 0.863 8.806 +- 3.250
14 A 0.825 8.458 +- 3.568
16 N 0.763 7.875 +- 3.979
17 T 0.808 8.302 +- 3.692
18 S 0.984* 9.929 +- 1.353
20 G 0.804 8.259 +- 3.724
21 V 0.996** 10.038 +- 0.927
22 T 0.986* 9.943 +- 1.309
23 S 0.995** 10.033 +- 0.953
24 P 0.854 8.725 +- 3.330
25 N 0.743 7.692 +- 4.083
26 E 0.899 9.144 +- 2.866
27 S 0.960* 9.704 +- 1.945
29 A 0.808 8.302 +- 3.692
30 N 0.743 7.690 +- 4.085
31 A 0.833 8.530 +- 3.509
32 A 0.784 8.070 +- 3.857
33 D 0.703 7.319 +- 4.263
34 D 0.995** 10.028 +- 0.976
35 L 0.939 9.514 +- 2.313
36 I 0.998** 10.053 +- 0.852
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.156 0.141 0.127 0.114 0.102 0.090 0.080 0.071 0.063 0.056
w2: 0.000 0.000 0.000 0.000 0.000 0.003 0.016 0.066 0.228 0.686
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.004 0.000 0.000 0.000 0.000
0.021 0.009 0.004 0.000 0.000 0.000 0.000
0.017 0.025 0.025 0.010 0.004 0.000 0.000 0.000 0.000
0.003 0.012 0.023 0.031 0.029 0.010 0.004 0.000 0.000 0.000 0.000
0.000 0.002 0.005 0.017 0.030 0.038 0.033 0.010 0.003 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.003 0.008 0.025 0.040 0.045 0.036 0.010 0.003 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.001 0.005 0.012 0.034 0.053 0.052 0.039 0.009 0.003 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.007 0.019 0.047 0.067 0.057 0.040 0.009 0.003 0.000 0.000 0.000 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 36
lnL(ntime: 5 np: 8): -660.066027 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.852746 0.000004 0.719544 0.005000 0.005010
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.852762
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.852746, 5: 0.000004);
(NC_011896_1_WP_010909003_1_2812_MLBR_RS13385: 0.000004, NC_002677_1_NP_302684_1_1556_ML2630: 0.000004, NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110: 0.000004, NZ_CP029543_1_2843_DIJ64_RS14470: 0.852746, NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.71954
Parameters in M7 (beta):
p = 0.00500 q = 0.00501
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 226.7 94.3 0.5000 0.0000 0.0000 0.0 0.0
6..2 0.000 226.7 94.3 0.5000 0.0000 0.0000 0.0 0.0
6..3 0.000 226.7 94.3 0.5000 0.0000 0.0000 0.0 0.0
6..4 0.853 226.7 94.3 0.5000 0.2197 0.4394 49.8 41.5
6..5 0.000 226.7 94.3 0.5000 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 36
check convergence..
