--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:54:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2630/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -793.58          -804.17
2       -793.50          -802.53
--------------------------------------
TOTAL     -793.54          -803.65
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.487624    0.021391    0.250237    0.784408    0.462857   1012.61   1033.21    1.000
r(A<->C){all}   0.196741    0.007553    0.038111    0.374036    0.189678    345.86    366.64    1.006
r(A<->G){all}   0.154648    0.007222    0.003059    0.313911    0.145565    387.79    395.13    1.001
r(A<->T){all}   0.148796    0.008933    0.000078    0.324711    0.132040    293.44    303.84    1.003
r(C<->G){all}   0.154041    0.005491    0.016580    0.301218    0.144143    414.43    527.32    1.002
r(C<->T){all}   0.163000    0.007786    0.001919    0.320482    0.151843    299.81    301.99    1.000
r(G<->T){all}   0.182775    0.008911    0.012579    0.365232    0.170372    346.91    376.68    1.000
pi(A){all}      0.212980    0.000358    0.172903    0.247616    0.212722   1135.90   1158.40    1.000
pi(C){all}      0.341704    0.000494    0.301100    0.386449    0.341501    918.66   1135.63    1.000
pi(G){all}      0.264377    0.000421    0.222608    0.304003    0.263726    781.97    964.21    1.000
pi(T){all}      0.180938    0.000322    0.145360    0.215894    0.180304   1253.87   1377.43    1.001
alpha{1,2}      0.429927    0.130436    0.000215    1.168301    0.328636    798.06    962.37    1.000
alpha{3}        0.752371    0.274558    0.003497    1.772511    0.628114   1094.00   1219.19    1.000
pinvar{all}     0.246029    0.029140    0.000213    0.560261    0.222741    859.75    952.50    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-660.011673
Model 2: PositiveSelection	-638.427906
Model 0: one-ratio	-665.138711
Model 7: beta	-660.066027
Model 8: beta&w>1	-638.428287


Model 0 vs 1	10.254075999999941

Model 2 vs 1	43.16753399999993

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)

            Pr(w>1)     post mean +- SE for w

     1 L      1.000**       998.675
     2 L      0.978*        976.552
     3 T      0.981*        979.555
     4 D      1.000**       998.509
     5 G      0.953*        951.860
     9 P      0.971*        970.062
    11 L      0.969*        967.656
    13 F      0.978*        977.024
    14 A      0.963*        962.509
    17 T      0.952*        951.223
    18 S      0.988*        987.042
    20 G      0.968*        967.058
    21 V      1.000**       998.762
    22 T      0.999**       998.252
    23 S      1.000**       998.737
    24 P      0.958*        956.921
    26 E      0.963*        961.724
    27 S      0.986*        985.103
    29 A      0.959*        958.101
    31 A      0.950*        949.078
    34 D      1.000**       998.595
    35 L      0.979*        977.537
    36 I      1.000**       998.891

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)

            Pr(w>1)     post mean +- SE for w

     1 L      0.989*        9.976 +- 1.193
     2 L      0.979*        9.881 +- 1.501
     3 T      0.955*        9.657 +- 2.043
     4 D      0.984*        9.929 +- 1.356
     5 G      0.802         8.244 +- 3.735
     7 L      0.813         8.348 +- 3.655
     9 P      0.844         8.633 +- 3.415
    10 E      0.760         7.853 +- 3.993
    11 L      0.882         8.983 +- 3.059
    12 L      0.790         8.130 +- 3.815
    13 F      0.863         8.806 +- 3.250
    14 A      0.825         8.458 +- 3.568
    16 N      0.763         7.875 +- 3.979
    17 T      0.808         8.302 +- 3.692
    18 S      0.984*        9.929 +- 1.353
    20 G      0.804         8.259 +- 3.724
    21 V      0.996**       10.038 +- 0.927
    22 T      0.986*        9.943 +- 1.309
    23 S      0.995**       10.033 +- 0.953
    24 P      0.854         8.725 +- 3.330
    25 N      0.743         7.692 +- 4.083
    26 E      0.899         9.144 +- 2.866
    27 S      0.960*        9.704 +- 1.945
    29 A      0.808         8.302 +- 3.692
    30 N      0.743         7.690 +- 4.085
    31 A      0.833         8.530 +- 3.509
    32 A      0.784         8.070 +- 3.857
    33 D      0.703         7.319 +- 4.263
    34 D      0.995**       10.028 +- 0.976
    35 L      0.939         9.514 +- 2.313
    36 I      0.998**       10.053 +- 0.852


Model 8 vs 7	43.275480000000016

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)

            Pr(w>1)     post mean +- SE for w

     1 L      1.000**       998.673
     2 L      0.977*        976.464
     3 T      0.981*        979.534
     4 D      1.000**       998.507
     5 G      0.953*        951.871
     9 P      0.971*        970.066
    11 L      0.969*        967.662
    13 F      0.978*        977.029
    14 A      0.963*        962.517
    17 T      0.952*        951.235
    18 S      0.988*        986.993
    20 G      0.968*        967.066
    21 V      1.000**       998.760
    22 T      0.999**       998.250
    23 S      1.000**       998.736
    24 P      0.958*        956.931
    26 E      0.963*        961.733
    27 S      0.986*        985.087
    29 A      0.959*        958.110
    31 A      0.950*        949.091
    34 D      1.000**       998.592
    35 L      0.978*        977.524
    36 I      1.000**       998.890

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909003_1_2812_MLBR_RS13385)

            Pr(w>1)     post mean +- SE for w

     1 L      0.995**       10.009 +- 0.994
     2 L      0.990*        9.962 +- 1.187
     3 T      0.975*        9.821 +- 1.638
     4 D      0.992**       9.986 +- 1.095
     5 G      0.872         8.849 +- 3.216
     7 L      0.880         8.927 +- 3.129
     9 P      0.901         9.129 +- 2.886
    10 E      0.841         8.557 +- 3.501
    11 L      0.926         9.365 +- 2.555
    12 L      0.863         8.767 +- 3.300
    13 F      0.914         9.244 +- 2.733
    14 A      0.888         9.005 +- 3.040
    16 N      0.843         8.574 +- 3.486
    17 T      0.876         8.891 +- 3.170
    18 S      0.992**       9.986 +- 1.092
    20 G      0.873         8.861 +- 3.203
    21 V      0.998**       10.040 +- 0.838
    22 T      0.993**       9.992 +- 1.071
    23 S      0.998**       10.037 +- 0.854
    24 P      0.908         9.187 +- 2.811
    25 N      0.828         8.433 +- 3.609
    26 E      0.937         9.468 +- 2.388
    27 S      0.978*        9.849 +- 1.560
    29 A      0.876         8.891 +- 3.170
    30 N      0.828         8.431 +- 3.611
    31 A      0.893         9.050 +- 2.987
    32 A      0.858         8.720 +- 3.347
    33 D      0.797         8.138 +- 3.838
    34 D      0.998**       10.035 +- 0.865
    35 L      0.965*        9.729 +- 1.868
    36 I      0.999**       10.047 +- 0.799

>C1
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
>C2
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
>C3
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
>C4
AHRRRTATRTAVRLSQQMLSITPAVRYRDQHQCRGDVTERIEGLQRGRRP
DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYR
PSDPLTTTRQSNPAPGANVRooo
>C5
LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRAFNAADD
LIGDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQS
GYRPSDPLTTTRQSNPAPGANVR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=139 

C1              ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
C2              ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
C3              ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
C4              AHRRRTATRTAVRLSQQML---------------SITPAVRYRDQHQCRG
C5              ------LLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
                          .* *.: ::               :*..:*   . ::.*.

C1              FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C2              FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C3              FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C4              -DVTERIEGLQRGRRPDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
C5              FNAADDLIG-------DGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
                 :.:: : *       **********************************

C1              PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
C2              PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
C3              PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
C4              PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVRooo
C5              PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR---
                ************************************   




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  123 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  123 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5412]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5412]--->[3390]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.412 Mb, Max= 30.647 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
C2              LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
C3              LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
C4              ATRTAVRLSQQMLSITPAVRYRDQHQCRGDVTERIEGDGSVERAGLHRAT
C5              LLTDGVLLPELLFAINTSVGVTSPNESRANAADDLIGDGSVERAGLHRAT
                    .* *.: :::*..:*   . ::.*.:.:: : **************

C1              SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C2              SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C3              SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C4              SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
C5              SVPGESPEGLQRGHSPEPNDSPPWQRGSAQASQSGYRPSDPLTTTRQSNP
                **************************************************

C1              APGANVR
C2              APGANVR
C3              APGANVR
C4              APGANVR
C5              APGANVR
                *******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:88 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 71.03 C1	 C4	 71.03
TOP	    3    0	 71.03 C4	 C1	 71.03
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 71.03 C2	 C4	 71.03
TOP	    3    1	 71.03 C4	 C2	 71.03
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    2    3	 71.03 C3	 C4	 71.03
TOP	    3    2	 71.03 C4	 C3	 71.03
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    3    4	 71.03 C4	 C5	 71.03
TOP	    4    3	 71.03 C5	 C4	 71.03
AVG	 0	 C1	  *	 92.76
AVG	 1	 C2	  *	 92.76
AVG	 2	 C3	  *	 92.76
AVG	 3	 C4	  *	 71.03
AVG	 4	 C5	  *	 92.76
TOT	 TOT	  *	 88.41
CLUSTAL W (1.83) multiple sequence alignment

C1              ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
C2              ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
C3              ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
C4              GCTCACCGACGGCGTACTGCTACCAGAACTGCTGTTCGGCTATCTCAACA
C5              ------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
                                     . ** ... *  **:* **** *: ***:

C1              GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
C2              GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
C3              GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
C4              AATGCTG-------------------------------------------
C5              GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
                ..** *                                            

C1              CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
C2              CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
C3              CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
C4              --TCTATTACCCCAGCTGTTCGATACCGCGATCAACACCAGTGTCGGGGT
C5              CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
                   * ** *.*.*.. ***  *. : .   .:*...** *.*  .***  

C1              TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
C2              TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
C3              TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
C4              ---GACGTCACCGAACGAATCGAGGGCCTTCAACGCGGCCGACGACCTGA
C5              TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
                   .***  .****. ...* .: **                      **

C1              TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C2              TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C3              TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C4              TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
C5              TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
                **************************************************

C1              AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C2              AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C3              AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C4              AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
C5              AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
                **************************************************

C1              CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C2              CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C3              CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C4              CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
C5              CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
                **************************************************

C1              GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C2              GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C3              GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C4              GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
C5              GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
                **************************************************

C1              ACGTCCGA---------
C2              ACGTCCGA---------
C3              ACGTCCGA---------
C4              ACGTCCGA---------
C5              ACGTCCGA---------
                ********         



>C1
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C2
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C3
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C4
GCTCACCGACGGCGTACTGCTACCAGAACTGCTGTTCGGCTATCTCAACA
AATGCTG-------------------------------------------
--TCTATTACCCCAGCTGTTCGATACCGCGATCAACACCAGTGTCGGGGT
---GACGTCACCGAACGAATCGAGGGCCTTCAACGCGGCCGACGACCTGA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C5
------------------TTGCTCACCGACGGCGTACTGCTACCAGAACT
GCTGTTCGGCTATCTCAACAAATGCTGTCTATTACCCCAGCTGTTCGATA
CCGCGATCAACACCAGTGTCGGGGTGACGTCACCGAACGAATCGAGGGCC
TTCAACGCGGCCGACGACCTGATTGGG---------------------GA
TGGTTCGGTCGAGCGTGCCGGTCTACATCGCGCAACGTCTGTACCGGGAG
AGTCACCGGAGGGTCTCCAAAGGGGCCACAGCCCGGAACCCAACGATTCA
CCGCCCTGGCAGCGTGGGTCCGCCCAAGCTTCCCAGTCCGGTTATCGCCC
GTCAGATCCGCTCACCACTACACGGCAGTCGAACCCAGCACCAGGTGCAA
ACGTCCGA---------
>C1
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C2
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C3
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C4
AHRRRTATRTAVRLSQQMLoooooooooooooooSITPAVRYRDQHQCRG
oDVTERIEGLQRGRRPDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR
>C5
ooooooLLTDGVLLPELLFGYLNKCCLLPQLFDTAINTSVGVTSPNESRA
FNAADDLIGoooooooDGSVERAGLHRATSVPGESPEGLQRGHSPEPNDS
PPWQRGSAQASQSGYRPSDPLTTTRQSNPAPGANVR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 417 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859508
      Setting output file names to "/data/9res/ML2630/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1782400282
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5257532557
      Seed = 988282617
      Swapseed = 1579859508
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 21 unique site patterns
      Division 2 has 22 unique site patterns
      Division 3 has 22 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1030.806956 -- -25.624409
         Chain 2 -- -1030.699121 -- -25.624409
         Chain 3 -- -1030.806970 -- -25.624409
         Chain 4 -- -1030.806951 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1030.699121 -- -25.624409
         Chain 2 -- -1030.806951 -- -25.624409
         Chain 3 -- -1030.699121 -- -25.624409
         Chain 4 -- -1030.806951 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1030.807] (-1030.699) (-1030.807) (-1030.807) * [-1030.699] (-1030.807) (-1030.699) (-1030.807) 
        500 -- (-798.902) (-811.517) (-803.965) [-799.850] * (-806.277) [-799.975] (-808.882) (-802.673) -- 0:00:00
       1000 -- (-796.384) (-806.220) [-800.180] (-792.956) * (-793.931) (-798.382) [-792.822] (-803.503) -- 0:00:00
       1500 -- (-797.090) (-800.892) (-801.258) [-795.846] * (-800.019) (-799.359) [-793.260] (-798.243) -- 0:00:00
       2000 -- (-806.065) [-796.032] (-799.939) (-800.192) * (-801.272) (-793.697) (-791.896) [-794.034] -- 0:00:00
       2500 -- (-799.809) [-794.952] (-803.089) (-797.681) * [-798.623] (-793.044) (-797.957) (-801.779) -- 0:00:00
       3000 -- (-797.412) (-801.619) (-799.252) [-800.281] * (-794.927) (-797.401) [-791.675] (-795.627) -- 0:05:32
       3500 -- (-796.119) (-797.997) (-796.583) [-797.342] * (-796.108) (-790.773) (-792.000) [-797.017] -- 0:04:44
       4000 -- (-801.442) (-795.725) [-797.245] (-793.514) * (-798.508) [-797.703] (-795.738) (-803.620) -- 0:04:09
       4500 -- (-812.939) (-795.632) (-796.582) [-798.223] * (-801.033) (-796.301) [-794.910] (-801.313) -- 0:03:41
       5000 -- (-795.443) (-798.733) (-797.380) [-792.815] * (-794.932) [-792.222] (-795.201) (-791.871) -- 0:03:19

      Average standard deviation of split frequencies: 0.087297

       5500 -- (-796.858) (-797.547) (-799.961) [-792.906] * (-795.183) [-796.276] (-793.367) (-799.652) -- 0:03:00
       6000 -- (-797.929) [-795.745] (-797.048) (-804.903) * (-795.996) [-798.814] (-795.763) (-805.170) -- 0:02:45
       6500 -- (-799.840) (-792.128) [-797.880] (-807.965) * [-791.778] (-802.103) (-800.762) (-799.575) -- 0:02:32
       7000 -- (-797.848) (-793.646) [-798.610] (-806.911) * [-795.477] (-794.572) (-804.908) (-793.583) -- 0:02:21
       7500 -- (-796.995) (-796.121) [-796.980] (-805.225) * [-798.238] (-795.979) (-799.416) (-795.766) -- 0:02:12
       8000 -- [-795.751] (-797.992) (-799.950) (-800.826) * [-791.412] (-793.307) (-799.178) (-802.299) -- 0:02:04
       8500 -- (-798.409) [-796.490] (-793.516) (-796.996) * (-797.122) (-795.292) (-799.681) [-798.778] -- 0:01:56
       9000 -- (-793.875) [-794.493] (-797.160) (-799.334) * [-794.002] (-796.331) (-806.188) (-795.414) -- 0:01:50
       9500 -- (-796.338) (-797.416) [-791.481] (-796.484) * [-798.220] (-799.071) (-797.582) (-802.934) -- 0:01:44
      10000 -- (-793.396) (-796.754) [-791.426] (-796.784) * (-794.245) [-797.386] (-794.850) (-796.666) -- 0:01:39

      Average standard deviation of split frequencies: 0.123744

      10500 -- [-797.607] (-797.086) (-797.873) (-794.049) * (-792.081) (-801.508) (-795.554) [-795.628] -- 0:01:34
      11000 -- [-799.975] (-802.182) (-799.500) (-793.109) * (-798.479) (-792.560) [-796.198] (-795.722) -- 0:01:29
      11500 -- [-797.358] (-793.739) (-803.167) (-794.389) * (-792.572) (-791.003) (-798.923) [-795.176] -- 0:02:51
      12000 -- (-797.059) (-796.476) [-800.548] (-796.200) * (-794.309) (-796.141) [-793.448] (-796.761) -- 0:02:44
      12500 -- [-795.607] (-794.518) (-799.612) (-801.699) * (-797.832) (-793.859) (-796.445) [-792.457] -- 0:02:38
      13000 -- (-790.151) (-796.448) (-797.995) [-799.326] * (-802.007) [-796.224] (-800.607) (-796.241) -- 0:02:31
      13500 -- [-794.747] (-794.276) (-801.398) (-806.361) * [-793.259] (-802.946) (-801.692) (-804.130) -- 0:02:26
      14000 -- (-794.753) [-797.703] (-809.980) (-794.001) * (-797.425) (-799.141) [-806.264] (-800.386) -- 0:02:20
      14500 -- (-792.802) [-802.367] (-799.603) (-795.825) * (-800.506) (-807.800) [-793.557] (-794.713) -- 0:02:15
      15000 -- (-798.378) [-795.303] (-795.810) (-799.761) * (-797.771) [-802.660] (-793.887) (-799.867) -- 0:02:11

      Average standard deviation of split frequencies: 0.094281

      15500 -- (-796.192) (-795.874) [-797.374] (-800.466) * (-804.229) (-807.529) (-794.720) [-794.261] -- 0:02:07
      16000 -- (-798.352) [-804.535] (-796.482) (-802.951) * [-792.234] (-798.043) (-799.382) (-794.594) -- 0:02:03
      16500 -- (-792.709) (-793.200) (-804.586) [-794.528] * (-802.126) [-801.542] (-800.521) (-803.916) -- 0:01:59
      17000 -- (-798.607) (-796.390) (-799.105) [-801.335] * (-799.890) [-795.581] (-800.337) (-802.607) -- 0:01:55
      17500 -- (-804.370) (-795.399) [-794.271] (-797.983) * (-799.100) (-804.109) [-798.829] (-804.051) -- 0:01:52
      18000 -- [-798.839] (-797.065) (-801.317) (-799.019) * [-794.376] (-796.995) (-794.504) (-806.306) -- 0:01:49
      18500 -- [-794.486] (-800.296) (-799.166) (-798.340) * (-798.757) (-792.675) [-797.740] (-801.953) -- 0:01:46
      19000 -- (-798.522) (-797.558) [-795.835] (-801.380) * (-799.280) [-796.474] (-796.250) (-793.281) -- 0:01:43
      19500 -- (-797.343) (-802.792) [-798.105] (-798.032) * (-794.354) (-795.371) (-798.162) [-792.357] -- 0:01:40
      20000 -- (-791.527) [-793.156] (-795.159) (-798.751) * [-797.737] (-799.541) (-799.812) (-797.966) -- 0:01:38

      Average standard deviation of split frequencies: 0.054744

      20500 -- (-798.497) (-797.858) (-795.595) [-793.546] * (-792.943) [-800.092] (-805.103) (-797.979) -- 0:02:23
      21000 -- [-794.908] (-793.533) (-795.553) (-792.386) * (-801.144) (-809.018) (-803.292) [-800.380] -- 0:02:19
      21500 -- [-796.703] (-803.580) (-805.975) (-801.697) * [-794.719] (-794.771) (-808.940) (-794.101) -- 0:02:16
      22000 -- [-794.100] (-795.489) (-802.098) (-797.706) * (-796.375) [-797.838] (-798.247) (-801.970) -- 0:02:13
      22500 -- (-796.955) [-802.829] (-796.254) (-803.932) * (-794.818) (-795.791) (-796.143) [-794.506] -- 0:02:10
      23000 -- (-795.705) [-794.700] (-799.448) (-802.876) * (-797.836) [-797.377] (-796.942) (-793.177) -- 0:02:07
      23500 -- (-792.403) (-797.852) [-793.815] (-800.197) * (-802.009) [-794.719] (-795.011) (-795.826) -- 0:02:04
      24000 -- [-793.452] (-794.028) (-796.744) (-806.157) * [-802.369] (-800.007) (-793.303) (-795.190) -- 0:02:02
      24500 -- (-803.157) (-798.929) [-798.906] (-796.856) * (-797.876) (-798.428) [-792.909] (-800.705) -- 0:01:59
      25000 -- [-803.468] (-803.156) (-800.722) (-799.694) * [-800.587] (-793.115) (-793.905) (-791.520) -- 0:01:57

      Average standard deviation of split frequencies: 0.050767

      25500 -- [-799.921] (-803.799) (-798.166) (-801.401) * (-802.969) [-793.181] (-801.122) (-803.786) -- 0:01:54
      26000 -- (-794.088) (-797.130) [-798.668] (-794.280) * (-799.202) [-796.667] (-802.834) (-801.833) -- 0:01:52
      26500 -- (-799.747) [-797.713] (-795.497) (-794.944) * (-800.270) [-792.539] (-800.748) (-795.592) -- 0:01:50
      27000 -- (-795.625) (-794.533) (-797.448) [-794.713] * (-797.516) [-802.232] (-795.880) (-795.619) -- 0:01:48
      27500 -- (-793.692) (-799.628) (-803.090) [-793.223] * (-804.410) (-801.094) (-796.298) [-796.679] -- 0:01:46
      28000 -- (-795.345) [-799.409] (-797.483) (-794.419) * [-801.338] (-793.659) (-798.767) (-796.058) -- 0:01:44
      28500 -- (-801.016) [-793.421] (-791.848) (-794.438) * (-807.337) [-801.599] (-796.502) (-800.388) -- 0:01:42
      29000 -- (-795.114) (-795.503) (-791.745) [-798.045] * [-792.037] (-805.818) (-799.734) (-794.283) -- 0:01:40
      29500 -- (-795.026) (-804.035) (-801.452) [-792.647] * (-803.498) (-797.587) [-794.469] (-794.610) -- 0:02:11
      30000 -- (-795.437) (-796.768) [-797.083] (-798.381) * (-802.128) [-799.501] (-803.793) (-798.664) -- 0:02:09

      Average standard deviation of split frequencies: 0.052264

      30500 -- (-799.498) (-797.335) (-797.855) [-797.549] * (-803.390) (-801.430) (-798.934) [-801.412] -- 0:02:07
      31000 -- (-798.130) (-798.822) [-794.165] (-793.462) * [-800.960] (-796.625) (-796.235) (-803.283) -- 0:02:05
      31500 -- (-802.193) (-798.172) [-793.958] (-796.487) * (-801.944) (-794.108) (-799.107) [-794.770] -- 0:02:02
      32000 -- (-800.279) [-794.895] (-801.958) (-795.436) * [-801.591] (-806.256) (-806.655) (-802.393) -- 0:02:01
      32500 -- (-798.209) (-795.336) [-791.894] (-801.523) * (-799.272) [-794.704] (-793.851) (-799.005) -- 0:01:59
      33000 -- (-793.461) [-797.905] (-798.058) (-800.627) * (-803.953) [-793.363] (-797.628) (-802.276) -- 0:01:57
      33500 -- (-798.258) (-808.360) (-796.244) [-793.808] * (-805.068) (-791.106) (-798.135) [-793.453] -- 0:01:55
      34000 -- (-799.076) (-800.292) [-797.735] (-805.227) * (-800.291) (-797.686) [-799.424] (-793.539) -- 0:01:53
      34500 -- (-796.647) (-802.282) (-796.040) [-792.822] * (-798.949) (-803.212) (-796.701) [-804.013] -- 0:01:51
      35000 -- (-801.740) (-797.828) (-798.425) [-793.561] * (-797.845) (-794.531) [-798.907] (-795.203) -- 0:01:50

      Average standard deviation of split frequencies: 0.049759

      35500 -- (-798.103) (-798.731) [-791.788] (-799.458) * (-795.378) (-800.374) (-805.803) [-793.826] -- 0:01:48
      36000 -- (-797.037) (-792.059) [-794.228] (-796.759) * (-791.534) (-794.243) [-802.458] (-796.621) -- 0:01:47
      36500 -- (-799.589) (-798.031) [-793.871] (-796.204) * (-798.916) (-796.452) (-803.873) [-801.889] -- 0:01:45
      37000 -- (-793.255) (-794.426) (-794.931) [-792.501] * (-797.868) (-803.869) (-799.974) [-792.234] -- 0:01:44
      37500 -- (-799.671) (-792.608) (-798.526) [-798.264] * (-798.519) (-797.635) [-791.803] (-792.605) -- 0:01:42
      38000 -- (-803.066) [-798.527] (-794.118) (-797.162) * (-797.479) (-801.466) (-798.080) [-796.204] -- 0:02:06
      38500 -- [-796.935] (-794.757) (-801.705) (-798.293) * (-795.612) (-799.376) (-794.077) [-798.583] -- 0:02:04
      39000 -- (-808.414) (-797.500) (-794.314) [-795.238] * [-794.825] (-797.430) (-798.438) (-795.546) -- 0:02:03
      39500 -- (-794.024) [-794.886] (-799.338) (-801.221) * [-799.543] (-798.225) (-796.382) (-794.696) -- 0:02:01
      40000 -- (-798.226) (-799.881) [-791.128] (-795.163) * (-801.086) (-800.504) (-794.642) [-803.252] -- 0:02:00

      Average standard deviation of split frequencies: 0.027821

      40500 -- (-796.887) (-793.101) [-794.928] (-796.946) * (-802.601) (-796.977) [-796.880] (-799.561) -- 0:01:58
      41000 -- (-797.396) (-795.150) [-792.293] (-795.619) * (-795.485) (-797.451) (-803.504) [-795.435] -- 0:01:56
      41500 -- [-797.179] (-793.033) (-797.574) (-793.191) * (-799.431) [-793.794] (-802.485) (-796.761) -- 0:01:55
      42000 -- [-793.776] (-797.481) (-798.084) (-796.691) * (-797.562) [-794.035] (-798.212) (-794.520) -- 0:01:54
      42500 -- (-793.400) [-796.508] (-805.779) (-796.695) * (-799.616) (-800.455) [-796.853] (-803.022) -- 0:01:52
      43000 -- (-797.346) (-797.847) (-795.798) [-794.844] * [-798.472] (-799.457) (-800.153) (-795.580) -- 0:01:51
      43500 -- [-796.517] (-798.323) (-795.432) (-799.087) * (-792.416) [-797.741] (-794.955) (-805.283) -- 0:01:49
      44000 -- (-795.286) [-794.354] (-793.423) (-800.334) * (-799.887) (-794.635) [-797.165] (-799.519) -- 0:01:48
      44500 -- [-796.785] (-795.886) (-797.717) (-794.610) * (-796.082) (-803.589) (-797.245) [-801.001] -- 0:01:47
      45000 -- (-794.582) (-794.207) [-793.218] (-797.688) * (-802.926) (-804.385) (-798.186) [-793.357] -- 0:01:46

      Average standard deviation of split frequencies: 0.032793

      45500 -- (-801.779) (-792.886) [-796.740] (-799.309) * (-801.312) (-793.987) [-795.978] (-803.775) -- 0:01:44
      46000 -- (-795.552) (-797.087) (-794.294) [-793.959] * (-793.819) (-806.286) (-797.781) [-795.183] -- 0:01:43
      46500 -- (-797.218) (-803.173) (-797.348) [-797.993] * (-794.330) (-799.047) (-802.312) [-797.913] -- 0:01:42
      47000 -- [-793.525] (-795.278) (-797.740) (-799.868) * (-804.263) (-796.496) (-793.709) [-800.193] -- 0:02:01
      47500 -- (-802.173) [-796.008] (-796.481) (-794.561) * (-795.574) [-798.742] (-791.969) (-796.034) -- 0:02:00
      48000 -- (-797.061) (-795.295) (-797.738) [-795.882] * (-803.420) (-796.414) [-792.957] (-802.742) -- 0:01:59
      48500 -- (-793.370) (-794.218) [-802.455] (-799.138) * (-792.763) [-795.592] (-792.856) (-797.743) -- 0:01:57
      49000 -- [-794.348] (-796.746) (-797.419) (-796.443) * [-796.078] (-793.252) (-807.936) (-798.587) -- 0:01:56
      49500 -- [-797.591] (-798.917) (-794.216) (-801.153) * [-794.915] (-800.230) (-797.127) (-793.778) -- 0:01:55
      50000 -- (-797.720) [-793.153] (-804.098) (-794.797) * (-801.190) [-792.082] (-793.875) (-796.980) -- 0:01:54

      Average standard deviation of split frequencies: 0.035355

      50500 -- (-797.578) (-796.402) [-800.167] (-800.544) * [-800.565] (-795.223) (-795.966) (-804.386) -- 0:01:52
      51000 -- (-801.096) (-794.464) (-801.551) [-795.754] * (-794.578) [-794.143] (-797.246) (-797.801) -- 0:01:51
      51500 -- (-798.237) (-799.784) (-799.199) [-795.132] * [-792.648] (-797.454) (-803.995) (-802.434) -- 0:01:50
      52000 -- (-802.480) (-796.541) [-792.391] (-802.195) * (-795.010) [-794.707] (-794.115) (-798.501) -- 0:01:49
      52500 -- (-796.798) [-793.441] (-806.560) (-798.174) * (-802.498) [-799.577] (-795.803) (-795.926) -- 0:01:48
      53000 -- (-799.669) [-794.326] (-798.369) (-798.103) * (-797.202) (-796.307) (-797.852) [-794.176] -- 0:01:47
      53500 -- [-804.167] (-803.394) (-798.130) (-796.175) * (-793.662) [-794.384] (-795.738) (-793.234) -- 0:01:46
      54000 -- (-798.329) (-804.937) (-798.517) [-798.642] * (-797.966) [-795.906] (-798.047) (-793.810) -- 0:01:45
      54500 -- [-798.957] (-798.866) (-799.968) (-794.179) * (-802.597) [-793.193] (-796.306) (-799.059) -- 0:01:44
      55000 -- (-801.728) [-794.469] (-803.162) (-803.384) * [-798.231] (-791.985) (-797.035) (-798.597) -- 0:01:43

      Average standard deviation of split frequencies: 0.040406

      55500 -- (-797.738) (-799.775) (-804.761) [-797.572] * [-799.616] (-801.153) (-792.443) (-802.709) -- 0:01:42
      56000 -- (-797.062) (-794.315) [-796.821] (-803.534) * (-804.141) (-792.124) (-794.064) [-798.770] -- 0:01:58
      56500 -- (-806.048) (-795.742) [-796.308] (-800.315) * (-792.211) [-796.947] (-796.404) (-798.879) -- 0:01:56
      57000 -- (-795.943) (-797.191) [-797.473] (-810.471) * (-793.854) (-797.911) [-798.430] (-794.915) -- 0:01:55
      57500 -- (-793.668) (-793.054) [-793.628] (-795.736) * (-795.247) (-797.551) (-801.792) [-794.333] -- 0:01:54
      58000 -- (-798.535) (-794.853) [-793.595] (-793.115) * (-803.449) (-799.811) (-799.935) [-796.155] -- 0:01:53
      58500 -- [-793.494] (-805.958) (-795.454) (-799.351) * (-797.889) (-797.405) [-798.340] (-797.204) -- 0:01:52
      59000 -- [-795.666] (-790.822) (-799.048) (-801.002) * (-796.260) (-792.713) (-801.233) [-795.923] -- 0:01:51
      59500 -- (-799.752) [-795.597] (-799.442) (-793.720) * (-799.289) [-789.873] (-796.156) (-800.260) -- 0:01:50
      60000 -- (-799.226) [-794.253] (-803.504) (-791.991) * (-806.531) [-797.588] (-793.799) (-798.875) -- 0:01:49

      Average standard deviation of split frequencies: 0.032636

      60500 -- (-799.067) (-797.958) [-799.536] (-797.619) * (-799.445) (-793.070) [-791.159] (-800.165) -- 0:01:48
      61000 -- [-792.505] (-800.554) (-796.744) (-797.014) * (-795.764) (-797.108) [-799.830] (-794.603) -- 0:01:47
      61500 -- (-800.376) (-798.015) [-799.290] (-798.376) * [-797.052] (-799.959) (-795.921) (-804.595) -- 0:01:46
      62000 -- (-804.828) (-799.294) [-799.230] (-796.026) * (-794.411) (-796.977) [-796.185] (-803.416) -- 0:01:45
      62500 -- (-801.842) (-794.750) (-799.391) [-795.600] * (-792.552) (-795.195) [-795.069] (-796.171) -- 0:01:45
      63000 -- (-806.656) (-794.299) (-801.949) [-798.981] * [-796.158] (-800.759) (-794.317) (-797.076) -- 0:01:44
      63500 -- (-799.787) [-797.321] (-798.070) (-804.412) * (-796.209) (-801.897) [-794.859] (-801.683) -- 0:01:43
      64000 -- (-803.978) (-800.119) [-797.853] (-797.748) * (-797.268) (-805.636) (-798.933) [-797.251] -- 0:01:42
      64500 -- (-805.440) [-792.385] (-797.357) (-798.315) * (-800.619) (-799.378) (-794.504) [-794.145] -- 0:01:41
      65000 -- (-793.568) (-799.061) [-797.188] (-799.621) * (-799.846) (-806.057) [-796.333] (-794.666) -- 0:01:40

      Average standard deviation of split frequencies: 0.021427

      65500 -- (-793.029) (-798.298) (-807.198) [-799.200] * [-796.373] (-794.129) (-798.251) (-798.222) -- 0:01:54
      66000 -- (-793.794) [-795.032] (-797.471) (-797.454) * (-794.231) (-809.440) [-799.163] (-795.129) -- 0:01:53
      66500 -- [-795.231] (-793.570) (-799.978) (-796.923) * [-795.029] (-801.844) (-805.271) (-801.064) -- 0:01:52
      67000 -- [-796.108] (-802.578) (-800.955) (-797.083) * [-795.984] (-799.471) (-799.347) (-795.014) -- 0:01:51
      67500 -- (-798.371) [-792.631] (-794.177) (-801.386) * (-797.888) (-795.291) (-797.259) [-792.871] -- 0:01:50
      68000 -- (-796.244) [-793.894] (-797.120) (-797.487) * [-791.124] (-804.023) (-801.288) (-796.044) -- 0:01:49
      68500 -- (-793.914) (-798.352) (-799.812) [-799.313] * [-798.543] (-794.853) (-801.048) (-799.867) -- 0:01:48
      69000 -- (-795.615) (-800.509) (-803.143) [-793.564] * [-792.334] (-800.719) (-801.276) (-799.514) -- 0:01:47
      69500 -- (-800.353) [-796.828] (-799.489) (-802.903) * (-792.440) (-795.885) [-803.307] (-801.904) -- 0:01:47
      70000 -- (-796.636) [-805.096] (-807.695) (-805.791) * (-801.658) (-796.238) [-797.858] (-802.124) -- 0:01:46

      Average standard deviation of split frequencies: 0.024015

      70500 -- (-798.246) [-796.686] (-806.019) (-803.943) * (-805.837) (-797.722) (-815.699) [-802.217] -- 0:01:45
      71000 -- [-798.784] (-796.036) (-802.118) (-795.713) * (-791.068) [-793.702] (-802.617) (-797.490) -- 0:01:44
      71500 -- (-800.564) (-801.659) (-797.697) [-798.083] * (-792.140) [-796.478] (-808.094) (-805.098) -- 0:01:43
      72000 -- (-802.206) (-794.495) [-801.132] (-804.429) * [-794.686] (-812.123) (-802.856) (-799.267) -- 0:01:43
      72500 -- (-796.247) (-797.122) (-808.051) [-798.725] * (-796.941) (-794.512) (-800.390) [-797.083] -- 0:01:42
      73000 -- (-803.336) (-797.677) (-796.377) [-793.789] * [-796.623] (-795.424) (-794.816) (-796.547) -- 0:01:41
      73500 -- (-796.112) (-796.612) (-799.648) [-796.594] * (-797.538) (-798.998) (-804.299) [-793.881] -- 0:01:40
      74000 -- (-800.458) [-795.538] (-796.759) (-798.723) * (-801.561) (-794.014) [-794.742] (-798.229) -- 0:01:40
      74500 -- (-801.429) (-797.684) (-800.499) [-798.167] * (-798.989) (-807.211) (-800.303) [-800.554] -- 0:01:51
      75000 -- (-800.962) (-795.925) [-802.267] (-801.225) * [-794.363] (-796.866) (-800.334) (-798.821) -- 0:01:51

      Average standard deviation of split frequencies: 0.013646

      75500 -- (-797.770) (-796.156) (-802.418) [-797.582] * (-794.281) [-806.507] (-799.672) (-805.453) -- 0:01:50
      76000 -- (-798.804) (-793.663) [-799.349] (-797.756) * (-793.859) (-796.268) (-796.386) [-795.151] -- 0:01:49
      76500 -- (-797.257) [-792.848] (-798.745) (-799.165) * [-796.810] (-796.969) (-798.025) (-798.143) -- 0:01:48
      77000 -- (-810.387) (-798.780) [-804.012] (-797.050) * (-794.251) [-795.703] (-794.443) (-797.614) -- 0:01:47
      77500 -- [-805.033] (-793.644) (-798.074) (-803.514) * (-795.439) [-802.149] (-807.897) (-796.119) -- 0:01:47
      78000 -- (-798.019) (-794.136) [-794.892] (-792.480) * (-793.397) (-800.031) [-797.213] (-796.557) -- 0:01:46
      78500 -- [-797.381] (-797.579) (-795.074) (-796.526) * [-791.129] (-806.105) (-795.452) (-792.675) -- 0:01:45
      79000 -- (-795.361) [-794.504] (-793.783) (-801.213) * [-798.316] (-800.320) (-793.846) (-795.777) -- 0:01:44
      79500 -- (-795.473) (-794.289) (-795.338) [-792.964] * (-797.898) (-794.192) (-795.666) [-795.147] -- 0:01:44
      80000 -- [-791.922] (-790.005) (-795.807) (-801.681) * (-796.982) (-796.994) (-795.657) [-799.717] -- 0:01:43

      Average standard deviation of split frequencies: 0.017532

      80500 -- (-803.271) [-794.822] (-798.729) (-800.515) * (-802.203) (-797.638) (-806.083) [-802.164] -- 0:01:42
      81000 -- (-801.696) [-795.906] (-797.183) (-792.926) * (-799.158) (-807.175) [-798.834] (-795.287) -- 0:01:42
      81500 -- (-792.237) (-794.325) [-792.110] (-801.746) * (-798.268) [-792.341] (-798.565) (-798.034) -- 0:01:41
      82000 -- [-794.327] (-805.718) (-793.632) (-800.224) * (-810.793) [-792.905] (-797.331) (-802.975) -- 0:01:40
      82500 -- (-796.905) (-803.077) [-800.191] (-804.468) * (-798.940) (-796.147) (-797.006) [-796.389] -- 0:01:40
      83000 -- (-797.993) [-793.880] (-803.728) (-798.885) * (-796.263) (-796.557) (-804.731) [-795.671] -- 0:01:39
      83500 -- [-796.422] (-797.118) (-799.916) (-803.689) * (-801.473) [-798.246] (-801.434) (-801.559) -- 0:01:49
      84000 -- (-798.089) (-799.934) [-795.726] (-799.270) * (-794.063) (-793.589) (-792.968) [-794.048] -- 0:01:49
      84500 -- (-798.932) (-792.373) [-800.876] (-799.307) * (-813.938) (-797.957) (-805.651) [-793.143] -- 0:01:48
      85000 -- [-795.984] (-795.305) (-797.289) (-797.278) * (-797.168) (-801.658) (-814.625) [-797.860] -- 0:01:47

      Average standard deviation of split frequencies: 0.013155

      85500 -- [-805.000] (-798.191) (-796.424) (-796.078) * [-799.889] (-797.417) (-797.262) (-795.916) -- 0:01:46
      86000 -- (-793.370) [-796.870] (-794.948) (-795.096) * (-811.687) [-794.848] (-800.457) (-798.797) -- 0:01:46
      86500 -- [-795.004] (-800.858) (-791.911) (-799.565) * (-807.714) (-800.750) [-795.924] (-792.700) -- 0:01:45
      87000 -- (-797.474) (-799.929) [-792.491] (-803.669) * [-796.594] (-798.242) (-795.358) (-799.319) -- 0:01:44
      87500 -- (-797.281) (-800.800) [-795.142] (-794.709) * (-794.772) [-800.392] (-803.480) (-798.809) -- 0:01:44
      88000 -- (-808.902) [-795.186] (-796.202) (-795.937) * (-803.198) (-794.730) (-795.680) [-796.654] -- 0:01:43
      88500 -- (-792.721) [-795.061] (-791.579) (-793.012) * (-792.119) (-792.229) [-796.257] (-798.468) -- 0:01:42
      89000 -- (-798.697) (-799.454) [-799.795] (-795.416) * (-794.934) (-795.382) [-792.676] (-798.449) -- 0:01:42
      89500 -- (-802.640) (-800.822) [-796.498] (-794.978) * (-799.900) (-794.557) [-798.486] (-793.200) -- 0:01:41
      90000 -- (-801.636) [-802.914] (-797.047) (-797.943) * (-799.909) (-797.452) [-795.741] (-796.215) -- 0:01:41

      Average standard deviation of split frequencies: 0.010399

      90500 -- (-802.858) (-798.202) (-797.820) [-790.178] * (-797.347) [-793.490] (-805.338) (-792.746) -- 0:01:40
      91000 -- (-799.947) (-800.250) (-795.627) [-793.852] * (-797.097) (-796.653) (-799.571) [-795.811] -- 0:01:39
      91500 -- [-793.431] (-801.182) (-798.107) (-803.835) * (-796.177) (-793.595) (-798.256) [-801.092] -- 0:01:39
      92000 -- (-796.696) [-798.074] (-796.936) (-796.539) * (-793.988) (-796.110) (-795.854) [-795.550] -- 0:01:38
      92500 -- (-792.068) (-797.724) (-797.232) [-795.110] * (-799.790) [-797.189] (-802.642) (-792.626) -- 0:01:47
      93000 -- (-793.995) (-806.213) [-792.672] (-796.976) * (-794.373) (-801.024) [-801.735] (-795.436) -- 0:01:47
      93500 -- (-793.579) [-798.629] (-800.130) (-797.036) * [-795.319] (-800.346) (-802.191) (-798.144) -- 0:01:46
      94000 -- (-796.474) (-797.796) [-792.342] (-795.528) * [-791.984] (-798.541) (-799.135) (-799.365) -- 0:01:46
      94500 -- (-801.845) [-795.246] (-794.317) (-804.119) * (-794.232) [-796.792] (-799.963) (-803.956) -- 0:01:45
      95000 -- (-797.107) (-798.800) [-791.327] (-796.644) * (-795.416) (-794.951) (-799.880) [-796.668] -- 0:01:44

      Average standard deviation of split frequencies: 0.013749

      95500 -- (-801.170) (-805.005) (-793.883) [-797.499] * (-793.302) (-793.936) [-794.263] (-798.729) -- 0:01:44
      96000 -- (-800.681) (-796.336) [-793.898] (-799.673) * (-791.474) (-806.717) [-799.329] (-804.039) -- 0:01:43
      96500 -- (-798.517) (-797.151) [-799.965] (-796.812) * (-791.042) (-802.559) [-795.200] (-797.832) -- 0:01:42
      97000 -- (-792.423) [-797.064] (-796.931) (-797.540) * (-793.741) [-801.725] (-796.885) (-793.463) -- 0:01:42
      97500 -- (-799.125) (-798.420) [-791.516] (-793.052) * [-796.546] (-802.129) (-804.120) (-804.159) -- 0:01:41
      98000 -- (-796.785) (-805.744) (-794.035) [-796.405] * [-797.743] (-801.368) (-804.266) (-798.988) -- 0:01:41
      98500 -- [-792.472] (-793.047) (-798.572) (-798.200) * (-797.586) (-799.816) (-803.426) [-794.941] -- 0:01:40
      99000 -- [-794.880] (-798.449) (-798.238) (-795.971) * (-795.320) (-803.586) [-793.894] (-800.919) -- 0:01:40
      99500 -- (-795.786) (-794.664) [-801.326] (-797.554) * (-802.232) [-796.183] (-793.904) (-797.867) -- 0:01:39
      100000 -- (-793.093) [-803.178] (-803.142) (-804.139) * (-794.700) (-799.053) (-794.376) [-798.471] -- 0:01:39

      Average standard deviation of split frequencies: 0.009366

      100500 -- (-795.721) [-794.899] (-798.525) (-799.347) * (-797.945) [-798.712] (-793.830) (-798.759) -- 0:01:38
      101000 -- [-794.179] (-795.009) (-799.274) (-802.228) * [-792.285] (-800.395) (-798.918) (-797.560) -- 0:01:37
      101500 -- [-797.147] (-802.141) (-794.199) (-793.452) * (-798.828) [-794.405] (-796.719) (-795.076) -- 0:01:46
      102000 -- (-797.412) [-801.759] (-795.394) (-798.769) * [-799.706] (-801.910) (-797.658) (-795.489) -- 0:01:45
      102500 -- (-801.839) [-801.013] (-793.838) (-798.958) * [-793.464] (-802.581) (-796.113) (-794.381) -- 0:01:45
      103000 -- [-797.920] (-793.767) (-796.221) (-794.506) * [-793.530] (-800.986) (-801.862) (-801.030) -- 0:01:44
      103500 -- (-802.475) (-801.855) [-797.572] (-798.348) * (-800.254) (-801.863) (-800.009) [-789.509] -- 0:01:43
      104000 -- (-804.724) (-800.903) [-795.408] (-798.257) * (-799.258) [-792.418] (-800.817) (-794.163) -- 0:01:43
      104500 -- (-798.258) (-796.274) [-794.266] (-804.087) * [-801.471] (-802.631) (-806.000) (-798.010) -- 0:01:42
      105000 -- (-795.363) [-795.422] (-799.999) (-798.761) * (-794.106) (-813.359) [-794.801] (-798.875) -- 0:01:42