lnL(ntime: 5 np: 10): -638.428287 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 33.973278 0.000004 0.923763 0.743916 99.000000 84.940862 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 33.973294
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 33.973278, 5: 0.000004);
(NC_011896_1_WP_010909003_1_2812_MLBR_RS13385: 0.000004, NC_002677_1_NP_302684_1_1556_ML2630: 0.000004, NZ_LVXE01000015_1_WP_010909003_1_523_A3216_RS06110: 0.000004, NZ_CP029543_1_2843_DIJ64_RS14470: 33.973278, NZ_AP014567_1_WP_010909003_1_2910_JK2ML_RS14805: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.92376
Parameters in M8 (beta&w>1):
p0 = 0.74392 p = 99.00000 q = 84.94086
(p1 = 0.25608) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07439 0.07439 0.07439 0.07439 0.07439 0.07439 0.07439 0.07439 0.07439 0.07439 0.25608
w: 0.47766 0.50011 0.51348 0.52415 0.53373 0.54298 0.55251 0.56310 0.57630 0.59830 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 225.1 95.9 256.2282 0.0000 0.0000 0.0 0.0
6..2 0.000 225.1 95.9 256.2282 0.0000 0.0000 0.0 0.0
6..3 0.000 225.1 95.9 256.2282 0.0000 0.0000 0.0 0.0
6..4 33.973 225.1 95.9 256.2282 16.1252 0.0629 3629.1 6.0
6..5 0.000 225.1 95.9 256.2282 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 1.000** 998.673
2 L 0.977* 976.464
3 T 0.981* 979.534
4 D 1.000** 998.507
5 G 0.953* 951.871
9 P 0.971* 970.066
11 L 0.969* 967.662
13 F 0.978* 977.029
14 A 0.963* 962.517
17 T 0.952* 951.235
18 S 0.988* 986.993
20 G 0.968* 967.066
21 V 1.000** 998.760
22 T 0.999** 998.250
23 S 1.000** 998.736
24 P 0.958* 956.931
26 E 0.963* 961.733
27 S 0.986* 985.087
29 A 0.959* 958.110
31 A 0.950* 949.091
34 D 1.000** 998.592
35 L 0.978* 977.524
36 I 1.000** 998.890
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 0.995** 10.009 +- 0.994
2 L 0.990* 9.962 +- 1.187
3 T 0.975* 9.821 +- 1.638
4 D 0.992** 9.986 +- 1.095
5 G 0.872 8.849 +- 3.216
7 L 0.880 8.927 +- 3.129
9 P 0.901 9.129 +- 2.886
10 E 0.841 8.557 +- 3.501
11 L 0.926 9.365 +- 2.555
12 L 0.863 8.767 +- 3.300
13 F 0.914 9.244 +- 2.733
14 A 0.888 9.005 +- 3.040
16 N 0.843 8.574 +- 3.486
17 T 0.876 8.891 +- 3.170
18 S 0.992** 9.986 +- 1.092
20 G 0.873 8.861 +- 3.203
21 V 0.998** 10.040 +- 0.838
22 T 0.993** 9.992 +- 1.071
23 S 0.998** 10.037 +- 0.854
24 P 0.908 9.187 +- 2.811
25 N 0.828 8.433 +- 3.609
26 E 0.937 9.468 +- 2.388
27 S 0.978* 9.849 +- 1.560
29 A 0.876 8.891 +- 3.170
30 N 0.828 8.431 +- 3.611
31 A 0.893 9.050 +- 2.987
32 A 0.858 8.720 +- 3.347
33 D 0.797 8.138 +- 3.838
34 D 0.998** 10.035 +- 0.865
35 L 0.965* 9.729 +- 1.868
36 I 0.999** 10.047 +- 0.799
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.006 0.100 0.464 0.392 0.037 0.000 0.000
p : 0.164 0.135 0.117 0.104 0.094 0.087 0.081 0.076 0.072 0.069
q : 0.050 0.069 0.082 0.093 0.102 0.109 0.116 0.122 0.126 0.131
ws: 0.000 0.000 0.000 0.000 0.001 0.004 0.018 0.070 0.232 0.676
Time used: 0:34
Model 1: NearlyNeutral -660.011673
Model 2: PositiveSelection -638.427906
Model 0: one-ratio -665.138711