      Average standard deviation of split frequencies: 0.011563

      105500 -- (-797.580) [-795.582] (-801.490) (-796.375) * (-797.849) (-800.934) [-792.046] (-800.138) -- 0:01:41
      106000 -- (-797.055) (-804.741) [-801.549] (-797.420) * (-804.117) (-800.230) [-792.820] (-801.334) -- 0:01:41
      106500 -- (-796.245) (-799.736) (-796.411) [-799.726] * [-796.843] (-797.893) (-795.442) (-796.437) -- 0:01:40
      107000 -- (-797.190) (-799.248) (-799.730) [-792.860] * (-794.645) [-797.102] (-795.988) (-802.152) -- 0:01:40
      107500 -- (-794.956) (-796.298) [-799.707] (-800.256) * (-796.901) [-802.544] (-792.986) (-798.431) -- 0:01:39
      108000 -- (-793.270) (-799.476) (-802.414) [-796.648] * (-815.862) (-795.264) (-793.893) [-798.765] -- 0:01:39
      108500 -- (-795.942) [-793.787] (-803.534) (-797.755) * [-792.801] (-797.301) (-806.914) (-798.400) -- 0:01:38
      109000 -- (-795.344) (-793.006) [-797.002] (-799.459) * (-795.322) (-800.986) (-802.539) [-794.229] -- 0:01:38
      109500 -- (-795.760) (-800.980) [-794.696] (-795.777) * (-795.893) [-796.887] (-799.357) (-795.259) -- 0:01:37
      110000 -- (-796.417) [-791.626] (-792.174) (-796.377) * [-798.999] (-797.391) (-807.904) (-796.867) -- 0:01:37

      Average standard deviation of split frequencies: 0.011075

      110500 -- (-799.846) (-797.718) [-793.524] (-796.159) * (-799.122) (-793.974) [-796.065] (-795.245) -- 0:01:44
      111000 -- (-801.408) [-797.157] (-801.205) (-799.466) * (-794.243) (-799.499) [-795.283] (-803.748) -- 0:01:44
      111500 -- (-800.693) (-799.662) (-796.392) [-795.373] * (-805.111) (-802.603) [-793.666] (-797.029) -- 0:01:43
      112000 -- (-793.456) (-806.165) (-791.648) [-792.988] * (-793.858) [-791.703] (-801.587) (-793.968) -- 0:01:43
      112500 -- (-796.184) (-801.377) [-796.901] (-795.630) * (-796.899) (-794.033) (-798.091) [-800.242] -- 0:01:42
      113000 -- [-800.180] (-798.973) (-793.470) (-797.432) * (-807.711) (-798.036) [-795.899] (-796.310) -- 0:01:42
      113500 -- (-796.814) (-801.649) (-796.463) [-801.440] * [-794.143] (-793.307) (-797.524) (-804.448) -- 0:01:41
      114000 -- (-797.326) (-796.085) (-797.177) [-791.583] * (-801.036) (-797.554) (-804.375) [-800.569] -- 0:01:41
      114500 -- (-799.687) [-794.448] (-794.108) (-791.803) * (-796.659) (-799.686) (-802.059) [-801.467] -- 0:01:40
      115000 -- (-797.522) (-803.147) [-791.516] (-791.755) * (-801.536) [-796.062] (-801.726) (-798.310) -- 0:01:40

      Average standard deviation of split frequencies: 0.008128

      115500 -- (-796.649) (-793.880) [-793.921] (-795.558) * (-801.641) [-797.169] (-794.723) (-796.423) -- 0:01:39
      116000 -- (-800.709) (-796.219) (-795.176) [-794.414] * [-796.025] (-797.296) (-799.829) (-800.742) -- 0:01:39
      116500 -- [-797.602] (-793.550) (-793.970) (-795.905) * (-799.198) [-794.236] (-799.652) (-797.956) -- 0:01:38
      117000 -- (-798.753) [-795.865] (-799.329) (-795.662) * (-796.002) [-792.936] (-800.276) (-800.042) -- 0:01:38
      117500 -- (-801.573) (-800.271) (-802.550) [-801.711] * (-810.933) (-800.727) (-803.215) [-799.103] -- 0:01:37
      118000 -- [-798.291] (-797.721) (-801.006) (-802.043) * [-796.327] (-798.169) (-794.027) (-797.129) -- 0:01:37
      118500 -- (-790.078) (-795.458) [-795.783] (-795.551) * [-796.304] (-793.952) (-796.138) (-805.161) -- 0:01:36
      119000 -- [-797.306] (-796.560) (-794.954) (-796.585) * (-795.836) (-795.677) [-799.399] (-797.458) -- 0:01:36
      119500 -- [-803.593] (-799.332) (-799.986) (-797.066) * (-790.771) [-793.221] (-794.182) (-793.615) -- 0:01:43
      120000 -- (-796.335) (-802.152) (-796.242) [-796.318] * (-794.208) (-797.357) [-796.858] (-800.591) -- 0:01:42

      Average standard deviation of split frequencies: 0.009376

      120500 -- (-797.564) (-798.723) [-797.980] (-803.634) * (-795.745) (-799.565) [-801.080] (-797.599) -- 0:01:42
      121000 -- [-798.428] (-794.638) (-798.688) (-791.354) * [-796.728] (-798.995) (-797.333) (-801.068) -- 0:01:41
      121500 -- (-799.735) [-797.386] (-795.100) (-795.078) * (-796.792) [-797.748] (-794.679) (-797.263) -- 0:01:41
      122000 -- (-793.922) [-795.088] (-795.794) (-799.228) * (-797.562) (-795.832) [-797.368] (-796.215) -- 0:01:40
      122500 -- [-800.448] (-801.327) (-794.965) (-799.288) * (-799.685) (-798.674) [-796.109] (-805.851) -- 0:01:40
      123000 -- (-796.983) [-792.090] (-794.435) (-799.685) * (-795.426) (-801.971) [-794.094] (-798.426) -- 0:01:39
      123500 -- [-798.620] (-796.971) (-794.717) (-800.108) * [-794.628] (-800.455) (-797.574) (-795.343) -- 0:01:39
      124000 -- [-795.689] (-794.286) (-795.825) (-800.321) * (-795.763) [-797.733] (-802.338) (-794.745) -- 0:01:38
      124500 -- [-799.729] (-801.362) (-798.996) (-799.424) * (-794.995) (-795.547) (-804.600) [-795.705] -- 0:01:38
      125000 -- (-800.031) (-795.387) [-795.307] (-799.450) * (-793.437) [-796.563] (-799.841) (-799.137) -- 0:01:38

      Average standard deviation of split frequencies: 0.011224

      125500 -- (-794.865) (-792.412) [-794.117] (-806.001) * (-794.074) [-793.810] (-794.750) (-811.254) -- 0:01:37
      126000 -- [-795.546] (-798.492) (-793.786) (-801.330) * (-793.136) (-795.497) (-800.770) [-801.018] -- 0:01:37
      126500 -- (-797.806) (-800.216) [-793.624] (-802.051) * (-799.595) (-801.007) (-801.133) [-796.875] -- 0:01:36
      127000 -- (-798.158) [-798.482] (-798.083) (-799.884) * (-797.779) (-793.974) [-793.870] (-798.299) -- 0:01:36
      127500 -- (-803.402) (-800.912) [-801.292] (-794.786) * (-802.098) (-799.968) (-801.957) [-803.603] -- 0:01:35
      128000 -- (-796.856) [-794.869] (-799.655) (-798.105) * [-799.307] (-800.589) (-798.838) (-796.200) -- 0:01:35
      128500 -- (-798.255) (-802.300) (-802.842) [-794.801] * [-796.111] (-799.902) (-802.146) (-801.751) -- 0:01:41
      129000 -- (-794.514) (-796.843) (-797.831) [-792.524] * (-796.674) (-796.889) [-802.265] (-798.995) -- 0:01:41
      129500 -- (-797.928) [-797.377] (-796.409) (-796.711) * (-794.613) (-791.551) (-799.263) [-801.119] -- 0:01:40
      130000 -- (-809.703) [-788.702] (-806.623) (-796.648) * (-797.302) [-793.177] (-797.360) (-797.381) -- 0:01:40

      Average standard deviation of split frequencies: 0.010823

      130500 -- (-802.377) (-797.274) [-797.171] (-797.528) * [-795.447] (-799.265) (-802.053) (-799.124) -- 0:01:39
      131000 -- (-794.699) (-793.556) (-796.851) [-797.043] * (-797.910) (-799.338) [-798.497] (-800.869) -- 0:01:39
      131500 -- [-793.212] (-806.198) (-802.713) (-805.956) * (-802.227) [-799.381] (-798.180) (-802.157) -- 0:01:39
      132000 -- (-795.760) [-796.409] (-802.117) (-790.740) * (-799.372) (-805.492) (-799.111) [-797.977] -- 0:01:38
      132500 -- (-797.962) (-801.831) [-798.326] (-793.284) * (-806.896) [-795.054] (-802.983) (-803.711) -- 0:01:38
      133000 -- [-796.275] (-797.587) (-802.325) (-798.055) * (-802.460) (-795.128) (-801.322) [-792.410] -- 0:01:37
      133500 -- (-804.168) [-799.449] (-792.542) (-798.017) * (-796.736) [-795.516] (-805.909) (-796.202) -- 0:01:37
      134000 -- [-797.121] (-800.090) (-800.813) (-793.989) * (-800.901) (-802.540) [-808.581] (-797.360) -- 0:01:36
      134500 -- [-791.830] (-794.946) (-800.557) (-796.858) * (-797.698) [-793.308] (-804.700) (-797.549) -- 0:01:36
      135000 -- (-795.847) (-794.119) (-797.209) [-801.561] * (-795.752) [-798.970] (-794.753) (-798.362) -- 0:01:36

      Average standard deviation of split frequencies: 0.009705

      135500 -- [-800.723] (-795.028) (-800.498) (-802.259) * [-796.489] (-797.818) (-807.750) (-800.330) -- 0:01:35
      136000 -- (-795.296) [-799.370] (-800.731) (-789.595) * [-794.495] (-796.139) (-799.238) (-795.111) -- 0:01:35
      136500 -- [-797.408] (-802.281) (-790.342) (-801.251) * (-795.826) [-796.120] (-807.953) (-795.072) -- 0:01:34
      137000 -- (-795.125) (-797.737) [-793.260] (-794.461) * [-800.155] (-797.856) (-798.640) (-803.571) -- 0:01:34
      137500 -- (-802.654) (-804.136) [-796.074] (-793.255) * [-792.465] (-795.150) (-795.200) (-796.504) -- 0:01:40
      138000 -- [-797.105] (-795.740) (-798.018) (-803.275) * [-797.393] (-795.500) (-801.871) (-795.065) -- 0:01:39
      138500 -- (-798.540) (-800.045) (-804.402) [-798.450] * (-796.266) [-791.106] (-799.668) (-797.772) -- 0:01:39
      139000 -- (-798.654) (-799.808) [-796.368] (-796.927) * (-802.457) [-794.450] (-800.207) (-801.880) -- 0:01:39
      139500 -- [-794.960] (-801.659) (-794.345) (-794.127) * (-802.483) [-795.162] (-803.892) (-794.819) -- 0:01:38
      140000 -- [-798.421] (-799.363) (-792.735) (-802.355) * (-796.989) [-794.775] (-800.545) (-798.164) -- 0:01:38

      Average standard deviation of split frequencies: 0.007373

      140500 -- (-796.492) (-798.800) [-793.575] (-804.952) * [-793.922] (-805.950) (-806.023) (-800.974) -- 0:01:37
      141000 -- (-793.318) (-800.496) (-800.759) [-798.800] * (-798.276) [-797.407] (-806.152) (-793.518) -- 0:01:37
      141500 -- (-799.669) (-797.299) [-797.754] (-795.488) * (-797.359) (-799.432) [-797.000] (-799.838) -- 0:01:37
      142000 -- [-799.741] (-800.322) (-798.523) (-795.706) * (-792.309) (-801.992) (-797.323) [-793.727] -- 0:01:36
      142500 -- (-798.790) (-798.160) [-795.016] (-797.911) * (-795.224) (-795.090) [-797.042] (-795.737) -- 0:01:36
      143000 -- (-804.656) [-797.026] (-793.899) (-800.521) * (-800.025) (-795.105) [-797.100] (-802.702) -- 0:01:35
      143500 -- (-793.628) [-796.182] (-795.558) (-797.995) * (-805.245) (-798.646) (-794.638) [-792.008] -- 0:01:35
      144000 -- (-793.772) (-797.270) [-794.699] (-799.540) * (-797.965) [-801.648] (-793.677) (-799.526) -- 0:01:35
      144500 -- (-802.084) (-796.910) (-790.886) [-794.760] * (-794.762) (-801.769) [-793.846] (-800.149) -- 0:01:34
      145000 -- [-795.351] (-798.183) (-798.819) (-796.023) * (-793.243) [-802.626] (-798.273) (-794.878) -- 0:01:34

      Average standard deviation of split frequencies: 0.008395

      145500 -- (-802.172) [-802.832] (-796.178) (-800.228) * [-799.135] (-796.856) (-798.958) (-797.001) -- 0:01:33
      146000 -- (-796.576) (-794.818) [-793.404] (-794.699) * (-796.441) (-798.137) (-801.607) [-793.343] -- 0:01:39
      146500 -- [-798.862] (-798.894) (-797.484) (-797.089) * (-796.531) [-801.373] (-794.281) (-796.834) -- 0:01:39
      147000 -- [-799.729] (-803.691) (-798.844) (-795.676) * [-794.653] (-801.010) (-798.800) (-797.388) -- 0:01:38
      147500 -- (-798.990) [-793.852] (-802.606) (-799.038) * (-802.622) [-793.655] (-801.262) (-801.602) -- 0:01:38
      148000 -- [-797.268] (-793.047) (-802.193) (-799.928) * [-794.618] (-801.366) (-797.333) (-802.461) -- 0:01:37
      148500 -- [-803.352] (-803.948) (-795.890) (-800.970) * (-797.496) [-792.458] (-799.917) (-801.332) -- 0:01:37
      149000 -- (-797.707) (-798.752) [-795.198] (-801.415) * (-798.893) (-790.907) (-796.526) [-795.017] -- 0:01:37
      149500 -- (-800.132) [-800.162] (-802.057) (-792.828) * (-798.705) (-797.397) (-804.199) [-797.092] -- 0:01:36
      150000 -- [-795.791] (-800.816) (-801.748) (-797.541) * [-794.171] (-795.290) (-805.649) (-794.420) -- 0:01:36

      Average standard deviation of split frequencies: 0.012515

      150500 -- (-792.790) [-798.332] (-802.995) (-799.647) * (-794.364) (-794.878) (-810.662) [-794.198] -- 0:01:35
      151000 -- [-793.978] (-794.650) (-799.988) (-802.468) * (-797.880) [-800.838] (-798.483) (-792.975) -- 0:01:35
      151500 -- (-797.380) [-805.059] (-794.512) (-800.380) * (-793.768) (-797.739) [-798.155] (-800.350) -- 0:01:35
      152000 -- (-799.843) [-801.045] (-804.051) (-803.392) * (-799.046) [-791.593] (-800.215) (-790.583) -- 0:01:34
      152500 -- (-798.575) (-800.268) [-793.667] (-802.515) * (-804.138) (-801.726) (-807.304) [-798.667] -- 0:01:34
      153000 -- (-798.215) [-796.814] (-796.706) (-797.978) * (-797.379) (-799.398) (-802.293) [-794.135] -- 0:01:34
      153500 -- (-800.158) (-800.924) (-806.330) [-795.211] * (-795.006) (-797.816) [-798.830] (-800.916) -- 0:01:33
      154000 -- (-793.588) (-805.382) [-798.385] (-794.622) * (-794.342) (-794.171) [-795.436] (-799.246) -- 0:01:33
      154500 -- (-796.625) (-793.112) [-799.218] (-802.362) * (-798.633) (-793.413) [-798.138] (-792.539) -- 0:01:33
      155000 -- (-791.751) [-793.579] (-800.584) (-800.847) * [-804.578] (-803.338) (-796.753) (-797.775) -- 0:01:38

      Average standard deviation of split frequencies: 0.011483

      155500 -- (-796.460) (-796.737) [-801.439] (-799.251) * (-797.906) (-803.467) [-795.739] (-810.641) -- 0:01:37
      156000 -- (-793.657) [-800.217] (-799.018) (-798.462) * (-804.212) (-797.684) [-799.144] (-801.447) -- 0:01:37
      156500 -- [-796.276] (-800.009) (-796.795) (-797.483) * (-800.587) [-800.834] (-805.888) (-800.910) -- 0:01:37
      157000 -- (-796.088) (-792.907) (-800.044) [-795.798] * [-800.154] (-800.572) (-806.472) (-798.556) -- 0:01:36
      157500 -- (-793.445) (-800.611) (-799.220) [-796.817] * (-799.304) [-793.591] (-793.711) (-798.868) -- 0:01:36
      158000 -- (-793.245) (-792.935) [-793.987] (-793.834) * (-795.494) (-797.847) [-791.927] (-795.178) -- 0:01:35
      158500 -- (-795.623) (-798.830) [-795.807] (-798.957) * [-794.365] (-800.801) (-795.300) (-795.821) -- 0:01:35
      159000 -- (-794.112) [-797.885] (-797.767) (-794.815) * (-797.640) (-795.305) [-795.837] (-794.953) -- 0:01:35
      159500 -- [-803.467] (-797.830) (-794.140) (-806.846) * (-793.704) (-798.392) [-800.090] (-796.998) -- 0:01:34
      160000 -- (-800.410) (-799.398) [-796.963] (-793.686) * (-800.432) [-808.365] (-797.140) (-793.511) -- 0:01:34

      Average standard deviation of split frequencies: 0.012910

      160500 -- (-793.359) [-803.025] (-804.938) (-796.666) * (-798.443) (-803.192) (-801.882) [-792.730] -- 0:01:34
      161000 -- [-795.433] (-798.396) (-795.172) (-801.023) * (-805.832) [-799.356] (-794.125) (-792.969) -- 0:01:33
      161500 -- [-801.328] (-796.243) (-806.362) (-797.718) * (-798.894) (-798.267) [-797.049] (-796.654) -- 0:01:33
      162000 -- (-793.962) (-798.302) [-796.401] (-799.036) * [-793.078] (-798.713) (-794.646) (-794.620) -- 0:01:33
      162500 -- (-797.266) (-806.884) [-796.067] (-795.152) * (-794.232) [-797.533] (-798.947) (-794.526) -- 0:01:32
      163000 -- (-800.275) [-796.555] (-791.743) (-798.007) * (-798.104) (-795.598) (-798.091) [-798.604] -- 0:01:32
      163500 -- [-800.766] (-800.214) (-801.707) (-799.985) * (-803.442) (-802.339) [-795.931] (-795.531) -- 0:01:32
      164000 -- (-796.752) (-799.500) [-801.587] (-796.677) * (-797.387) (-797.719) (-802.608) [-794.750] -- 0:01:36
      164500 -- (-791.440) (-799.129) (-799.153) [-799.009] * (-804.866) (-810.704) [-801.067] (-797.870) -- 0:01:36
      165000 -- (-793.542) (-814.226) [-795.860] (-802.325) * (-799.835) (-800.758) [-796.768] (-798.314) -- 0:01:36

      Average standard deviation of split frequencies: 0.011359

      165500 -- (-796.376) (-797.445) [-805.160] (-800.581) * (-804.977) (-797.545) (-800.394) [-797.107] -- 0:01:35
      166000 -- (-793.777) [-796.475] (-801.398) (-799.742) * (-805.631) (-794.429) (-796.867) [-793.559] -- 0:01:35
      166500 -- [-796.706] (-796.583) (-795.633) (-794.144) * (-800.523) (-795.887) (-796.563) [-795.420] -- 0:01:35
      167000 -- [-791.693] (-796.173) (-799.920) (-797.893) * (-797.439) (-797.812) (-795.334) [-799.280] -- 0:01:34
      167500 -- (-793.462) (-797.812) [-795.459] (-793.665) * (-794.038) [-798.054] (-794.514) (-799.740) -- 0:01:34
      168000 -- (-802.888) [-795.598] (-798.383) (-801.822) * (-802.586) [-798.846] (-794.811) (-796.006) -- 0:01:34
      168500 -- (-795.035) [-799.710] (-797.880) (-796.180) * [-795.972] (-801.261) (-796.619) (-792.815) -- 0:01:33
      169000 -- [-792.168] (-798.766) (-804.585) (-794.490) * (-796.207) [-791.482] (-806.657) (-792.414) -- 0:01:33
      169500 -- (-795.155) (-795.925) (-803.169) [-794.653] * (-800.353) [-798.950] (-798.905) (-799.390) -- 0:01:33
      170000 -- (-800.541) (-795.871) (-795.559) [-795.351] * (-800.799) (-803.305) (-794.323) [-792.275] -- 0:01:32

      Average standard deviation of split frequencies: 0.010496

      170500 -- (-790.581) (-798.524) [-801.562] (-796.244) * (-797.391) (-797.941) (-799.008) [-794.815] -- 0:01:32
      171000 -- [-792.016] (-793.558) (-802.956) (-795.882) * (-799.422) [-797.907] (-798.660) (-798.991) -- 0:01:32
      171500 -- (-803.079) [-795.266] (-794.548) (-798.129) * (-793.259) (-802.044) (-804.750) [-792.728] -- 0:01:31
      172000 -- (-794.061) (-799.279) [-794.018] (-793.399) * (-797.746) (-799.763) [-796.511] (-805.811) -- 0:01:31
      172500 -- (-795.588) [-798.268] (-805.100) (-799.751) * (-793.982) [-791.064] (-802.707) (-802.690) -- 0:01:31
      173000 -- (-795.981) [-798.696] (-803.540) (-793.094) * (-797.021) [-795.096] (-798.050) (-801.467) -- 0:01:35
      173500 -- (-797.182) (-791.082) [-794.059] (-802.615) * (-800.933) [-797.748] (-798.599) (-796.493) -- 0:01:35
      174000 -- (-798.680) [-794.973] (-794.539) (-800.064) * (-800.190) (-797.740) (-797.086) [-794.660] -- 0:01:34
      174500 -- (-807.064) (-799.402) [-798.162] (-794.047) * (-796.151) [-797.459] (-801.417) (-799.649) -- 0:01:34
      175000 -- (-794.897) (-803.076) [-793.586] (-794.835) * (-791.619) (-798.408) [-796.700] (-805.311) -- 0:01:34

      Average standard deviation of split frequencies: 0.010178

      175500 -- (-798.040) [-792.807] (-799.953) (-803.203) * (-801.697) (-793.375) [-793.643] (-805.945) -- 0:01:33
      176000 -- (-794.293) [-800.458] (-803.587) (-800.913) * (-796.976) [-797.934] (-797.802) (-800.860) -- 0:01:33
      176500 -- (-796.642) (-797.553) [-793.600] (-798.854) * (-795.264) (-802.677) (-799.890) [-796.096] -- 0:01:33
      177000 -- (-797.378) (-797.670) (-793.176) [-797.444] * [-797.639] (-795.879) (-801.038) (-798.637) -- 0:01:32
      177500 -- (-797.128) [-796.944] (-796.822) (-799.302) * (-808.402) (-798.647) (-798.580) [-797.601] -- 0:01:32
      178000 -- [-800.750] (-805.424) (-799.062) (-798.669) * (-800.214) (-794.963) [-794.263] (-797.854) -- 0:01:32
      178500 -- [-793.964] (-797.349) (-799.856) (-799.350) * (-797.526) [-800.958] (-798.696) (-804.504) -- 0:01:32
      179000 -- (-801.636) (-800.429) (-797.309) [-794.784] * (-797.430) (-802.977) (-795.306) [-794.290] -- 0:01:31
      179500 -- (-798.295) [-799.581] (-796.985) (-797.063) * [-804.575] (-801.221) (-804.606) (-795.532) -- 0:01:31
      180000 -- [-801.309] (-799.020) (-798.917) (-797.492) * (-804.183) [-794.180] (-795.243) (-810.149) -- 0:01:31

      Average standard deviation of split frequencies: 0.009393

      180500 -- (-805.246) (-797.254) (-808.042) [-799.554] * (-793.676) (-793.675) (-797.321) [-791.442] -- 0:01:30
      181000 -- (-800.272) [-801.336] (-794.299) (-796.831) * (-795.076) [-799.258] (-795.780) (-797.846) -- 0:01:30
      181500 -- [-794.076] (-810.213) (-796.541) (-801.131) * [-794.682] (-795.295) (-797.685) (-791.719) -- 0:01:30
      182000 -- (-793.425) [-801.018] (-793.909) (-804.408) * (-795.093) [-795.626] (-799.505) (-796.277) -- 0:01:34
      182500 -- (-797.792) [-800.377] (-797.148) (-799.814) * [-801.468] (-792.517) (-798.875) (-797.463) -- 0:01:34
      183000 -- (-794.752) (-796.518) (-800.833) [-796.651] * (-797.585) (-802.467) (-797.761) [-798.725] -- 0:01:33
      183500 -- (-794.095) [-795.151] (-792.244) (-795.410) * (-804.523) (-797.208) (-798.132) [-794.350] -- 0:01:33
      184000 -- (-803.045) [-795.064] (-795.272) (-801.374) * [-796.075] (-805.411) (-796.784) (-800.816) -- 0:01:33
      184500 -- (-793.907) (-798.160) (-800.611) [-794.329] * (-798.281) (-801.925) (-795.919) [-794.049] -- 0:01:32
      185000 -- (-796.539) (-807.942) (-798.992) [-797.676] * (-806.047) (-793.927) (-801.223) [-799.895] -- 0:01:32

      Average standard deviation of split frequencies: 0.012165

      185500 -- (-797.995) [-797.336] (-796.872) (-802.314) * (-793.269) (-798.037) [-795.002] (-799.794) -- 0:01:32
      186000 -- (-794.892) (-799.159) [-794.870] (-795.814) * [-793.777] (-803.335) (-803.950) (-796.022) -- 0:01:31
      186500 -- [-794.689] (-803.897) (-794.640) (-804.525) * [-793.686] (-797.594) (-796.346) (-803.957) -- 0:01:31
      187000 -- [-791.521] (-804.726) (-796.123) (-800.342) * (-796.439) (-795.390) [-797.232] (-796.736) -- 0:01:31
      187500 -- (-804.255) (-797.461) [-801.489] (-802.725) * (-801.792) (-797.502) [-790.712] (-799.818) -- 0:01:31
      188000 -- (-797.067) (-800.689) [-798.101] (-800.666) * (-803.350) (-809.838) [-800.224] (-798.840) -- 0:01:30
      188500 -- (-790.590) (-799.253) [-792.854] (-795.608) * (-806.013) (-794.912) (-796.747) [-798.261] -- 0:01:30
      189000 -- (-796.339) (-805.551) [-795.923] (-800.959) * (-797.649) (-796.430) [-796.486] (-796.400) -- 0:01:34
      189500 -- (-799.165) (-794.885) [-794.942] (-796.547) * (-797.560) (-796.416) (-795.525) [-797.702] -- 0:01:34
      190000 -- [-797.163] (-798.106) (-799.130) (-800.978) * (-808.193) (-802.853) (-794.935) [-797.175] -- 0:01:33

      Average standard deviation of split frequencies: 0.010879

      190500 -- (-792.163) (-799.487) [-798.121] (-800.496) * [-798.829] (-802.247) (-794.901) (-797.964) -- 0:01:33
      191000 -- (-799.993) (-796.325) [-798.011] (-800.569) * (-795.417) [-797.777] (-798.149) (-803.163) -- 0:01:33
      191500 -- (-796.171) (-798.083) [-795.746] (-792.094) * (-792.672) (-795.102) [-804.661] (-802.330) -- 0:01:32
      192000 -- [-798.534] (-800.181) (-794.295) (-797.020) * (-793.076) (-799.637) [-792.822] (-795.464) -- 0:01:32
      192500 -- (-799.343) [-800.795] (-797.090) (-796.470) * (-791.894) (-797.815) (-797.992) [-797.329] -- 0:01:32
      193000 -- (-799.716) (-794.292) [-797.070] (-798.343) * [-797.807] (-799.490) (-796.965) (-793.905) -- 0:01:31
      193500 -- (-799.099) [-795.012] (-794.094) (-800.995) * [-794.197] (-799.661) (-796.595) (-795.228) -- 0:01:31
      194000 -- (-807.073) (-794.880) (-794.609) [-799.093] * (-798.806) (-808.085) (-804.389) [-797.559] -- 0:01:31
      194500 -- (-801.633) (-798.523) [-798.349] (-802.971) * [-793.384] (-800.905) (-799.732) (-795.658) -- 0:01:31
      195000 -- (-799.836) [-796.146] (-796.784) (-800.522) * (-800.040) (-801.658) [-799.417] (-792.113) -- 0:01:30

      Average standard deviation of split frequencies: 0.008177

      195500 -- (-796.016) (-793.061) [-790.662] (-800.200) * (-798.902) (-796.102) [-795.606] (-795.945) -- 0:01:30
      196000 -- (-793.405) (-798.304) [-794.342] (-801.827) * (-798.308) [-796.139] (-803.254) (-795.079) -- 0:01:30
      196500 -- (-800.839) (-792.524) (-799.366) [-795.317] * (-797.721) (-797.865) (-797.920) [-799.160] -- 0:01:29
      197000 -- [-799.122] (-806.781) (-797.038) (-798.815) * [-793.729] (-792.971) (-801.187) (-800.650) -- 0:01:29
      197500 -- [-791.689] (-805.430) (-794.695) (-801.756) * (-793.635) [-797.185] (-805.276) (-807.697) -- 0:01:33
      198000 -- (-792.708) [-798.443] (-792.734) (-805.125) * (-797.777) (-794.617) (-800.404) [-798.860] -- 0:01:33
      198500 -- (-799.860) (-798.029) [-794.018] (-801.218) * (-794.367) [-796.675] (-793.503) (-797.502) -- 0:01:32
      199000 -- (-800.659) (-810.615) (-793.253) [-794.664] * (-796.402) (-798.902) [-793.947] (-807.782) -- 0:01:32
      199500 -- [-795.652] (-797.652) (-792.699) (-795.250) * (-794.109) (-791.426) [-797.216] (-795.665) -- 0:01:32
      200000 -- (-800.077) (-801.545) (-792.072) [-794.694] * [-798.244] (-797.067) (-797.655) (-800.759) -- 0:01:32

      Average standard deviation of split frequencies: 0.010806

      200500 -- (-798.022) (-792.481) (-797.854) [-793.626] * (-794.864) [-796.012] (-794.441) (-797.209) -- 0:01:31
      201000 -- (-804.380) (-800.024) [-798.685] (-800.571) * [-798.816] (-798.212) (-800.387) (-794.689) -- 0:01:31
      201500 -- (-797.242) (-801.309) (-797.978) [-796.449] * (-796.163) (-798.130) (-796.263) [-794.972] -- 0:01:31
      202000 -- [-795.960] (-808.628) (-796.768) (-799.805) * (-790.747) (-791.573) [-793.521] (-814.513) -- 0:01:30
      202500 -- (-802.208) (-799.492) [-791.910] (-795.192) * (-814.866) (-795.729) (-802.334) [-792.729] -- 0:01:30
      203000 -- (-799.596) [-798.859] (-796.339) (-810.706) * (-798.666) (-793.338) (-801.504) [-793.115] -- 0:01:30
      203500 -- [-798.860] (-794.640) (-791.418) (-801.108) * (-801.651) [-794.432] (-794.673) (-796.401) -- 0:01:30
      204000 -- [-798.734] (-797.917) (-795.939) (-800.485) * [-794.659] (-795.299) (-800.945) (-798.339) -- 0:01:29
      204500 -- [-800.892] (-797.602) (-800.644) (-796.459) * (-806.356) (-796.969) (-803.279) [-797.440] -- 0:01:29
      205000 -- (-797.903) (-805.266) [-793.799] (-796.263) * (-799.276) (-799.862) (-796.586) [-794.286] -- 0:01:29

      Average standard deviation of split frequencies: 0.010527

      205500 -- (-797.093) (-807.323) (-799.147) [-794.899] * (-800.666) (-796.878) (-801.240) [-794.746] -- 0:01:28
      206000 -- (-793.339) (-793.265) (-799.384) [-797.223] * [-794.719] (-799.264) (-797.817) (-797.039) -- 0:01:28
      206500 -- (-796.351) [-794.079] (-804.190) (-802.708) * (-795.021) (-801.190) [-801.085] (-801.097) -- 0:01:32
      207000 -- (-800.956) [-794.933] (-799.895) (-795.599) * [-798.387] (-800.282) (-803.458) (-798.354) -- 0:01:31
      207500 -- (-795.145) (-803.684) [-794.196] (-799.440) * (-792.613) (-799.253) (-794.630) [-802.288] -- 0:01:31
      208000 -- (-798.410) (-794.494) (-799.666) [-794.736] * (-795.995) [-800.400] (-797.149) (-809.409) -- 0:01:31
      208500 -- [-795.187] (-805.405) (-799.397) (-798.747) * (-801.805) (-797.800) (-800.707) [-801.741] -- 0:01:31
      209000 -- [-807.924] (-793.989) (-806.195) (-807.881) * [-797.497] (-801.543) (-808.318) (-794.986) -- 0:01:30
      209500 -- (-797.237) (-800.115) [-793.090] (-798.554) * (-794.242) (-802.122) (-806.277) [-791.527] -- 0:01:30
      210000 -- (-798.757) (-797.538) (-796.791) [-800.008] * (-795.718) (-799.910) (-800.716) [-795.091] -- 0:01:30

      Average standard deviation of split frequencies: 0.012531

      210500 -- (-805.204) [-795.269] (-800.514) (-794.245) * (-795.242) (-799.821) (-796.599) [-794.978] -- 0:01:30
      211000 -- (-801.429) [-794.503] (-802.650) (-794.175) * [-799.377] (-796.581) (-797.732) (-795.845) -- 0:01:29
      211500 -- (-802.610) (-795.129) [-793.931] (-796.514) * (-797.742) (-795.626) (-797.777) [-793.461] -- 0:01:29
      212000 -- [-796.559] (-797.531) (-798.731) (-789.641) * (-801.875) (-810.753) (-796.399) [-799.942] -- 0:01:29
      212500 -- (-796.288) (-807.236) (-799.437) [-800.939] * [-796.507] (-796.566) (-796.482) (-800.940) -- 0:01:28
      213000 -- (-796.140) (-794.623) (-795.841) [-792.656] * (-795.168) (-797.877) [-796.292] (-796.804) -- 0:01:28
      213500 -- [-790.465] (-794.292) (-799.072) (-796.235) * [-791.410] (-794.496) (-801.780) (-798.638) -- 0:01:28
      214000 -- (-804.143) [-796.962] (-800.022) (-794.630) * (-799.222) (-797.982) [-794.009] (-797.632) -- 0:01:28
      214500 -- (-800.119) (-797.779) [-795.154] (-794.485) * (-797.512) (-800.467) (-796.915) [-791.716] -- 0:01:27
      215000 -- (-792.161) (-803.292) (-799.048) [-791.810] * (-797.036) (-798.266) (-798.875) [-793.709] -- 0:01:27

      Average standard deviation of split frequencies: 0.013095

      215500 -- (-793.933) (-799.488) [-794.046] (-798.356) * (-798.194) [-794.458] (-797.816) (-790.366) -- 0:01:27
      216000 -- (-799.423) (-802.566) [-790.575] (-799.501) * (-796.851) (-792.272) [-794.877] (-804.329) -- 0:01:30
      216500 -- (-799.880) (-799.940) (-799.868) [-793.234] * [-795.236] (-796.820) (-797.498) (-796.703) -- 0:01:30
      217000 -- (-797.090) [-794.880] (-795.667) (-795.704) * (-796.007) (-793.711) [-793.817] (-793.977) -- 0:01:30
      217500 -- (-799.221) [-800.053] (-795.941) (-799.706) * (-797.766) (-794.286) [-794.760] (-795.350) -- 0:01:29
      218000 -- [-795.766] (-802.507) (-799.206) (-797.595) * [-794.410] (-794.476) (-795.594) (-796.570) -- 0:01:29
      218500 -- (-804.877) (-797.442) [-797.051] (-797.798) * [-797.533] (-797.525) (-793.020) (-797.329) -- 0:01:29
      219000 -- (-797.547) (-801.730) (-801.843) [-794.139] * (-795.091) [-795.519] (-800.442) (-806.805) -- 0:01:29
      219500 -- (-801.746) (-799.555) [-798.559] (-801.467) * (-795.747) (-791.314) [-794.618] (-799.807) -- 0:01:28
      220000 -- (-807.541) (-800.499) [-793.439] (-796.077) * (-797.270) [-795.423] (-797.188) (-802.760) -- 0:01:28

      Average standard deviation of split frequencies: 0.012390

      220500 -- (-801.321) (-804.429) [-798.318] (-796.484) * (-798.483) (-796.273) (-790.600) [-800.385] -- 0:01:28
      221000 -- (-808.674) (-793.757) [-792.710] (-799.796) * (-800.870) [-791.760] (-802.935) (-802.569) -- 0:01:28
      221500 -- (-801.676) (-803.941) (-798.128) [-799.965] * (-796.738) (-796.354) (-800.846) [-795.154] -- 0:01:27
      222000 -- (-799.908) (-800.351) [-794.507] (-799.786) * [-797.530] (-802.658) (-798.955) (-802.389) -- 0:01:27
      222500 -- [-792.564] (-797.173) (-796.546) (-799.092) * (-797.321) (-803.012) [-796.671] (-798.153) -- 0:01:27
      223000 -- [-801.586] (-800.670) (-795.147) (-794.135) * (-803.427) (-796.222) (-794.745) [-801.309] -- 0:01:27
      223500 -- (-812.904) [-797.134] (-803.889) (-792.807) * [-794.091] (-800.821) (-792.364) (-801.978) -- 0:01:26
      224000 -- (-803.823) (-803.222) (-807.615) [-798.951] * [-796.794] (-797.087) (-793.973) (-795.107) -- 0:01:26
      224500 -- (-799.666) [-799.438] (-800.387) (-798.938) * (-804.221) (-805.754) [-799.477] (-794.952) -- 0:01:26
      225000 -- [-795.893] (-795.852) (-794.804) (-796.360) * (-803.296) (-800.372) [-797.209] (-794.641) -- 0:01:29

      Average standard deviation of split frequencies: 0.011681

      225500 -- (-803.103) (-811.553) [-790.810] (-802.394) * (-800.014) (-801.308) (-797.511) [-798.667] -- 0:01:29
      226000 -- [-793.445] (-800.218) (-797.490) (-801.968) * (-805.015) (-798.633) (-796.257) [-790.494] -- 0:01:29
      226500 -- (-794.876) (-801.846) [-796.980] (-798.674) * (-798.101) [-793.780] (-794.268) (-800.457) -- 0:01:28
      227000 -- (-797.599) (-793.011) [-794.576] (-800.035) * (-797.528) (-796.283) (-796.310) [-797.778] -- 0:01:28
      227500 -- (-796.975) (-803.889) [-791.524] (-799.292) * (-803.182) (-796.131) [-793.506] (-794.615) -- 0:01:28
      228000 -- [-796.260] (-793.741) (-797.034) (-794.960) * (-798.825) (-796.218) (-798.050) [-794.507] -- 0:01:28
      228500 -- (-793.896) [-792.705] (-797.058) (-793.202) * (-800.208) (-796.555) (-795.487) [-797.924] -- 0:01:27
      229000 -- (-801.534) [-795.673] (-799.106) (-801.005) * (-799.397) [-793.305] (-802.749) (-798.003) -- 0:01:27
      229500 -- [-794.747] (-795.311) (-794.726) (-801.823) * (-807.361) (-803.389) [-793.981] (-796.924) -- 0:01:27
      230000 -- (-794.642) [-794.359] (-800.866) (-800.152) * [-805.359] (-797.768) (-802.487) (-806.319) -- 0:01:27

      Average standard deviation of split frequencies: 0.009401

      230500 -- [-795.265] (-792.797) (-800.029) (-794.341) * (-794.189) [-793.788] (-797.268) (-795.137) -- 0:01:26
      231000 -- [-798.375] (-796.970) (-796.617) (-797.023) * (-795.661) [-797.267] (-798.276) (-796.503) -- 0:01:26
      231500 -- (-792.902) [-795.763] (-798.429) (-793.898) * [-796.274] (-801.463) (-804.192) (-799.458) -- 0:01:26
      232000 -- (-794.311) [-794.532] (-798.386) (-798.567) * (-801.019) (-801.041) (-793.973) [-799.116] -- 0:01:26
      232500 -- (-796.398) (-801.006) [-799.316] (-799.120) * (-792.434) [-800.671] (-802.461) (-798.707) -- 0:01:25
      233000 -- (-795.802) (-794.482) (-798.665) [-797.626] * [-801.281] (-796.519) (-798.821) (-803.512) -- 0:01:25
      233500 -- (-797.825) (-793.637) (-804.621) [-803.906] * (-795.738) (-800.730) [-806.587] (-800.460) -- 0:01:25
      234000 -- (-800.398) (-799.587) [-796.676] (-797.690) * (-793.457) (-795.442) [-795.376] (-795.245) -- 0:01:28
      234500 -- (-799.728) [-801.360] (-795.432) (-795.703) * (-795.494) [-802.409] (-803.484) (-803.287) -- 0:01:28
      235000 -- (-795.957) (-796.770) [-797.072] (-797.924) * (-799.848) (-799.566) [-796.798] (-798.442) -- 0:01:27

      Average standard deviation of split frequencies: 0.008389

      235500 -- (-798.370) (-794.165) [-795.352] (-796.834) * (-793.435) [-795.891] (-807.337) (-794.765) -- 0:01:27
      236000 -- (-795.798) (-793.348) [-793.708] (-797.702) * [-797.227] (-795.040) (-795.663) (-795.169) -- 0:01:27
      236500 -- (-794.453) (-803.531) [-792.745] (-800.033) * (-792.574) [-793.507] (-799.903) (-797.611) -- 0:01:27
      237000 -- [-796.415] (-798.568) (-792.551) (-805.428) * (-799.737) [-792.888] (-803.643) (-797.906) -- 0:01:26
      237500 -- (-804.771) (-793.851) (-796.758) [-800.318] * [-795.997] (-799.881) (-799.231) (-796.373) -- 0:01:26
      238000 -- (-799.127) (-801.072) [-795.364] (-798.618) * [-794.639] (-803.095) (-802.750) (-797.584) -- 0:01:26
      238500 -- (-801.548) (-800.088) (-798.449) [-798.436] * (-792.470) (-795.259) [-799.506] (-800.656) -- 0:01:26
      239000 -- (-796.998) (-799.963) (-795.074) [-793.449] * (-795.874) (-794.143) [-794.708] (-800.059) -- 0:01:25
      239500 -- [-792.051] (-802.557) (-803.917) (-793.022) * [-797.332] (-800.466) (-802.728) (-802.658) -- 0:01:25
      240000 -- (-799.144) [-795.186] (-795.359) (-801.659) * (-794.154) (-801.090) [-797.356] (-801.247) -- 0:01:25

      Average standard deviation of split frequencies: 0.009010

      240500 -- (-803.084) (-796.331) (-797.945) [-796.650] * [-795.535] (-802.444) (-795.106) (-804.142) -- 0:01:25
      241000 -- (-801.432) (-795.034) (-796.586) [-797.820] * (-800.402) [-796.632] (-799.898) (-801.066) -- 0:01:25
      241500 -- [-794.735] (-796.481) (-792.977) (-796.825) * (-802.075) [-792.435] (-804.569) (-796.923) -- 0:01:24
      242000 -- (-799.106) (-795.734) (-800.666) [-796.779] * (-800.640) (-800.840) [-796.211] (-795.832) -- 0:01:24
      242500 -- (-792.108) (-801.616) (-800.914) [-796.386] * (-798.876) [-794.264] (-795.698) (-796.650) -- 0:01:24
      243000 -- (-797.018) [-795.819] (-795.236) (-802.514) * (-793.816) (-797.828) [-793.047] (-792.739) -- 0:01:27
      243500 -- (-799.307) [-802.796] (-802.623) (-798.022) * (-800.300) (-798.663) [-797.425] (-799.409) -- 0:01:26
      244000 -- (-800.701) (-796.134) (-798.083) [-800.277] * (-799.854) (-798.873) [-797.556] (-796.646) -- 0:01:26
      244500 -- (-795.107) [-800.167] (-801.779) (-794.029) * (-802.406) (-801.571) [-797.758] (-801.296) -- 0:01:26
      245000 -- [-793.837] (-794.608) (-795.216) (-808.422) * (-794.852) [-799.213] (-801.748) (-792.711) -- 0:01:26