Model 7: beta -660.066027
Model 8: beta&w>1 -638.428287
Model 0 vs 1 10.254075999999941
Model 2 vs 1 43.16753399999993
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 1.000** 998.675
2 L 0.978* 976.552
3 T 0.981* 979.555
4 D 1.000** 998.509
5 G 0.953* 951.860
9 P 0.971* 970.062
11 L 0.969* 967.656
13 F 0.978* 977.024
14 A 0.963* 962.509
17 T 0.952* 951.223
18 S 0.988* 987.042
20 G 0.968* 967.058
21 V 1.000** 998.762
22 T 0.999** 998.252
23 S 1.000** 998.737
24 P 0.958* 956.921
26 E 0.963* 961.724
27 S 0.986* 985.103
29 A 0.959* 958.101
31 A 0.950* 949.078
34 D 1.000** 998.595
35 L 0.979* 977.537
36 I 1.000** 998.891
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 0.989* 9.976 +- 1.193
2 L 0.979* 9.881 +- 1.501
3 T 0.955* 9.657 +- 2.043
4 D 0.984* 9.929 +- 1.356
5 G 0.802 8.244 +- 3.735
7 L 0.813 8.348 +- 3.655
9 P 0.844 8.633 +- 3.415
10 E 0.760 7.853 +- 3.993
11 L 0.882 8.983 +- 3.059
12 L 0.790 8.130 +- 3.815
13 F 0.863 8.806 +- 3.250
14 A 0.825 8.458 +- 3.568
16 N 0.763 7.875 +- 3.979
17 T 0.808 8.302 +- 3.692
18 S 0.984* 9.929 +- 1.353
20 G 0.804 8.259 +- 3.724
21 V 0.996** 10.038 +- 0.927
22 T 0.986* 9.943 +- 1.309
23 S 0.995** 10.033 +- 0.953
24 P 0.854 8.725 +- 3.330
25 N 0.743 7.692 +- 4.083
26 E 0.899 9.144 +- 2.866
27 S 0.960* 9.704 +- 1.945
29 A 0.808 8.302 +- 3.692
30 N 0.743 7.690 +- 4.085
31 A 0.833 8.530 +- 3.509
32 A 0.784 8.070 +- 3.857
33 D 0.703 7.319 +- 4.263
34 D 0.995** 10.028 +- 0.976
35 L 0.939 9.514 +- 2.313
36 I 0.998** 10.053 +- 0.852
Model 8 vs 7 43.275480000000016
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 1.000** 998.673
2 L 0.977* 976.464
3 T 0.981* 979.534
4 D 1.000** 998.507
5 G 0.953* 951.871
9 P 0.971* 970.066
11 L 0.969* 967.662
13 F 0.978* 977.029
14 A 0.963* 962.517
17 T 0.952* 951.235
18 S 0.988* 986.993
20 G 0.968* 967.066
21 V 1.000** 998.760
22 T 0.999** 998.250
23 S 1.000** 998.736
24 P 0.958* 956.931
26 E 0.963* 961.733
27 S 0.986* 985.087
29 A 0.959* 958.110
31 A 0.950* 949.091
34 D 1.000** 998.592
35 L 0.978* 977.524
36 I 1.000** 998.890
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)
Pr(w>1) post mean +- SE for w
1 L 0.995** 10.009 +- 0.994
2 L 0.990* 9.962 +- 1.187
3 T 0.975* 9.821 +- 1.638
4 D 0.992** 9.986 +- 1.095
5 G 0.872 8.849 +- 3.216
7 L 0.880 8.927 +- 3.129
9 P 0.901 9.129 +- 2.886
10 E 0.841 8.557 +- 3.501
11 L 0.926 9.365 +- 2.555
12 L 0.863 8.767 +- 3.300
13 F 0.914 9.244 +- 2.733
14 A 0.888 9.005 +- 3.040
16 N 0.843 8.574 +- 3.486
17 T 0.876 8.891 +- 3.170
18 S 0.992** 9.986 +- 1.092
20 G 0.873 8.861 +- 3.203
21 V 0.998** 10.040 +- 0.838
22 T 0.993** 9.992 +- 1.071
23 S 0.998** 10.037 +- 0.854
24 P 0.908 9.187 +- 2.811
25 N 0.828 8.433 +- 3.609
26 E 0.937 9.468 +- 2.388
27 S 0.978* 9.849 +- 1.560
29 A 0.876 8.891 +- 3.170
30 N 0.828 8.431 +- 3.611
31 A 0.893 9.050 +- 2.987
32 A 0.858 8.720 +- 3.347
33 D 0.797 8.138 +- 3.838
34 D 0.998** 10.035 +- 0.865
35 L 0.965* 9.729 +- 1.868
36 I 0.999** 10.047 +- 0.799
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