      Average standard deviation of split frequencies: 0.009965

      245500 -- (-800.067) (-796.258) [-792.497] (-798.787) * [-793.704] (-797.745) (-799.569) (-797.730) -- 0:01:26
      246000 -- [-792.436] (-798.795) (-800.425) (-796.295) * (-800.578) [-799.667] (-803.220) (-796.354) -- 0:01:25
      246500 -- (-799.315) (-799.178) [-795.615] (-795.922) * (-799.683) (-794.969) (-794.157) [-796.272] -- 0:01:25
      247000 -- [-799.621] (-796.564) (-804.134) (-800.229) * (-796.477) (-800.019) (-800.893) [-800.279] -- 0:01:25
      247500 -- [-798.717] (-798.709) (-800.070) (-807.801) * [-798.663] (-796.975) (-798.179) (-801.198) -- 0:01:25
      248000 -- (-799.656) (-795.177) (-796.812) [-800.591] * (-803.314) (-796.648) (-796.242) [-792.003] -- 0:01:24
      248500 -- (-797.045) (-793.679) (-796.799) [-807.111] * [-795.167] (-797.466) (-801.906) (-797.607) -- 0:01:24
      249000 -- (-798.494) [-792.138] (-796.787) (-800.331) * (-803.540) (-797.919) (-798.287) [-795.977] -- 0:01:24
      249500 -- (-803.399) [-801.305] (-803.280) (-798.626) * [-792.535] (-796.898) (-801.380) (-800.162) -- 0:01:24
      250000 -- (-796.955) (-795.743) [-795.337] (-808.208) * (-798.660) (-796.927) [-798.886] (-797.861) -- 0:01:24

      Average standard deviation of split frequencies: 0.011660

      250500 -- (-797.814) (-797.726) [-808.755] (-798.617) * (-800.664) [-793.927] (-794.934) (-797.700) -- 0:01:23
      251000 -- (-798.915) [-793.533] (-801.494) (-799.891) * (-800.204) (-795.886) (-792.017) [-800.507] -- 0:01:23
      251500 -- (-791.616) (-794.613) (-801.158) [-795.513] * (-799.366) [-796.748] (-797.095) (-799.202) -- 0:01:23
      252000 -- (-798.298) (-797.925) (-796.599) [-797.333] * (-796.131) [-795.865] (-802.751) (-803.596) -- 0:01:26
      252500 -- (-805.793) (-800.095) (-795.003) [-798.079] * (-804.029) (-798.241) [-798.083] (-795.074) -- 0:01:25
      253000 -- (-799.975) (-795.386) (-799.034) [-794.449] * [-797.436] (-802.175) (-802.343) (-802.147) -- 0:01:25
      253500 -- (-795.246) [-796.779] (-796.077) (-800.176) * [-796.301] (-806.646) (-805.352) (-795.420) -- 0:01:25
      254000 -- (-807.886) [-794.047] (-800.416) (-795.502) * (-800.729) (-798.291) (-805.031) [-792.203] -- 0:01:25
      254500 -- (-795.299) (-801.456) (-805.980) [-797.613] * (-801.698) (-794.448) [-799.982] (-804.046) -- 0:01:24
      255000 -- [-798.690] (-806.523) (-798.707) (-795.239) * (-799.309) (-796.100) [-800.526] (-796.538) -- 0:01:24

      Average standard deviation of split frequencies: 0.011049

      255500 -- [-798.288] (-806.135) (-802.110) (-805.063) * (-797.359) (-797.679) [-797.766] (-798.934) -- 0:01:24
      256000 -- (-803.256) [-792.811] (-801.046) (-796.639) * [-793.302] (-800.181) (-798.940) (-793.791) -- 0:01:24
      256500 -- (-798.418) (-793.952) (-802.024) [-799.896] * (-797.553) [-796.626] (-802.439) (-794.598) -- 0:01:24
      257000 -- [-800.411] (-796.038) (-804.043) (-796.253) * (-796.969) [-797.350] (-802.480) (-795.615) -- 0:01:23
      257500 -- [-795.360] (-796.582) (-800.892) (-797.607) * (-796.337) (-799.146) [-797.206] (-806.122) -- 0:01:23
      258000 -- (-799.263) [-797.210] (-797.230) (-805.467) * [-801.867] (-799.171) (-797.911) (-791.779) -- 0:01:23
      258500 -- [-796.547] (-793.229) (-802.375) (-796.570) * [-796.080] (-798.476) (-796.520) (-800.502) -- 0:01:23
      259000 -- [-796.739] (-797.289) (-800.224) (-792.727) * (-795.785) (-808.314) (-793.741) [-792.901] -- 0:01:22
      259500 -- (-799.678) [-796.853] (-797.482) (-794.885) * (-793.872) (-801.443) [-794.766] (-800.018) -- 0:01:22
      260000 -- (-800.515) (-793.505) [-797.585] (-795.083) * (-809.977) (-798.443) [-804.784] (-791.995) -- 0:01:22

      Average standard deviation of split frequencies: 0.010851

      260500 -- (-797.871) (-794.311) (-800.222) [-803.843] * (-794.743) (-797.438) [-794.561] (-796.036) -- 0:01:22
      261000 -- [-794.916] (-800.203) (-801.847) (-798.679) * (-797.279) (-800.710) [-792.736] (-791.667) -- 0:01:24
      261500 -- (-803.345) (-795.094) [-792.175] (-795.839) * [-796.176] (-801.669) (-802.926) (-798.039) -- 0:01:24
      262000 -- (-800.175) (-800.154) (-792.967) [-792.438] * (-798.517) [-799.703] (-794.494) (-792.799) -- 0:01:24
      262500 -- (-796.985) (-800.956) [-793.709] (-796.487) * (-795.334) [-796.990] (-801.300) (-802.982) -- 0:01:24
      263000 -- (-797.608) (-801.616) (-795.504) [-795.274] * (-796.464) (-800.424) (-793.224) [-800.281] -- 0:01:24
      263500 -- (-803.602) [-797.098] (-793.749) (-793.724) * [-798.324] (-803.375) (-796.371) (-796.143) -- 0:01:23
      264000 -- (-799.461) [-793.407] (-802.262) (-800.252) * [-799.078] (-799.948) (-802.569) (-799.188) -- 0:01:23
      264500 -- (-794.153) [-797.262] (-793.844) (-797.981) * (-795.799) (-793.781) [-793.394] (-793.459) -- 0:01:23
      265000 -- [-797.452] (-793.571) (-795.290) (-803.586) * (-795.105) [-794.081] (-796.491) (-801.505) -- 0:01:23

      Average standard deviation of split frequencies: 0.010988

      265500 -- (-802.521) [-799.896] (-794.786) (-808.143) * (-800.706) (-799.924) (-800.171) [-791.440] -- 0:01:22
      266000 -- (-801.087) [-789.957] (-790.368) (-796.058) * (-810.000) [-794.324] (-801.234) (-800.611) -- 0:01:22
      266500 -- (-802.666) (-801.428) [-790.398] (-800.272) * (-805.956) [-795.449] (-808.150) (-791.958) -- 0:01:22
      267000 -- (-802.778) [-795.533] (-789.451) (-807.284) * [-794.280] (-793.709) (-802.632) (-798.039) -- 0:01:22
      267500 -- (-801.015) (-797.563) (-803.007) [-797.456] * (-795.066) (-803.996) (-799.711) [-802.274] -- 0:01:22
      268000 -- (-805.460) [-793.574] (-794.137) (-804.668) * (-800.921) [-799.256] (-803.446) (-799.631) -- 0:01:21
      268500 -- [-806.536] (-800.957) (-795.574) (-801.929) * (-794.296) (-796.830) [-797.930] (-793.354) -- 0:01:21
      269000 -- (-796.751) [-794.333] (-795.914) (-798.270) * (-802.887) (-796.248) (-793.474) [-796.292] -- 0:01:21
      269500 -- (-796.731) [-793.925] (-793.338) (-796.036) * (-794.552) (-804.923) [-796.498] (-807.821) -- 0:01:21
      270000 -- (-802.827) (-800.294) (-795.162) [-796.742] * (-798.259) (-796.267) [-795.019] (-799.713) -- 0:01:23

      Average standard deviation of split frequencies: 0.009753

      270500 -- (-799.385) (-794.686) (-804.753) [-795.267] * (-799.108) (-793.126) [-797.859] (-799.052) -- 0:01:23
      271000 -- (-795.140) [-801.863] (-799.637) (-792.538) * [-796.930] (-797.189) (-803.590) (-794.624) -- 0:01:23
      271500 -- (-794.957) (-802.974) (-800.886) [-797.923] * (-796.413) (-796.215) [-799.128] (-797.231) -- 0:01:23
      272000 -- (-803.246) (-799.015) [-796.231] (-794.316) * (-798.375) [-798.095] (-800.560) (-799.007) -- 0:01:22
      272500 -- (-799.687) (-797.175) (-792.858) [-799.714] * (-799.102) (-812.577) (-793.607) [-799.740] -- 0:01:22
      273000 -- [-800.681] (-796.800) (-799.333) (-799.756) * [-798.527] (-806.037) (-800.916) (-800.427) -- 0:01:22
      273500 -- (-793.573) (-796.305) (-797.458) [-802.145] * [-795.644] (-795.590) (-798.679) (-800.805) -- 0:01:22
      274000 -- [-796.561] (-796.334) (-794.344) (-795.670) * (-796.277) [-798.513] (-808.205) (-802.464) -- 0:01:22
      274500 -- (-801.069) (-800.948) [-797.725] (-795.874) * (-805.624) (-802.723) (-798.286) [-796.787] -- 0:01:21
      275000 -- [-797.559] (-793.306) (-801.287) (-797.032) * (-799.837) [-795.660] (-811.393) (-799.577) -- 0:01:21

      Average standard deviation of split frequencies: 0.010248

      275500 -- [-801.190] (-800.764) (-797.305) (-794.899) * [-796.103] (-804.609) (-796.836) (-801.201) -- 0:01:21
      276000 -- (-800.785) [-798.077] (-797.403) (-803.143) * [-798.921] (-798.333) (-802.289) (-796.333) -- 0:01:21
      276500 -- (-798.225) (-805.367) [-795.226] (-797.891) * [-791.158] (-801.808) (-792.692) (-802.082) -- 0:01:21
      277000 -- (-796.567) (-799.655) [-796.773] (-797.627) * (-796.588) (-800.509) (-797.552) [-796.916] -- 0:01:20
      277500 -- (-798.321) (-801.127) (-794.980) [-793.200] * (-796.407) (-798.275) (-799.718) [-798.311] -- 0:01:20
      278000 -- (-798.210) [-796.555] (-795.857) (-799.185) * [-800.588] (-796.759) (-798.016) (-800.712) -- 0:01:20
      278500 -- [-793.143] (-803.675) (-801.125) (-792.065) * (-804.495) (-798.376) [-797.709] (-795.155) -- 0:01:22
      279000 -- [-792.770] (-801.761) (-798.041) (-799.993) * [-800.618] (-795.202) (-798.337) (-799.732) -- 0:01:22
      279500 -- [-795.391] (-793.251) (-796.271) (-795.195) * (-793.218) [-796.948] (-793.330) (-793.416) -- 0:01:22
      280000 -- [-795.663] (-798.543) (-797.270) (-799.078) * [-796.008] (-797.750) (-803.988) (-801.102) -- 0:01:22

      Average standard deviation of split frequencies: 0.009070

      280500 -- (-802.345) (-797.010) [-799.516] (-794.876) * (-797.123) (-799.362) [-796.016] (-795.502) -- 0:01:22
      281000 -- (-799.846) [-798.171] (-796.953) (-794.755) * (-795.681) [-798.251] (-800.931) (-799.707) -- 0:01:21
      281500 -- (-800.166) (-802.417) (-800.214) [-797.108] * (-808.135) (-805.541) (-795.765) [-798.761] -- 0:01:21
      282000 -- [-793.574] (-796.759) (-796.118) (-799.566) * (-800.704) [-800.403] (-795.632) (-800.048) -- 0:01:21
      282500 -- (-795.258) [-798.645] (-794.875) (-802.384) * [-790.692] (-795.228) (-804.865) (-797.271) -- 0:01:21
      283000 -- (-805.945) (-804.559) [-797.779] (-794.684) * (-799.034) [-797.988] (-804.128) (-799.121) -- 0:01:21
      283500 -- (-798.926) (-802.986) [-798.205] (-798.414) * [-805.035] (-800.421) (-799.569) (-808.523) -- 0:01:20
      284000 -- [-794.334] (-800.495) (-791.625) (-802.163) * (-799.258) (-800.092) [-803.950] (-801.307) -- 0:01:20
      284500 -- (-806.492) (-792.832) [-799.061] (-795.454) * [-796.054] (-796.913) (-798.048) (-805.064) -- 0:01:20
      285000 -- (-797.578) (-797.572) [-797.821] (-799.430) * (-796.104) (-800.702) (-799.258) [-794.982] -- 0:01:20

      Average standard deviation of split frequencies: 0.009230

      285500 -- [-794.868] (-798.674) (-798.457) (-801.645) * [-793.617] (-802.622) (-798.601) (-799.309) -- 0:01:20
      286000 -- (-798.442) [-793.867] (-798.480) (-800.374) * (-796.443) (-797.786) (-797.426) [-797.030] -- 0:01:19
      286500 -- (-796.922) (-795.686) (-794.720) [-793.779] * (-802.540) (-798.913) [-792.263] (-801.501) -- 0:01:19
      287000 -- (-800.076) (-799.287) [-794.113] (-800.388) * (-799.027) [-794.798] (-793.622) (-802.279) -- 0:01:19
      287500 -- (-794.573) [-792.911] (-796.601) (-805.024) * [-801.400] (-799.160) (-798.400) (-797.852) -- 0:01:21
      288000 -- (-801.893) (-795.689) (-795.353) [-804.661] * (-795.435) (-795.252) (-798.218) [-795.759] -- 0:01:21
      288500 -- [-794.834] (-802.587) (-795.214) (-801.390) * (-793.764) (-802.498) (-795.073) [-798.703] -- 0:01:21
      289000 -- (-799.213) (-801.699) [-798.445] (-807.023) * (-794.082) [-797.989] (-793.942) (-792.734) -- 0:01:21
      289500 -- [-798.900] (-799.693) (-801.585) (-806.608) * (-792.569) (-801.747) (-802.550) [-794.717] -- 0:01:20
      290000 -- (-794.584) [-799.062] (-793.506) (-799.281) * [-797.437] (-795.375) (-807.601) (-797.146) -- 0:01:20

      Average standard deviation of split frequencies: 0.008758

      290500 -- (-797.449) [-795.299] (-798.496) (-796.938) * (-800.787) (-800.111) [-794.509] (-800.172) -- 0:01:20
      291000 -- (-799.630) (-793.912) (-805.533) [-791.443] * (-797.292) (-796.242) [-793.858] (-798.557) -- 0:01:20
      291500 -- [-797.196] (-794.936) (-799.033) (-796.496) * [-791.859] (-799.945) (-801.724) (-791.526) -- 0:01:20
      292000 -- (-795.664) (-794.551) [-799.376] (-807.194) * [-794.554] (-803.478) (-796.910) (-797.155) -- 0:01:20
      292500 -- [-794.902] (-797.586) (-796.855) (-806.115) * (-808.537) [-797.065] (-802.312) (-794.029) -- 0:01:19
      293000 -- (-794.722) (-802.884) (-791.543) [-794.999] * [-800.694] (-801.853) (-797.685) (-796.852) -- 0:01:19
      293500 -- (-798.951) (-801.411) [-794.340] (-797.204) * (-796.247) (-797.678) [-797.458] (-794.689) -- 0:01:19
      294000 -- (-793.855) (-802.025) (-796.437) [-792.054] * (-791.508) [-794.828] (-792.949) (-806.373) -- 0:01:19
      294500 -- [-798.877] (-795.421) (-803.433) (-794.685) * (-797.829) [-800.337] (-797.553) (-793.247) -- 0:01:19
      295000 -- [-795.351] (-798.202) (-803.574) (-792.860) * (-798.597) [-798.057] (-805.057) (-799.037) -- 0:01:18

      Average standard deviation of split frequencies: 0.008918

      295500 -- (-797.534) [-796.299] (-801.795) (-797.935) * (-797.755) [-796.320] (-797.921) (-796.378) -- 0:01:18
      296000 -- (-797.075) (-797.589) [-796.203] (-802.549) * (-797.765) (-799.341) (-804.138) [-793.519] -- 0:01:18
      296500 -- (-796.081) (-796.976) (-796.279) [-795.070] * (-795.082) [-797.589] (-798.545) (-799.880) -- 0:01:20
      297000 -- [-795.180] (-797.363) (-793.315) (-794.479) * [-796.809] (-797.440) (-796.677) (-798.439) -- 0:01:20
      297500 -- (-795.414) (-800.447) [-795.294] (-797.859) * (-799.933) (-801.565) [-792.664] (-796.290) -- 0:01:20
      298000 -- (-793.227) (-795.349) [-792.775] (-798.361) * (-796.045) (-801.306) [-795.840] (-791.340) -- 0:01:20
      298500 -- [-802.539] (-796.008) (-794.376) (-798.405) * (-798.081) [-793.961] (-806.609) (-802.204) -- 0:01:19
      299000 -- [-794.305] (-801.424) (-795.016) (-801.152) * (-799.973) [-795.844] (-799.585) (-798.842) -- 0:01:19
      299500 -- [-793.641] (-797.370) (-795.762) (-802.943) * (-797.231) [-796.423] (-795.366) (-800.536) -- 0:01:19
      300000 -- (-792.898) (-796.307) [-792.504] (-797.982) * [-791.537] (-795.713) (-799.780) (-807.014) -- 0:01:19

      Average standard deviation of split frequencies: 0.009094

      300500 -- (-793.963) (-800.387) (-804.694) [-792.783] * [-795.075] (-795.627) (-801.262) (-810.021) -- 0:01:19
      301000 -- (-804.096) [-797.211] (-798.525) (-793.247) * (-798.160) (-797.933) (-800.554) [-795.726] -- 0:01:18
      301500 -- (-803.971) (-801.660) (-796.247) [-795.953] * (-796.945) (-794.132) [-794.759] (-796.402) -- 0:01:18
      302000 -- (-798.413) (-794.719) (-798.584) [-793.163] * (-795.383) [-798.049] (-797.876) (-804.164) -- 0:01:18
      302500 -- (-805.188) (-799.543) [-794.926] (-794.081) * (-795.655) [-796.696] (-802.069) (-799.636) -- 0:01:18
      303000 -- (-797.541) [-809.064] (-804.079) (-797.735) * [-800.775] (-796.216) (-807.018) (-794.626) -- 0:01:18
      303500 -- (-800.661) (-805.683) (-800.414) [-795.533] * [-796.954] (-792.562) (-792.840) (-794.317) -- 0:01:18
      304000 -- (-805.025) (-799.207) (-794.547) [-797.594] * (-801.256) (-792.738) [-799.326] (-797.772) -- 0:01:17
      304500 -- (-795.645) (-800.892) [-795.177] (-799.539) * [-794.270] (-798.387) (-795.209) (-799.155) -- 0:01:17
      305000 -- (-803.692) (-801.307) [-794.630] (-798.811) * [-796.598] (-798.729) (-806.370) (-798.488) -- 0:01:17

      Average standard deviation of split frequencies: 0.009859

      305500 -- (-799.775) (-800.214) [-793.636] (-797.613) * (-800.384) [-794.104] (-798.266) (-797.552) -- 0:01:19
      306000 -- (-797.935) (-798.561) [-800.417] (-797.271) * (-800.388) [-792.366] (-807.328) (-796.094) -- 0:01:19
      306500 -- (-799.227) (-803.192) [-798.061] (-797.579) * [-792.873] (-798.408) (-799.945) (-794.799) -- 0:01:19
      307000 -- (-797.922) (-794.579) (-798.181) [-801.358] * [-796.299] (-797.450) (-799.923) (-797.114) -- 0:01:19
      307500 -- (-794.481) [-795.689] (-795.802) (-796.719) * (-795.781) (-798.565) (-798.247) [-794.790] -- 0:01:18
      308000 -- [-796.326] (-801.594) (-805.936) (-798.561) * (-792.909) (-798.045) (-794.252) [-791.918] -- 0:01:18
      308500 -- (-801.537) (-795.382) [-800.861] (-796.393) * (-800.494) (-797.310) (-797.572) [-792.005] -- 0:01:18
      309000 -- (-799.354) [-794.589] (-796.100) (-799.548) * (-802.725) (-794.633) [-796.504] (-794.386) -- 0:01:18
      309500 -- (-803.978) (-799.399) (-800.784) [-793.373] * (-798.155) [-792.011] (-800.792) (-802.686) -- 0:01:18
      310000 -- (-800.718) (-802.375) [-800.818] (-800.739) * (-795.196) (-791.547) (-797.114) [-795.242] -- 0:01:17

      Average standard deviation of split frequencies: 0.010925

      310500 -- [-800.509] (-793.980) (-798.370) (-796.317) * [-794.487] (-797.085) (-794.424) (-804.185) -- 0:01:17
      311000 -- (-800.342) (-801.027) [-795.723] (-797.655) * (-798.114) (-800.065) [-795.480] (-797.753) -- 0:01:17
      311500 -- (-803.034) (-806.619) [-795.360] (-793.508) * (-804.637) (-806.120) [-795.981] (-795.504) -- 0:01:17
      312000 -- (-798.199) (-797.256) (-796.398) [-800.325] * (-797.894) [-793.899] (-796.340) (-798.777) -- 0:01:17
      312500 -- (-794.233) (-803.325) (-797.243) [-793.980] * (-806.515) [-790.315] (-798.455) (-794.980) -- 0:01:17
      313000 -- (-794.290) (-796.209) [-796.688] (-799.736) * (-800.221) (-798.592) [-794.884] (-794.344) -- 0:01:16
      313500 -- (-793.516) (-800.650) [-799.834] (-808.687) * (-796.416) (-803.561) [-798.445] (-795.665) -- 0:01:16
      314000 -- (-800.048) [-792.067] (-801.532) (-796.329) * [-798.871] (-796.893) (-796.196) (-795.926) -- 0:01:16
      314500 -- (-798.899) (-797.164) [-795.541] (-793.803) * (-797.417) (-798.371) [-797.226] (-798.999) -- 0:01:18
      315000 -- [-796.138] (-795.589) (-796.759) (-793.803) * (-799.157) (-796.520) (-791.613) [-797.620] -- 0:01:18

      Average standard deviation of split frequencies: 0.012531

      315500 -- (-796.103) (-797.287) (-797.803) [-801.597] * [-792.316] (-797.404) (-796.861) (-795.264) -- 0:01:18
      316000 -- (-797.180) (-798.115) [-797.499] (-798.562) * (-802.505) (-797.194) (-803.750) [-803.439] -- 0:01:17
      316500 -- (-797.906) (-807.766) [-797.694] (-799.316) * [-796.876] (-801.056) (-795.714) (-801.112) -- 0:01:17
      317000 -- (-795.891) (-799.132) [-793.984] (-802.681) * (-799.679) (-805.313) (-801.804) [-792.902] -- 0:01:17
      317500 -- (-800.398) (-798.497) (-792.608) [-796.225] * (-804.956) (-800.476) (-792.200) [-794.767] -- 0:01:17
      318000 -- (-800.439) (-797.294) (-792.354) [-803.612] * (-799.192) (-800.425) [-796.349] (-799.600) -- 0:01:17
      318500 -- (-799.639) (-799.942) (-799.709) [-800.152] * (-795.739) [-794.953] (-799.033) (-797.378) -- 0:01:17
      319000 -- (-797.553) (-796.361) (-794.973) [-798.353] * [-793.433] (-795.211) (-796.759) (-804.224) -- 0:01:16
      319500 -- (-793.159) (-796.008) [-796.894] (-798.702) * (-793.766) [-793.283] (-796.550) (-802.089) -- 0:01:16
      320000 -- (-798.022) (-802.855) (-798.469) [-798.643] * (-797.166) (-794.703) [-794.426] (-797.161) -- 0:01:16

      Average standard deviation of split frequencies: 0.010585

      320500 -- (-803.459) [-792.784] (-797.920) (-800.722) * (-807.855) (-800.746) (-800.326) [-792.656] -- 0:01:16
      321000 -- (-797.051) [-794.812] (-797.465) (-800.528) * (-797.631) [-794.193] (-795.310) (-805.475) -- 0:01:16
      321500 -- (-799.219) (-798.167) [-796.465] (-795.766) * (-798.215) (-803.723) (-796.013) [-795.722] -- 0:01:15
      322000 -- (-796.922) [-795.117] (-795.823) (-797.645) * (-795.044) [-799.633] (-795.652) (-798.289) -- 0:01:15
      322500 -- (-795.169) [-794.986] (-799.730) (-795.722) * (-803.198) [-796.452] (-794.416) (-798.150) -- 0:01:15
      323000 -- (-791.374) (-795.137) [-798.168] (-801.623) * (-798.833) (-798.383) (-789.710) [-796.553] -- 0:01:15
      323500 -- [-795.545] (-795.110) (-799.025) (-798.653) * (-798.653) (-796.083) (-801.931) [-794.015] -- 0:01:17
      324000 -- [-790.677] (-797.352) (-800.251) (-799.308) * (-805.093) (-797.009) (-795.128) [-794.063] -- 0:01:17
      324500 -- (-798.973) [-808.459] (-804.799) (-800.130) * (-798.346) (-797.206) (-795.855) [-792.889] -- 0:01:17
      325000 -- (-805.032) (-795.237) (-804.531) [-795.635] * [-801.285] (-797.945) (-796.792) (-806.630) -- 0:01:16

      Average standard deviation of split frequencies: 0.010701

      325500 -- (-801.624) [-798.066] (-801.443) (-807.552) * [-797.124] (-792.445) (-800.838) (-806.135) -- 0:01:16
      326000 -- [-791.667] (-791.722) (-795.110) (-795.935) * [-799.401] (-798.905) (-802.249) (-805.466) -- 0:01:16
      326500 -- (-795.152) (-795.509) (-799.155) [-796.162] * (-801.614) (-794.787) [-795.570] (-797.332) -- 0:01:16
      327000 -- [-800.889] (-799.667) (-792.939) (-793.791) * (-797.756) (-791.654) [-794.337] (-803.760) -- 0:01:16
      327500 -- (-796.225) (-795.683) (-797.804) [-795.966] * (-794.678) (-801.067) [-794.231] (-798.993) -- 0:01:15
      328000 -- (-799.368) (-797.486) (-804.052) [-793.949] * (-794.190) [-805.646] (-798.897) (-797.033) -- 0:01:15
      328500 -- [-798.569] (-799.404) (-802.163) (-793.426) * [-795.451] (-804.779) (-803.315) (-801.167) -- 0:01:15
      329000 -- (-791.615) (-800.335) [-792.186] (-794.250) * (-793.757) (-800.707) (-794.246) [-800.045] -- 0:01:15
      329500 -- [-798.649] (-795.879) (-802.367) (-792.093) * (-799.440) [-803.467] (-802.660) (-795.407) -- 0:01:15
      330000 -- (-799.558) (-798.983) (-805.877) [-795.874] * (-795.326) (-796.281) [-797.876] (-799.490) -- 0:01:15

      Average standard deviation of split frequencies: 0.012831

      330500 -- (-794.076) (-796.583) (-804.540) [-795.492] * (-800.530) (-799.064) (-800.667) [-799.533] -- 0:01:14
      331000 -- (-797.164) (-800.943) (-796.951) [-797.968] * (-801.935) (-799.903) [-798.094] (-796.548) -- 0:01:14
      331500 -- (-802.721) (-798.864) [-795.072] (-802.711) * (-793.760) [-799.413] (-799.062) (-807.090) -- 0:01:14
      332000 -- [-796.824] (-796.464) (-805.036) (-795.003) * (-802.649) [-799.646] (-800.955) (-796.932) -- 0:01:14
      332500 -- [-797.862] (-797.496) (-801.607) (-795.967) * (-794.259) [-796.737] (-803.386) (-793.209) -- 0:01:16
      333000 -- (-798.702) (-795.890) (-804.333) [-797.362] * (-796.566) (-794.623) [-798.844] (-796.377) -- 0:01:16
      333500 -- (-795.823) (-799.403) [-797.116] (-792.510) * (-799.740) (-800.716) (-802.158) [-798.400] -- 0:01:15
      334000 -- (-804.075) (-799.880) [-797.052] (-797.330) * (-799.286) (-802.408) [-799.661] (-794.964) -- 0:01:15
      334500 -- [-803.195] (-798.147) (-797.147) (-801.455) * (-803.779) (-800.558) [-798.113] (-794.963) -- 0:01:15
      335000 -- (-800.507) (-795.498) [-796.932] (-798.235) * (-797.899) (-801.701) [-799.921] (-797.077) -- 0:01:15

      Average standard deviation of split frequencies: 0.012627

      335500 -- (-797.411) (-799.203) [-799.261] (-796.412) * (-796.075) [-796.166] (-796.124) (-799.915) -- 0:01:15
      336000 -- (-800.236) [-795.390] (-801.821) (-800.509) * (-792.981) (-805.737) [-795.360] (-793.763) -- 0:01:15
      336500 -- (-801.490) [-800.629] (-798.345) (-794.682) * (-793.668) [-798.251] (-795.157) (-801.029) -- 0:01:14
      337000 -- (-798.688) (-799.817) [-801.483] (-801.511) * (-801.386) (-803.972) [-799.082] (-800.021) -- 0:01:14
      337500 -- (-800.971) (-795.188) (-802.576) [-800.636] * (-800.584) (-792.497) [-799.973] (-797.807) -- 0:01:14
      338000 -- (-799.213) (-796.990) [-802.170] (-793.311) * [-794.495] (-799.566) (-800.450) (-797.070) -- 0:01:14
      338500 -- (-798.236) [-795.677] (-793.242) (-796.376) * (-803.693) (-798.274) (-796.561) [-794.764] -- 0:01:14
      339000 -- (-802.235) (-801.530) [-793.062] (-793.808) * [-794.472] (-802.772) (-796.179) (-794.741) -- 0:01:14
      339500 -- (-797.456) (-796.227) (-797.956) [-795.723] * (-797.249) [-796.543] (-797.972) (-794.268) -- 0:01:13
      340000 -- (-804.148) (-795.758) (-804.482) [-790.204] * (-800.100) (-792.346) [-797.615] (-795.821) -- 0:01:13

      Average standard deviation of split frequencies: 0.010517

      340500 -- (-800.027) (-799.839) (-803.286) [-791.255] * (-795.298) [-801.936] (-800.017) (-796.724) -- 0:01:13
      341000 -- (-796.212) (-799.068) (-796.227) [-792.227] * [-791.320] (-794.583) (-797.764) (-797.844) -- 0:01:13
      341500 -- [-793.201] (-801.227) (-804.173) (-795.657) * (-795.039) (-802.164) [-801.658] (-795.180) -- 0:01:15
      342000 -- (-797.501) (-799.588) (-801.555) [-797.365] * [-796.356] (-794.372) (-798.265) (-794.440) -- 0:01:15
      342500 -- (-803.140) (-802.021) [-800.625] (-796.275) * (-794.766) [-803.599] (-796.039) (-797.543) -- 0:01:14
      343000 -- (-798.236) (-799.671) [-800.210] (-798.809) * (-792.779) [-799.062] (-795.786) (-802.960) -- 0:01:14
      343500 -- [-797.613] (-796.129) (-796.309) (-797.288) * (-792.313) (-798.148) (-798.410) [-798.434] -- 0:01:14
      344000 -- [-794.837] (-800.066) (-797.664) (-798.428) * (-806.500) (-802.651) [-795.356] (-795.729) -- 0:01:14
      344500 -- (-793.039) [-793.461] (-800.714) (-795.956) * (-798.725) [-792.477] (-795.452) (-794.293) -- 0:01:14
      345000 -- (-801.552) (-799.308) (-808.854) [-799.185] * (-796.020) [-798.012] (-798.409) (-796.810) -- 0:01:14

      Average standard deviation of split frequencies: 0.011445

      345500 -- [-800.278] (-795.532) (-799.501) (-802.171) * (-798.294) [-799.536] (-801.365) (-797.880) -- 0:01:13
      346000 -- (-808.649) (-800.034) (-800.795) [-799.152] * (-796.718) (-795.328) (-801.045) [-793.983] -- 0:01:13
      346500 -- (-801.432) (-806.087) [-798.382] (-797.784) * [-799.043] (-801.365) (-796.015) (-794.306) -- 0:01:13
      347000 -- (-800.065) [-796.691] (-801.763) (-792.141) * (-804.330) (-800.383) [-794.230] (-795.124) -- 0:01:13
      347500 -- [-793.525] (-798.547) (-798.245) (-797.265) * (-794.118) [-795.810] (-805.627) (-798.625) -- 0:01:13
      348000 -- (-800.621) (-801.728) (-796.393) [-802.139] * (-797.029) (-800.077) (-796.875) [-797.088] -- 0:01:13
      348500 -- [-792.778] (-796.935) (-798.017) (-798.357) * [-793.200] (-796.350) (-795.841) (-800.430) -- 0:01:12
      349000 -- [-799.563] (-797.467) (-794.011) (-791.439) * (-794.642) [-797.920] (-795.429) (-794.620) -- 0:01:12
      349500 -- (-801.454) (-799.965) [-794.594] (-796.462) * (-798.908) [-792.875] (-801.356) (-794.811) -- 0:01:12
      350000 -- (-795.289) (-799.557) [-795.847] (-802.338) * (-808.844) (-799.588) (-801.132) [-792.182] -- 0:01:12

      Average standard deviation of split frequencies: 0.011830

      350500 -- (-799.578) (-802.195) (-801.654) [-801.421] * (-801.866) (-797.786) (-798.926) [-794.662] -- 0:01:14
      351000 -- (-799.716) (-805.378) [-796.689] (-806.243) * [-796.824] (-801.064) (-795.763) (-794.753) -- 0:01:13
      351500 -- (-798.253) (-801.182) [-794.350] (-800.216) * (-796.049) (-794.872) (-804.389) [-799.098] -- 0:01:13
      352000 -- (-797.926) [-794.125] (-794.206) (-797.751) * [-793.069] (-796.805) (-797.703) (-800.154) -- 0:01:13
      352500 -- (-804.842) (-802.565) (-799.116) [-793.986] * (-798.104) (-795.145) [-796.311] (-798.915) -- 0:01:13
      353000 -- (-799.873) (-801.357) (-803.539) [-797.638] * [-789.845] (-796.356) (-798.325) (-799.840) -- 0:01:13
      353500 -- (-801.086) [-803.429] (-803.578) (-795.190) * (-794.472) (-799.125) (-805.107) [-794.615] -- 0:01:13
      354000 -- [-799.447] (-800.965) (-796.481) (-796.797) * [-791.119] (-801.054) (-798.694) (-796.259) -- 0:01:12
      354500 -- (-796.258) [-795.852] (-804.449) (-792.295) * (-795.721) (-797.458) [-797.671] (-796.405) -- 0:01:12
      355000 -- (-799.030) (-802.545) (-795.700) [-797.096] * (-795.293) (-796.359) (-799.032) [-797.459] -- 0:01:12

      Average standard deviation of split frequencies: 0.012447

      355500 -- [-799.692] (-809.849) (-800.773) (-795.050) * (-797.373) (-794.238) (-799.304) [-795.458] -- 0:01:12
      356000 -- [-796.543] (-805.121) (-799.002) (-800.151) * (-798.483) (-795.344) (-800.049) [-795.928] -- 0:01:12
      356500 -- (-803.816) [-797.076] (-800.193) (-793.380) * (-801.661) (-793.498) (-797.526) [-795.573] -- 0:01:12
      357000 -- (-798.366) (-792.331) (-793.722) [-800.403] * [-794.113] (-799.738) (-797.027) (-795.255) -- 0:01:12
      357500 -- (-794.159) (-807.786) (-797.827) [-793.856] * (-798.459) (-793.324) [-793.847] (-799.610) -- 0:01:11
      358000 -- (-791.972) [-795.806] (-798.309) (-796.689) * [-797.357] (-796.319) (-799.402) (-794.259) -- 0:01:11
      358500 -- [-795.109] (-810.392) (-796.608) (-795.345) * (-800.069) (-801.483) [-797.530] (-803.702) -- 0:01:11
      359000 -- [-797.840] (-799.665) (-800.522) (-794.928) * [-792.789] (-798.563) (-797.253) (-797.768) -- 0:01:11
      359500 -- [-793.674] (-799.677) (-797.627) (-801.457) * (-794.642) (-806.727) (-796.413) [-794.920] -- 0:01:11
      360000 -- (-798.040) [-797.015] (-796.073) (-800.247) * [-795.570] (-800.129) (-794.741) (-793.961) -- 0:01:12

      Average standard deviation of split frequencies: 0.013070

      360500 -- [-798.945] (-796.028) (-801.888) (-797.931) * [-796.176] (-797.837) (-801.212) (-791.548) -- 0:01:12
      361000 -- (-798.681) (-813.042) [-795.939] (-800.050) * (-792.426) (-794.118) [-794.645] (-801.149) -- 0:01:12
      361500 -- [-796.962] (-791.309) (-805.347) (-800.220) * (-801.642) [-793.310] (-794.809) (-792.993) -- 0:01:12
      362000 -- (-796.246) (-806.104) (-798.698) [-797.569] * (-794.987) (-796.973) [-798.345] (-799.270) -- 0:01:12
      362500 -- (-799.730) (-798.497) [-796.580] (-798.767) * (-796.952) (-798.046) [-794.289] (-801.592) -- 0:01:12
      363000 -- [-797.681] (-793.288) (-797.591) (-799.833) * (-797.677) [-796.048] (-793.722) (-801.970) -- 0:01:11
      363500 -- [-795.942] (-797.020) (-807.269) (-794.032) * [-793.864] (-799.906) (-792.736) (-796.815) -- 0:01:11
      364000 -- (-802.528) [-793.813] (-806.390) (-805.405) * (-801.266) [-792.566] (-800.598) (-797.350) -- 0:01:11
      364500 -- (-796.412) (-795.682) (-801.754) [-800.951] * (-796.313) (-794.463) (-799.381) [-799.204] -- 0:01:11
      365000 -- [-793.455] (-791.277) (-797.099) (-803.280) * (-795.535) [-797.064] (-795.630) (-800.335) -- 0:01:11

      Average standard deviation of split frequencies: 0.012622

      365500 -- (-797.164) [-793.298] (-797.431) (-797.945) * [-796.843] (-800.751) (-799.269) (-800.575) -- 0:01:11
      366000 -- (-799.053) (-800.223) [-797.125] (-796.207) * (-796.902) (-798.389) (-801.066) [-798.561] -- 0:01:11
      366500 -- (-796.238) (-800.036) [-794.864] (-801.199) * (-801.641) (-797.797) [-799.573] (-803.554) -- 0:01:10
      367000 -- (-796.906) (-798.716) (-797.555) [-796.736] * (-795.789) [-793.189] (-799.964) (-797.285) -- 0:01:10
      367500 -- (-796.437) (-810.442) [-799.368] (-798.108) * (-800.331) (-803.678) (-802.153) [-800.117] -- 0:01:10
      368000 -- (-795.563) (-794.792) [-793.893] (-801.149) * (-804.337) (-792.998) (-799.350) [-797.820] -- 0:01:10
      368500 -- (-797.329) (-796.511) (-797.512) [-796.751] * [-791.062] (-796.633) (-801.286) (-794.050) -- 0:01:10
      369000 -- (-800.906) [-794.826] (-797.425) (-796.804) * (-801.759) (-793.140) [-794.585] (-796.177) -- 0:01:11
      369500 -- (-799.913) (-794.840) [-799.840] (-799.263) * (-795.314) (-793.625) [-797.023] (-797.836) -- 0:01:11
      370000 -- (-796.480) [-794.755] (-794.632) (-796.977) * (-795.931) (-798.013) (-798.460) [-795.917] -- 0:01:11

      Average standard deviation of split frequencies: 0.010937

      370500 -- (-799.237) (-799.699) [-793.512] (-804.573) * (-799.993) (-799.118) (-799.210) [-800.450] -- 0:01:11
      371000 -- (-805.772) [-794.176] (-800.037) (-796.047) * (-793.159) (-801.651) [-796.411] (-797.859) -- 0:01:11
      371500 -- (-796.738) (-799.307) [-796.790] (-804.335) * [-792.947] (-795.292) (-796.739) (-804.248) -- 0:01:11
      372000 -- (-801.810) (-799.463) (-795.170) [-793.908] * (-801.957) (-794.273) [-798.518] (-803.145) -- 0:01:10
      372500 -- (-801.234) (-800.807) [-791.873] (-797.266) * (-803.646) [-796.210] (-794.553) (-808.123) -- 0:01:10
      373000 -- (-796.787) (-803.224) (-801.618) [-796.257] * (-807.512) (-795.229) (-799.251) [-795.939] -- 0:01:10
      373500 -- (-797.290) [-797.857] (-795.834) (-793.186) * [-796.278] (-798.322) (-796.462) (-796.516) -- 0:01:10
      374000 -- (-796.628) (-796.732) [-801.694] (-797.681) * (-797.778) (-796.709) (-796.986) [-793.951] -- 0:01:10
      374500 -- (-804.886) (-791.171) [-797.057] (-795.177) * [-796.337] (-801.135) (-797.489) (-793.887) -- 0:01:10
      375000 -- (-797.485) (-797.470) (-798.052) [-793.724] * (-802.244) [-794.722] (-795.075) (-798.146) -- 0:01:10

      Average standard deviation of split frequencies: 0.010782

      375500 -- (-801.742) (-799.144) [-791.730] (-796.270) * (-793.738) [-796.334] (-799.971) (-797.254) -- 0:01:09
      376000 -- [-795.428] (-798.513) (-803.774) (-803.920) * (-800.378) [-795.279] (-796.952) (-796.957) -- 0:01:09
      376500 -- (-794.790) (-800.079) (-804.034) [-795.059] * (-800.225) (-795.555) [-798.412] (-800.082) -- 0:01:09
      377000 -- (-798.098) (-794.434) (-805.855) [-792.239] * (-800.308) [-802.002] (-799.620) (-799.203) -- 0:01:09
      377500 -- (-799.975) [-801.356] (-797.079) (-797.956) * [-802.358] (-803.902) (-801.123) (-799.558) -- 0:01:09
      378000 -- (-798.199) [-790.422] (-798.062) (-796.854) * (-795.859) (-801.265) (-799.072) [-798.855] -- 0:01:10
      378500 -- (-800.057) [-796.231] (-801.286) (-797.128) * (-798.421) (-802.324) [-794.760] (-793.784) -- 0:01:10
      379000 -- (-797.403) (-792.770) [-796.493] (-800.435) * (-801.421) [-794.502] (-802.192) (-794.399) -- 0:01:10
      379500 -- (-798.601) (-794.807) [-796.263] (-802.915) * [-796.590] (-802.283) (-793.488) (-803.362) -- 0:01:10
      380000 -- (-801.147) [-796.820] (-795.566) (-797.978) * (-798.024) (-794.290) (-797.382) [-792.568] -- 0:01:10

      Average standard deviation of split frequencies: 0.012136

      380500 -- [-794.209] (-798.927) (-804.939) (-796.748) * (-801.631) (-795.184) [-805.998] (-806.768) -- 0:01:10
      381000 -- (-798.049) [-796.836] (-795.561) (-792.461) * (-798.640) (-794.075) [-797.279] (-798.414) -- 0:01:09
      381500 -- (-794.915) (-799.873) (-792.490) [-794.602] * [-793.440] (-800.915) (-800.274) (-801.413) -- 0:01:09
      382000 -- (-795.690) (-799.947) (-795.961) [-801.150] * (-797.685) (-807.040) [-804.716] (-800.192) -- 0:01:09
      382500 -- [-798.187] (-801.663) (-798.270) (-793.402) * (-797.185) [-801.023] (-797.983) (-798.211) -- 0:01:09
      383000 -- (-795.003) (-802.466) (-801.039) [-796.646] * (-798.502) (-796.676) [-793.630] (-797.517) -- 0:01:09
      383500 -- (-793.271) (-805.363) (-796.927) [-800.018] * (-803.618) (-792.957) [-794.200] (-797.919) -- 0:01:09
      384000 -- (-792.584) (-798.218) (-801.410) [-796.094] * [-793.248] (-806.657) (-794.753) (-794.039) -- 0:01:08
      384500 -- (-790.427) (-796.285) [-798.542] (-796.127) * (-800.557) (-803.952) [-799.022] (-798.167) -- 0:01:08
      385000 -- (-797.364) (-801.149) (-801.997) [-793.939] * [-793.654] (-797.562) (-793.473) (-797.026) -- 0:01:08

      Average standard deviation of split frequencies: 0.013190

      385500 -- (-799.316) (-796.745) [-796.127] (-804.368) * [-799.810] (-803.484) (-799.248) (-799.805) -- 0:01:08
      386000 -- (-792.239) (-797.661) (-794.807) [-796.911] * (-800.255) (-794.771) [-797.730] (-795.624) -- 0:01:08
      386500 -- (-795.062) (-802.868) [-792.803] (-795.693) * (-799.207) (-793.633) [-797.082] (-802.408) -- 0:01:08
      387000 -- (-802.603) (-800.265) [-791.589] (-801.328) * (-795.795) (-801.329) (-798.173) [-800.658] -- 0:01:09
      387500 -- [-794.501] (-793.996) (-799.826) (-796.201) * (-796.925) (-797.761) (-799.726) [-793.791] -- 0:01:09
      388000 -- (-794.796) (-800.544) [-796.012] (-799.091) * (-797.992) [-795.644] (-797.442) (-800.124) -- 0:01:09
      388500 -- (-797.207) [-798.165] (-791.787) (-800.094) * (-797.401) [-794.531] (-791.057) (-807.478) -- 0:01:09
      389000 -- (-799.466) (-802.924) (-801.121) [-798.942] * (-796.285) [-799.135] (-799.835) (-795.927) -- 0:01:09
      389500 -- (-798.051) (-802.123) (-798.965) [-799.681] * (-800.849) [-798.090] (-802.884) (-795.215) -- 0:01:08
      390000 -- (-800.547) (-797.169) (-802.720) [-795.810] * (-798.361) (-797.374) [-799.215] (-794.193) -- 0:01:08

      Average standard deviation of split frequencies: 0.011584

      390500 -- (-801.022) (-805.479) (-806.052) [-797.133] * [-794.786] (-799.760) (-794.942) (-797.889) -- 0:01:08
      391000 -- (-800.985) [-798.713] (-795.522) (-794.990) * (-796.411) (-798.153) [-800.783] (-795.743) -- 0:01:08
      391500 -- [-799.730] (-797.394) (-798.687) (-799.539) * [-795.512] (-798.941) (-797.845) (-801.764) -- 0:01:08
      392000 -- [-793.253] (-801.117) (-795.167) (-790.787) * (-797.066) [-795.223] (-797.244) (-804.904) -- 0:01:08
      392500 -- [-802.350] (-802.256) (-800.801) (-796.937) * (-795.185) [-794.666] (-795.856) (-800.648) -- 0:01:08
      393000 -- [-800.387] (-803.657) (-798.147) (-793.273) * (-809.144) (-805.345) [-796.402] (-796.103) -- 0:01:07
      393500 -- (-803.833) (-794.072) [-799.906] (-797.045) * (-798.873) (-801.189) [-796.120] (-796.029) -- 0:01:07
      394000 -- (-798.183) (-799.328) (-799.960) [-795.993] * (-793.270) (-797.622) (-799.602) [-799.373] -- 0:01:07
      394500 -- [-800.276] (-801.850) (-802.368) (-802.188) * [-795.116] (-794.572) (-795.554) (-796.936) -- 0:01:07
      395000 -- [-801.691] (-798.478) (-804.737) (-796.817) * (-796.673) [-798.957] (-802.390) (-802.726) -- 0:01:07

      Average standard deviation of split frequencies: 0.012380

      395500 -- (-803.222) [-800.424] (-797.404) (-797.247) * [-800.573] (-791.783) (-795.915) (-797.297) -- 0:01:07
      396000 -- (-800.610) (-795.788) [-797.302] (-799.245) * (-800.072) [-798.157] (-800.191) (-793.360) -- 0:01:08
      396500 -- [-794.664] (-808.694) (-796.001) (-791.560) * (-800.132) [-797.460] (-800.137) (-794.962) -- 0:01:08
      397000 -- (-799.472) (-800.853) (-790.824) [-797.864] * (-807.320) (-798.977) (-796.957) [-791.091] -- 0:01:08
      397500 -- (-797.719) [-800.365] (-793.388) (-799.304) * [-798.060] (-798.064) (-803.494) (-800.770) -- 0:01:08
      398000 -- (-801.199) (-797.274) [-794.722] (-805.395) * (-803.854) (-793.484) (-799.107) [-792.544] -- 0:01:08
      398500 -- (-795.496) [-793.393] (-799.583) (-796.779) * (-797.683) (-800.742) (-800.841) [-793.471] -- 0:01:07
      399000 -- (-802.753) (-799.088) (-796.356) [-796.566] * [-795.820] (-805.757) (-798.124) (-796.703) -- 0:01:07
      399500 -- (-799.467) (-801.598) (-794.916) [-795.841] * [-796.038] (-804.532) (-795.740) (-794.015) -- 0:01:07
      400000 -- (-800.372) (-806.989) [-799.898] (-790.567) * [-798.665] (-804.787) (-805.057) (-796.921) -- 0:01:07

      Average standard deviation of split frequencies: 0.012236

      400500 -- (-795.164) [-792.723] (-813.380) (-794.798) * (-799.714) (-795.612) [-797.143] (-794.970) -- 0:01:07
      401000 -- (-795.397) (-796.427) [-795.484] (-793.091) * [-794.205] (-803.829) (-795.968) (-799.439) -- 0:01:07
      401500 -- (-797.475) (-794.866) (-795.615) [-795.571] * (-801.098) [-802.749] (-797.664) (-791.009) -- 0:01:07
      402000 -- (-797.842) (-792.847) (-797.904) [-793.176] * (-803.205) (-802.265) [-793.812] (-797.082) -- 0:01:06
      402500 -- (-799.040) [-794.756] (-799.000) (-800.330) * [-796.269] (-802.665) (-800.371) (-803.600) -- 0:01:06
      403000 -- (-798.890) (-795.978) (-797.676) [-793.815] * (-797.307) (-800.292) (-795.494) [-799.419] -- 0:01:06
      403500 -- [-795.519] (-801.460) (-800.916) (-794.361) * [-799.330] (-801.587) (-797.330) (-799.340) -- 0:01:06
      404000 -- [-795.248] (-796.960) (-796.331) (-797.193) * (-803.935) (-797.311) [-797.839] (-798.340) -- 0:01:06
      404500 -- [-797.210] (-794.967) (-793.433) (-793.604) * (-802.452) (-799.339) (-803.131) [-794.575] -- 0:01:06
      405000 -- (-794.388) (-797.567) [-796.102] (-801.591) * (-801.869) (-794.552) [-797.371] (-798.638) -- 0:01:07

      Average standard deviation of split frequencies: 0.012075

      405500 -- (-795.375) (-797.673) (-795.656) [-796.679] * [-793.986] (-795.951) (-803.951) (-802.665) -- 0:01:07
      406000 -- (-794.888) (-803.752) (-798.115) [-793.544] * [-794.241] (-800.957) (-798.781) (-798.419) -- 0:01:07
      406500 -- (-797.903) (-798.020) [-792.846] (-792.745) * (-804.871) (-804.465) (-800.789) [-793.479] -- 0:01:07
      407000 -- (-795.461) (-794.725) [-800.570] (-798.398) * (-803.003) (-798.949) [-796.597] (-800.188) -- 0:01:07
      407500 -- (-800.698) [-794.750] (-795.960) (-795.248) * (-796.825) [-794.268] (-795.081) (-800.065) -- 0:01:06
      408000 -- (-801.616) [-796.852] (-795.577) (-795.038) * (-793.389) (-797.742) [-790.249] (-801.474) -- 0:01:06
      408500 -- (-792.853) (-796.684) (-792.084) [-803.754] * (-795.594) [-791.528] (-795.818) (-797.694) -- 0:01:06
      409000 -- (-799.689) [-790.368] (-795.160) (-801.488) * (-794.585) (-795.801) [-797.991] (-809.621) -- 0:01:06
      409500 -- (-803.536) (-797.084) [-800.684] (-802.135) * [-792.251] (-792.171) (-799.287) (-799.964) -- 0:01:06
      410000 -- (-797.696) (-795.251) [-795.062] (-797.053) * (-801.269) [-798.902] (-800.769) (-799.142) -- 0:01:06

      Average standard deviation of split frequencies: 0.011938

      410500 -- [-800.679] (-804.093) (-793.044) (-796.044) * (-801.615) (-795.352) (-805.043) [-797.155] -- 0:01:06
      411000 -- (-795.901) [-794.032] (-796.493) (-798.560) * (-806.468) (-798.472) (-800.105) [-800.061] -- 0:01:05
      411500 -- (-795.955) (-795.538) (-792.462) [-799.096] * [-800.400] (-793.062) (-795.629) (-798.800) -- 0:01:05
      412000 -- (-804.413) [-796.529] (-803.463) (-797.304) * (-795.578) [-796.417] (-801.184) (-806.797) -- 0:01:05
      412500 -- [-796.801] (-799.682) (-797.645) (-800.225) * (-794.818) (-797.658) [-798.517] (-797.610) -- 0:01:05
      413000 -- (-801.370) (-805.837) (-798.284) [-794.109] * (-805.584) [-799.706] (-801.027) (-798.865) -- 0:01:05
      413500 -- (-808.007) (-804.696) (-798.743) [-804.838] * [-792.365] (-798.616) (-803.614) (-804.066) -- 0:01:05
      414000 -- [-805.393] (-799.789) (-794.664) (-796.788) * (-794.043) [-798.493] (-796.096) (-805.649) -- 0:01:06
      414500 -- (-793.066) (-797.538) (-792.930) [-799.182] * [-794.227] (-800.493) (-796.860) (-805.221) -- 0:01:06
      415000 -- [-794.561] (-797.505) (-794.176) (-803.052) * (-795.952) (-806.196) [-796.997] (-815.181) -- 0:01:06

      Average standard deviation of split frequencies: 0.012012

      415500 -- [-798.427] (-794.187) (-799.238) (-797.773) * (-798.024) (-801.724) (-797.691) [-794.827] -- 0:01:06
      416000 -- [-799.887] (-806.468) (-793.483) (-796.487) * (-795.062) (-799.707) [-794.899] (-798.676) -- 0:01:05
      416500 -- [-794.015] (-797.223) (-802.166) (-798.779) * (-793.326) (-802.083) [-800.261] (-804.163) -- 0:01:05
      417000 -- (-797.047) [-795.966] (-804.588) (-795.618) * [-797.578] (-799.378) (-798.291) (-793.995) -- 0:01:05
      417500 -- [-793.622] (-801.932) (-799.846) (-793.637) * (-802.310) (-798.839) [-797.771] (-795.512) -- 0:01:05
      418000 -- (-795.953) (-802.134) [-799.081] (-797.355) * (-794.776) (-804.459) (-793.347) [-794.769] -- 0:01:05
      418500 -- (-800.428) (-801.535) [-795.258] (-802.511) * [-801.213] (-796.848) (-805.614) (-798.146) -- 0:01:05
      419000 -- (-794.995) (-798.731) (-803.392) [-797.404] * (-799.690) (-797.779) (-799.733) [-807.294] -- 0:01:05
      419500 -- (-796.396) [-797.296] (-795.732) (-802.364) * (-795.510) [-795.658] (-794.321) (-797.371) -- 0:01:05
      420000 -- (-800.772) (-793.797) [-793.922] (-805.309) * (-795.257) (-795.296) [-799.219] (-798.023) -- 0:01:04

      Average standard deviation of split frequencies: 0.011878

      420500 -- (-793.297) (-796.082) [-796.052] (-794.131) * (-797.662) (-794.368) (-793.976) [-796.113] -- 0:01:04
      421000 -- (-795.844) [-793.056] (-803.057) (-792.771) * (-798.010) (-798.889) (-793.702) [-796.266] -- 0:01:04
      421500 -- (-797.249) (-798.121) [-790.103] (-798.351) * (-798.946) [-794.644] (-798.011) (-807.229) -- 0:01:04
      422000 -- (-797.241) (-796.727) (-792.234) [-796.161] * (-796.210) (-796.771) (-791.419) [-796.642] -- 0:01:04
      422500 -- (-795.365) (-795.098) (-796.980) [-797.764] * [-797.639] (-797.258) (-799.249) (-799.847) -- 0:01:04
      423000 -- (-801.525) [-796.602] (-798.015) (-793.650) * (-799.483) (-802.824) [-791.847] (-798.095) -- 0:01:05
      423500 -- (-794.844) (-802.769) (-803.899) [-794.361] * (-793.097) (-797.514) [-796.205] (-806.565) -- 0:01:05
      424000 -- [-793.378] (-795.003) (-800.323) (-796.055) * (-794.844) (-800.690) (-798.848) [-793.740] -- 0:01:05
      424500 -- [-799.669] (-802.694) (-791.893) (-798.647) * (-806.196) [-803.044] (-798.695) (-791.083) -- 0:01:05
      425000 -- [-797.080] (-795.749) (-799.366) (-797.113) * (-794.152) (-797.996) [-791.780] (-795.777) -- 0:01:04

      Average standard deviation of split frequencies: 0.011287

      425500 -- [-795.956] (-794.377) (-801.005) (-799.769) * (-792.833) (-797.711) [-796.225] (-798.487) -- 0:01:04
      426000 -- [-802.882] (-796.524) (-798.529) (-796.917) * (-802.818) [-794.969] (-795.278) (-798.813) -- 0:01:04
      426500 -- [-801.022] (-799.300) (-796.310) (-797.586) * (-797.661) (-795.710) (-799.945) [-795.490] -- 0:01:04
      427000 -- [-798.630] (-793.470) (-798.901) (-802.597) * (-806.267) (-800.530) (-794.066) [-796.897] -- 0:01:04
      427500 -- (-796.897) (-801.124) [-795.072] (-794.404) * (-795.277) (-805.796) [-797.770] (-798.407) -- 0:01:04
      428000 -- (-799.012) (-795.646) (-797.996) [-792.961] * (-800.032) [-794.028] (-792.272) (-800.781) -- 0:01:04
      428500 -- [-795.460] (-797.872) (-803.644) (-793.269) * (-797.160) [-793.042] (-801.729) (-802.843) -- 0:01:04
      429000 -- (-802.057) [-797.718] (-798.722) (-797.576) * (-806.556) (-793.469) (-800.809) [-799.901] -- 0:01:03
      429500 -- [-793.841] (-808.272) (-792.485) (-792.873) * (-797.823) (-796.943) (-798.341) [-793.745] -- 0:01:03
      430000 -- (-797.856) (-798.009) [-800.799] (-798.129) * (-802.977) (-802.263) [-798.321] (-795.929) -- 0:01:03

      Average standard deviation of split frequencies: 0.010727

      430500 -- (-796.455) [-794.418] (-796.785) (-799.765) * (-792.049) [-790.792] (-795.667) (-797.388) -- 0:01:03
      431000 -- [-796.760] (-799.672) (-798.930) (-799.101) * (-796.042) (-798.780) (-794.560) [-795.055] -- 0:01:03
      431500 -- (-793.385) (-797.200) (-798.351) [-795.972] * (-797.759) [-797.021] (-799.233) (-799.587) -- 0:01:03
      432000 -- (-793.223) (-796.925) [-796.781] (-796.143) * (-792.692) (-798.014) [-795.459] (-795.671) -- 0:01:04
      432500 -- [-798.194] (-796.524) (-800.484) (-803.464) * [-798.892] (-797.852) (-798.927) (-794.197) -- 0:01:04
      433000 -- (-798.285) (-804.503) [-795.109] (-802.623) * (-796.961) (-800.206) [-798.172] (-796.718) -- 0:01:04
      433500 -- [-793.342] (-793.801) (-794.736) (-799.391) * [-792.899] (-796.709) (-803.195) (-808.617) -- 0:01:04
      434000 -- (-794.695) (-803.772) (-800.693) [-796.632] * (-794.480) [-800.883] (-803.383) (-800.063) -- 0:01:03
      434500 -- (-797.536) (-799.146) [-796.649] (-797.014) * (-796.754) [-795.238] (-802.111) (-801.683) -- 0:01:03
      435000 -- [-800.762] (-803.883) (-800.157) (-799.998) * [-794.918] (-802.223) (-800.449) (-798.373) -- 0:01:03

      Average standard deviation of split frequencies: 0.010596

      435500 -- (-797.515) [-797.692] (-795.868) (-801.864) * [-795.194] (-795.387) (-801.176) (-797.292) -- 0:01:03
      436000 -- (-794.645) (-796.856) (-801.974) [-795.593] * [-796.020] (-795.694) (-794.261) (-804.917) -- 0:01:03
      436500 -- (-799.645) (-798.908) [-792.374] (-797.121) * (-795.357) [-795.935] (-799.062) (-794.986) -- 0:01:03
      437000 -- (-792.887) (-793.777) (-797.074) [-798.206] * (-796.176) (-796.302) (-796.161) [-793.940] -- 0:01:03
      437500 -- (-794.142) [-790.783] (-801.746) (-802.610) * (-796.173) (-797.535) [-799.156] (-793.405) -- 0:01:03
      438000 -- (-806.398) (-796.138) [-802.051] (-799.703) * (-791.242) (-799.221) [-795.706] (-804.483) -- 0:01:02
      438500 -- (-803.281) [-794.301] (-802.131) (-795.261) * (-792.407) [-796.899] (-798.259) (-794.200) -- 0:01:02
      439000 -- (-798.742) (-793.803) [-798.195] (-799.278) * (-795.469) (-804.156) (-796.756) [-798.516] -- 0:01:02
      439500 -- (-794.706) (-795.171) [-805.507] (-796.246) * [-804.524] (-798.696) (-797.322) (-801.424) -- 0:01:02
      440000 -- [-802.878] (-795.606) (-798.443) (-802.543) * (-802.959) (-800.694) (-793.938) [-791.211] -- 0:01:02

      Average standard deviation of split frequencies: 0.010056

      440500 -- (-794.489) (-797.267) [-794.110] (-794.854) * (-800.879) [-799.088] (-801.244) (-795.836) -- 0:01:02
      441000 -- (-794.499) (-795.354) (-799.783) [-793.712] * (-796.804) (-798.825) [-790.531] (-795.320) -- 0:01:03
      441500 -- (-799.059) (-796.993) [-799.549] (-797.221) * (-793.140) (-801.372) (-800.445) [-795.614] -- 0:01:03
      442000 -- (-790.988) (-797.943) [-798.580] (-795.709) * [-801.762] (-800.854) (-796.990) (-796.902) -- 0:01:03
      442500 -- [-790.485] (-801.331) (-803.155) (-796.448) * (-795.041) [-796.382] (-803.645) (-797.453) -- 0:01:02
      443000 -- (-799.567) (-797.743) (-796.071) [-797.838] * (-799.922) (-804.480) [-799.093] (-802.895) -- 0:01:02
      443500 -- (-801.045) (-796.381) (-796.597) [-792.057] * (-794.362) [-794.491] (-804.375) (-796.509) -- 0:01:02
      444000 -- (-794.232) (-796.327) [-791.633] (-798.095) * [-797.031] (-802.236) (-801.083) (-797.125) -- 0:01:02
      444500 -- (-795.789) (-795.767) (-796.498) [-791.080] * (-798.425) [-798.479] (-802.601) (-797.713) -- 0:01:02
      445000 -- (-790.146) [-800.208] (-792.526) (-801.113) * (-801.512) (-796.000) [-798.485] (-797.767) -- 0:01:02

      Average standard deviation of split frequencies: 0.010992

      445500 -- (-800.963) (-795.254) [-795.242] (-797.137) * (-804.052) (-795.400) [-797.165] (-792.855) -- 0:01:02
      446000 -- (-798.991) (-796.976) (-796.234) [-793.087] * (-799.954) (-799.436) (-793.100) [-792.756] -- 0:01:02
      446500 -- (-804.377) (-794.639) (-804.550) [-795.906] * [-793.278] (-795.253) (-797.175) (-800.277) -- 0:01:01
      447000 -- (-804.340) (-795.642) (-801.365) [-794.757] * [-801.033] (-795.140) (-803.104) (-797.781) -- 0:01:01
      447500 -- (-798.291) [-798.350] (-801.544) (-811.614) * [-794.806] (-794.940) (-798.065) (-794.735) -- 0:01:01
      448000 -- (-799.842) (-801.319) [-794.176] (-803.128) * (-792.572) (-794.915) [-797.353] (-795.910) -- 0:01:01
      448500 -- (-799.672) (-796.032) (-798.436) [-796.046] * (-800.628) (-798.864) (-801.759) [-795.164] -- 0:01:01
      449000 -- (-797.893) [-795.080] (-795.825) (-791.405) * [-799.368] (-796.098) (-799.077) (-801.407) -- 0:01:01
      449500 -- (-804.549) [-796.406] (-801.643) (-798.111) * (-798.137) (-799.240) (-796.208) [-798.367] -- 0:01:01
      450000 -- [-792.467] (-799.807) (-800.213) (-798.483) * [-794.349] (-802.709) (-793.264) (-794.297) -- 0:01:02

      Average standard deviation of split frequencies: 0.011506

      450500 -- (-798.144) (-793.233) [-802.274] (-803.239) * (-805.257) (-800.722) [-799.453] (-794.701) -- 0:01:02
      451000 -- [-794.679] (-797.963) (-807.018) (-804.569) * (-799.498) (-798.462) [-794.478] (-795.383) -- 0:01:02
      451500 -- (-796.633) [-792.629] (-796.176) (-795.838) * (-794.726) (-795.486) [-798.665] (-798.182) -- 0:01:01
      452000 -- (-801.404) [-797.765] (-797.360) (-802.570) * (-796.671) (-799.276) [-796.576] (-798.895) -- 0:01:01
      452500 -- (-796.720) (-793.361) [-794.460] (-801.986) * [-796.684] (-798.454) (-796.093) (-800.640) -- 0:01:01
      453000 -- [-796.053] (-798.856) (-797.726) (-790.714) * (-797.960) (-793.142) [-795.306] (-796.249) -- 0:01:01
      453500 -- (-800.890) (-791.102) (-795.134) [-793.535] * (-801.369) [-794.669] (-800.795) (-801.175) -- 0:01:01
      454000 -- (-797.318) (-800.961) (-798.562) [-797.734] * (-800.608) (-798.540) [-796.455] (-797.129) -- 0:01:01
      454500 -- (-798.475) [-798.676] (-809.851) (-799.557) * (-797.242) (-793.713) [-795.725] (-804.701) -- 0:01:01
      455000 -- (-793.495) (-800.340) [-801.394] (-797.192) * (-799.049) [-798.958] (-797.997) (-799.385) -- 0:01:01

      Average standard deviation of split frequencies: 0.009718

      455500 -- (-796.141) [-803.653] (-799.300) (-795.195) * (-792.401) (-800.097) [-802.597] (-794.054) -- 0:01:00
      456000 -- [-795.715] (-796.416) (-800.952) (-800.131) * [-792.654] (-800.973) (-792.746) (-797.916) -- 0:01:00
      456500 -- (-796.303) [-800.042] (-801.623) (-804.335) * (-800.244) (-793.148) [-793.672] (-795.171) -- 0:01:00
      457000 -- [-798.249] (-797.653) (-796.659) (-801.749) * (-794.344) [-795.491] (-795.686) (-799.784) -- 0:01:00
      457500 -- (-796.639) (-799.417) (-795.535) [-797.515] * (-792.638) (-794.034) [-792.946] (-799.309) -- 0:01:00
      458000 -- (-801.585) (-797.353) (-796.458) [-794.606] * [-804.020] (-800.808) (-802.047) (-798.588) -- 0:01:00
      458500 -- (-798.737) (-808.012) (-793.888) [-792.710] * [-795.358] (-796.269) (-797.905) (-798.017) -- 0:01:00
      459000 -- (-795.358) (-794.430) [-797.607] (-795.553) * (-797.139) [-792.820] (-794.223) (-797.859) -- 0:01:01
      459500 -- (-796.598) [-794.238] (-798.004) (-795.118) * (-799.888) (-800.050) (-796.040) [-798.870] -- 0:01:01
      460000 -- (-796.568) (-795.571) [-795.883] (-797.009) * (-805.418) (-797.813) [-796.129] (-799.386) -- 0:01:01

      Average standard deviation of split frequencies: 0.008391

      460500 -- (-802.589) [-794.917] (-801.742) (-798.609) * (-803.408) [-800.000] (-802.355) (-804.525) -- 0:01:00
      461000 -- (-794.955) [-795.073] (-793.837) (-796.145) * (-799.521) [-796.454] (-797.481) (-802.687) -- 0:01:00
      461500 -- (-804.409) (-798.915) [-795.567] (-795.328) * (-797.578) (-799.816) (-801.984) [-794.586] -- 0:01:00
      462000 -- [-795.026] (-793.939) (-797.575) (-796.718) * (-797.315) (-800.711) [-792.542] (-796.875) -- 0:01:00
      462500 -- (-802.437) (-795.387) (-797.781) [-795.306] * [-794.455] (-799.734) (-801.202) (-794.064) -- 0:01:00
      463000 -- (-797.679) (-799.856) (-795.530) [-799.318] * (-798.439) [-795.487] (-793.933) (-800.777) -- 0:01:00
      463500 -- (-796.567) [-796.653] (-793.862) (-795.043) * (-792.932) (-794.812) [-800.634] (-800.304) -- 0:01:00
      464000 -- (-797.812) (-797.352) [-795.804] (-793.716) * (-795.481) (-799.475) [-798.172] (-799.231) -- 0:01:00
      464500 -- (-802.020) [-795.736] (-801.119) (-800.167) * (-799.104) (-798.179) [-800.688] (-800.288) -- 0:00:59
      465000 -- [-799.566] (-798.237) (-799.215) (-791.060) * (-799.176) (-800.705) (-802.135) [-793.097] -- 0:00:59

      Average standard deviation of split frequencies: 0.009307

      465500 -- (-796.184) [-795.182] (-798.595) (-798.828) * (-795.857) [-797.537] (-793.814) (-806.199) -- 0:00:59
      466000 -- (-794.788) [-795.053] (-797.278) (-794.665) * (-802.278) (-797.386) [-793.786] (-799.075) -- 0:00:59
      466500 -- (-799.453) (-798.767) (-798.788) [-798.082] * (-802.206) [-795.725] (-806.189) (-795.350) -- 0:00:59
      467000 -- (-802.508) (-794.050) (-795.888) [-795.072] * (-795.661) (-804.504) [-802.484] (-799.157) -- 0:00:59
      467500 -- (-797.567) (-791.794) (-799.062) [-796.009] * (-796.992) [-799.292] (-802.487) (-802.622) -- 0:00:59
      468000 -- [-792.166] (-797.550) (-798.553) (-794.997) * (-799.908) (-805.850) (-797.736) [-799.189] -- 0:01:00
      468500 -- (-796.970) (-801.332) (-798.214) [-795.343] * (-797.959) (-797.757) [-792.354] (-797.332) -- 0:01:00
      469000 -- [-801.301] (-793.339) (-794.254) (-803.563) * [-796.911] (-801.050) (-799.725) (-797.979) -- 0:01:00
      469500 -- (-802.922) (-796.530) (-792.963) [-798.028] * (-794.759) (-791.830) [-801.418] (-798.992) -- 0:00:59
      470000 -- (-800.711) (-801.306) [-797.376] (-797.889) * [-797.329] (-795.590) (-802.317) (-799.584) -- 0:00:59

      Average standard deviation of split frequencies: 0.008814

      470500 -- [-789.870] (-796.309) (-806.882) (-796.024) * (-795.414) (-795.487) (-800.735) [-797.808] -- 0:00:59
      471000 -- (-792.041) (-796.128) [-794.428] (-798.317) * (-802.177) [-795.357] (-795.096) (-800.157) -- 0:00:59
      471500 -- [-799.072] (-794.509) (-792.286) (-798.880) * (-797.065) [-798.200] (-794.665) (-800.719) -- 0:00:59
      472000 -- [-795.382] (-798.227) (-802.103) (-799.100) * (-797.766) [-793.553] (-796.442) (-800.109) -- 0:00:59
      472500 -- (-808.131) (-793.409) [-796.991] (-800.225) * (-800.969) (-798.135) (-793.038) [-797.853] -- 0:00:59
      473000 -- (-804.157) (-805.601) (-802.023) [-796.125] * (-798.912) (-800.762) [-795.181] (-794.131) -- 0:00:59
      473500 -- (-804.718) (-797.266) [-792.122] (-792.884) * (-800.392) [-795.459] (-794.127) (-798.391) -- 0:00:58
      474000 -- (-799.426) (-794.000) (-795.507) [-797.453] * [-795.294] (-806.799) (-796.005) (-799.751) -- 0:00:58
      474500 -- (-798.958) [-795.788] (-796.961) (-797.773) * [-795.868] (-792.665) (-800.283) (-798.559) -- 0:00:58
      475000 -- (-804.355) (-798.168) [-795.861] (-794.871) * (-793.718) [-792.818] (-804.301) (-801.185) -- 0:00:58

      Average standard deviation of split frequencies: 0.008121

      475500 -- (-800.539) (-795.547) [-796.351] (-793.397) * (-793.788) (-794.682) [-794.475] (-800.231) -- 0:00:58
      476000 -- (-803.049) (-800.940) (-799.281) [-791.799] * (-800.436) (-793.586) [-794.443] (-796.522) -- 0:00:58
      476500 -- (-791.443) (-796.835) (-797.960) [-796.401] * [-794.724] (-802.686) (-792.965) (-799.425) -- 0:00:58
      477000 -- (-798.561) (-800.714) [-790.498] (-796.646) * (-800.036) (-801.039) [-800.126] (-796.134) -- 0:00:59
      477500 -- [-797.690] (-799.823) (-792.098) (-795.188) * [-798.275] (-798.890) (-806.676) (-795.662) -- 0:00:59
      478000 -- (-804.067) (-795.972) (-800.420) [-800.328] * (-801.174) (-795.054) (-795.745) [-798.032] -- 0:00:58
      478500 -- [-797.164] (-804.510) (-802.877) (-795.728) * (-796.436) [-795.988] (-796.500) (-796.274) -- 0:00:58
      479000 -- [-795.606] (-801.029) (-797.664) (-805.195) * (-791.794) (-797.213) (-796.274) [-797.205] -- 0:00:58
      479500 -- [-799.602] (-796.901) (-799.876) (-794.874) * [-794.675] (-797.071) (-795.797) (-796.219) -- 0:00:58
      480000 -- (-798.372) (-793.919) [-798.218] (-792.560) * [-794.855] (-794.908) (-801.205) (-797.682) -- 0:00:58

      Average standard deviation of split frequencies: 0.007454

      480500 -- [-801.512] (-804.805) (-799.914) (-796.640) * (-801.456) (-797.051) [-796.812] (-800.324) -- 0:00:58
      481000 -- (-798.078) [-791.765] (-800.573) (-798.330) * (-800.133) [-791.186] (-795.141) (-794.771) -- 0:00:58
      481500 -- (-801.475) [-800.288] (-796.604) (-799.344) * (-795.968) (-795.371) [-791.801] (-798.833) -- 0:00:58
      482000 -- (-803.927) (-791.956) [-795.217] (-806.677) * [-793.003] (-795.990) (-800.508) (-797.151) -- 0:00:58
      482500 -- (-806.362) (-794.475) (-799.290) [-797.492] * (-796.514) (-796.083) [-794.175] (-802.121) -- 0:00:57
      483000 -- (-795.533) (-798.096) [-791.533] (-798.995) * (-795.137) (-798.705) [-801.395] (-803.481) -- 0:00:57
      483500 -- (-794.998) (-807.161) [-798.400] (-793.333) * (-799.011) (-798.096) (-803.152) [-796.728] -- 0:00:57
      484000 -- [-798.277] (-796.748) (-793.069) (-800.129) * [-794.605] (-796.476) (-793.089) (-798.399) -- 0:00:57
      484500 -- (-804.143) (-795.870) [-796.847] (-797.715) * (-795.316) [-801.168] (-807.253) (-801.949) -- 0:00:57
      485000 -- [-801.595] (-800.926) (-792.969) (-797.697) * (-805.635) [-799.230] (-795.464) (-798.017) -- 0:00:57

      Average standard deviation of split frequencies: 0.006984

      485500 -- (-790.598) (-801.918) (-799.351) [-795.510] * (-796.312) [-797.585] (-798.279) (-804.357) -- 0:00:58
      486000 -- (-800.222) (-799.793) (-802.483) [-801.486] * (-796.911) [-794.730] (-798.542) (-804.785) -- 0:00:58
      486500 -- (-802.716) [-798.319] (-806.298) (-796.303) * (-797.100) (-791.101) (-795.973) [-801.037] -- 0:00:58
      487000 -- (-792.978) (-795.793) (-794.012) [-800.642] * (-805.685) [-796.535] (-799.684) (-800.493) -- 0:00:57
      487500 -- (-794.103) (-803.114) [-794.800] (-797.389) * (-798.785) [-799.836] (-795.679) (-796.353) -- 0:00:57
      488000 -- [-808.131] (-796.281) (-793.373) (-796.698) * (-792.937) (-799.956) [-796.952] (-796.782) -- 0:00:57
      488500 -- [-794.593] (-795.389) (-795.234) (-794.709) * (-799.203) [-805.393] (-796.261) (-797.127) -- 0:00:57
      489000 -- [-796.562] (-797.868) (-796.889) (-797.183) * [-798.990] (-797.168) (-794.369) (-805.858) -- 0:00:57
      489500 -- (-803.008) [-798.460] (-797.017) (-798.644) * [-797.066] (-795.162) (-795.379) (-795.952) -- 0:00:57
      490000 -- (-802.081) (-801.648) (-799.043) [-797.585] * (-801.915) [-804.029] (-798.137) (-801.241) -- 0:00:57

      Average standard deviation of split frequencies: 0.007302

      490500 -- [-797.991] (-802.616) (-798.950) (-794.908) * [-795.591] (-798.367) (-802.807) (-796.075) -- 0:00:57
      491000 -- [-794.688] (-805.721) (-799.593) (-794.067) * (-796.689) (-801.190) [-793.373] (-798.473) -- 0:00:57
      491500 -- (-796.138) [-796.987] (-802.882) (-807.639) * (-800.086) (-794.673) [-796.565] (-797.119) -- 0:00:56
      492000 -- (-793.624) (-798.150) [-800.601] (-796.854) * (-800.065) (-794.856) [-797.875] (-798.953) -- 0:00:56
      492500 -- (-797.114) [-800.084] (-797.443) (-800.321) * (-794.591) (-794.896) [-795.585] (-797.500) -- 0:00:56
      493000 -- (-798.386) (-805.061) (-798.449) [-796.516] * (-804.874) (-797.578) [-797.091] (-797.818) -- 0:00:56
      493500 -- (-798.887) (-799.060) [-793.043] (-799.479) * [-795.946] (-794.271) (-796.599) (-795.071) -- 0:00:56
      494000 -- (-798.637) [-796.994] (-795.712) (-793.423) * (-794.166) (-794.104) (-800.465) [-802.271] -- 0:00:56
      494500 -- [-796.378] (-794.781) (-798.179) (-800.723) * [-792.873] (-803.086) (-794.622) (-797.887) -- 0:00:57
      495000 -- [-800.855] (-801.560) (-800.899) (-798.447) * (-804.613) (-803.614) [-793.871] (-801.600) -- 0:00:57

      Average standard deviation of split frequencies: 0.007223

      495500 -- (-794.062) (-803.079) (-803.814) [-794.651] * (-796.114) [-795.938] (-798.965) (-809.638) -- 0:00:57
      496000 -- (-801.058) (-797.474) [-799.368] (-799.584) * (-792.307) [-791.784] (-798.479) (-797.383) -- 0:00:56
      496500 -- (-796.111) (-798.945) (-804.418) [-797.542] * (-794.111) [-800.131] (-799.689) (-793.514) -- 0:00:56
      497000 -- (-796.477) (-804.240) (-794.763) [-797.399] * (-800.030) [-807.307] (-799.180) (-794.558) -- 0:00:56
      497500 -- [-794.781] (-802.920) (-799.005) (-797.789) * (-810.185) (-796.194) (-804.335) [-796.734] -- 0:00:56
      498000 -- [-796.310] (-789.719) (-795.171) (-800.995) * (-800.914) (-803.151) (-800.541) [-801.245] -- 0:00:56
      498500 -- [-792.905] (-794.338) (-798.106) (-798.171) * (-796.560) (-797.418) (-792.604) [-791.321] -- 0:00:56
      499000 -- (-796.249) [-792.749] (-794.768) (-801.639) * (-791.789) [-795.678] (-799.228) (-793.522) -- 0:00:56
      499500 -- (-797.303) [-808.670] (-801.675) (-797.623) * (-802.994) (-791.601) [-795.611] (-797.714) -- 0:00:56
      500000 -- (-794.834) (-795.666) [-798.165] (-799.028) * [-792.652] (-797.587) (-801.450) (-800.861) -- 0:00:56

      Average standard deviation of split frequencies: 0.007721

      500500 -- [-795.754] (-795.579) (-793.643) (-799.462) * (-801.364) (-802.765) (-794.024) [-794.908] -- 0:00:55
      501000 -- [-796.029] (-796.511) (-799.586) (-799.053) * (-804.807) (-798.485) (-795.875) [-797.090] -- 0:00:55
      501500 -- (-799.845) [-796.825] (-800.051) (-793.382) * (-799.156) [-795.099] (-801.309) (-797.640) -- 0:00:55
      502000 -- (-796.339) (-800.297) [-795.284] (-806.779) * (-797.639) [-794.526] (-793.822) (-794.440) -- 0:00:55
      502500 -- [-796.198] (-804.640) (-798.979) (-795.352) * (-795.919) [-799.963] (-799.158) (-799.547) -- 0:00:55
      503000 -- (-793.907) (-799.907) [-793.949] (-800.454) * (-801.147) [-791.948] (-798.105) (-795.989) -- 0:00:55
      503500 -- (-794.323) [-797.766] (-793.860) (-798.208) * (-802.279) (-796.555) (-800.709) [-794.066] -- 0:00:56
      504000 -- (-794.859) (-793.106) [-792.901] (-801.196) * (-796.500) (-797.761) (-801.230) [-793.968] -- 0:00:56
      504500 -- (-800.364) (-798.856) [-794.195] (-798.542) * (-800.098) [-799.303] (-799.418) (-792.121) -- 0:00:55
      505000 -- (-797.683) (-797.023) [-796.842] (-795.344) * (-803.975) [-798.644] (-794.220) (-797.745) -- 0:00:55

      Average standard deviation of split frequencies: 0.007639

      505500 -- (-798.569) [-794.885] (-794.047) (-793.752) * (-795.745) (-798.473) (-792.499) [-794.187] -- 0:00:55
      506000 -- (-801.162) (-796.083) (-805.308) [-797.059] * (-794.768) (-798.250) (-796.398) [-796.010] -- 0:00:55
      506500 -- (-795.937) (-801.004) (-796.335) [-794.742] * [-793.830] (-799.315) (-796.114) (-799.244) -- 0:00:55
      507000 -- (-801.124) (-795.053) [-791.034] (-798.557) * [-795.278] (-802.628) (-801.933) (-795.910) -- 0:00:55
      507500 -- (-802.049) [-801.007] (-798.860) (-794.302) * (-803.232) [-799.632] (-798.038) (-792.731) -- 0:00:55
      508000 -- (-797.032) [-795.210] (-796.279) (-794.892) * (-796.405) (-800.102) (-794.352) [-799.774] -- 0:00:55
      508500 -- (-794.866) (-796.629) (-802.483) [-799.209] * (-793.834) [-795.982] (-794.183) (-795.280) -- 0:00:55
      509000 -- (-794.918) (-795.280) (-803.574) [-793.417] * (-797.972) [-792.124] (-794.103) (-792.652) -- 0:00:54
      509500 -- (-804.448) [-793.382] (-804.853) (-796.821) * (-799.740) [-798.134] (-801.631) (-798.004) -- 0:00:54
      510000 -- [-800.997] (-804.186) (-795.893) (-799.263) * [-801.926] (-798.944) (-802.687) (-798.229) -- 0:00:54

      Average standard deviation of split frequencies: 0.007570

      510500 -- [-793.406] (-793.745) (-794.502) (-800.734) * (-801.160) [-791.849] (-803.802) (-800.422) -- 0:00:54
      511000 -- [-795.073] (-796.483) (-798.577) (-800.167) * (-803.201) [-793.089] (-795.652) (-794.323) -- 0:00:54
      511500 -- (-797.419) [-797.751] (-793.353) (-793.994) * (-801.447) (-794.043) [-798.837] (-798.493) -- 0:00:54
      512000 -- (-796.012) (-799.883) [-802.658] (-796.488) * (-793.326) (-791.264) [-793.996] (-796.880) -- 0:00:54
      512500 -- [-798.495] (-795.870) (-796.656) (-793.134) * (-805.629) (-801.132) [-794.050] (-798.093) -- 0:00:54
      513000 -- [-800.022] (-804.599) (-793.602) (-797.922) * (-796.502) [-792.094] (-794.692) (-793.932) -- 0:00:55
      513500 -- (-797.450) (-803.210) (-796.093) [-793.515] * (-794.217) [-796.021] (-798.107) (-800.928) -- 0:00:54
      514000 -- (-800.611) (-799.732) (-798.161) [-790.334] * (-796.073) [-794.913] (-795.773) (-796.696) -- 0:00:54
      514500 -- [-798.414] (-797.547) (-803.059) (-805.256) * (-804.253) [-793.838] (-801.006) (-799.513) -- 0:00:54
      515000 -- (-802.668) (-805.137) (-804.144) [-794.629] * (-793.976) [-791.959] (-800.203) (-799.057) -- 0:00:54

      Average standard deviation of split frequencies: 0.008039

      515500 -- (-803.202) [-803.598] (-803.064) (-794.350) * [-795.603] (-795.442) (-797.832) (-792.774) -- 0:00:54
      516000 -- (-800.190) [-800.583] (-795.709) (-793.120) * (-799.668) (-796.147) [-792.329] (-796.005) -- 0:00:54
      516500 -- (-796.562) (-791.060) (-792.564) [-795.536] * (-797.875) (-799.123) [-794.132] (-797.003) -- 0:00:54
      517000 -- [-794.288] (-796.939) (-806.038) (-800.005) * (-791.671) [-795.428] (-794.505) (-794.716) -- 0:00:54
      517500 -- [-801.785] (-798.245) (-799.742) (-794.304) * (-798.865) [-796.900] (-797.072) (-799.411) -- 0:00:54
      518000 -- (-797.176) [-796.203] (-796.661) (-799.234) * (-794.409) (-795.767) [-795.173] (-795.989) -- 0:00:53
      518500 -- (-795.256) [-798.710] (-799.490) (-797.054) * [-799.258] (-798.943) (-796.917) (-794.006) -- 0:00:53
      519000 -- (-790.914) [-797.830] (-793.475) (-794.845) * [-797.210] (-797.736) (-798.628) (-791.555) -- 0:00:53
      519500 -- (-808.734) (-799.642) (-801.602) [-792.159] * (-802.349) (-804.140) [-795.290] (-793.576) -- 0:00:53
      520000 -- (-806.001) (-800.497) (-794.903) [-795.669] * (-795.753) [-794.523] (-796.994) (-800.336) -- 0:00:53

      Average standard deviation of split frequencies: 0.007062

      520500 -- (-796.954) [-793.971] (-791.899) (-795.868) * (-802.911) (-795.703) [-792.045] (-804.729) -- 0:00:53
      521000 -- [-798.370] (-799.035) (-795.271) (-797.364) * (-799.105) (-801.017) (-790.819) [-801.877] -- 0:00:53
      521500 -- [-800.967] (-802.848) (-794.335) (-799.943) * (-795.958) (-795.006) [-793.631] (-799.616) -- 0:00:53
      522000 -- (-799.265) [-799.118] (-800.730) (-796.076) * (-801.498) (-803.099) (-798.237) [-799.962] -- 0:00:54
      522500 -- (-798.445) (-802.870) [-793.370] (-807.901) * (-795.808) (-796.863) (-795.801) [-801.445] -- 0:00:53
      523000 -- [-794.225] (-806.539) (-801.894) (-799.280) * (-794.035) (-797.017) (-803.760) [-804.221] -- 0:00:53
      523500 -- (-790.540) (-798.723) [-801.412] (-795.924) * (-797.817) (-799.683) [-796.766] (-795.954) -- 0:00:53
      524000 -- (-798.826) (-797.224) (-799.286) [-793.635] * (-797.732) (-797.078) [-797.938] (-810.053) -- 0:00:53
      524500 -- (-794.976) (-802.249) [-790.650] (-797.967) * (-796.531) (-799.829) (-798.563) [-795.025] -- 0:00:53
      525000 -- (-792.873) (-798.873) [-798.970] (-801.094) * (-796.239) [-792.313] (-795.678) (-793.421) -- 0:00:53

      Average standard deviation of split frequencies: 0.007170

      525500 -- (-796.203) (-801.292) [-795.446] (-799.013) * (-799.500) [-792.930] (-805.124) (-799.580) -- 0:00:53
      526000 -- [-795.641] (-796.820) (-800.386) (-799.194) * [-796.195] (-801.490) (-795.295) (-795.626) -- 0:00:53
      526500 -- (-802.235) (-798.094) [-800.059] (-800.060) * (-795.870) (-794.340) (-800.149) [-789.959] -- 0:00:53
      527000 -- [-794.105] (-792.836) (-804.553) (-797.605) * (-795.596) (-797.682) [-807.977] (-801.234) -- 0:00:52
      527500 -- (-799.478) (-796.521) (-800.807) [-795.301] * (-797.059) (-799.382) [-791.288] (-802.472) -- 0:00:52
      528000 -- (-794.974) (-801.968) [-794.923] (-797.028) * (-793.505) (-795.553) (-802.664) [-797.342] -- 0:00:52
      528500 -- (-798.768) (-799.059) [-804.232] (-799.932) * (-795.916) (-797.085) [-798.424] (-793.049) -- 0:00:52
      529000 -- (-795.651) (-795.387) [-797.411] (-795.038) * [-795.579] (-794.772) (-799.750) (-798.537) -- 0:00:52
      529500 -- [-795.112] (-793.167) (-792.201) (-799.095) * (-803.362) (-795.009) [-795.908] (-794.116) -- 0:00:52
      530000 -- [-798.058] (-802.035) (-798.414) (-796.656) * (-800.969) [-797.734] (-800.881) (-798.947) -- 0:00:52

      Average standard deviation of split frequencies: 0.007107

      530500 -- (-796.745) (-795.948) [-798.577] (-798.738) * (-799.975) (-798.213) (-800.952) [-798.844] -- 0:00:52
      531000 -- (-801.598) (-800.009) (-794.445) [-797.682] * (-797.166) [-795.039] (-795.110) (-794.962) -- 0:00:52
      531500 -- (-797.405) [-794.517] (-803.210) (-799.254) * (-794.088) (-799.452) [-798.866] (-791.468) -- 0:00:52
      532000 -- (-803.690) [-796.317] (-794.190) (-798.157) * (-797.350) [-796.593] (-796.796) (-791.227) -- 0:00:52
      532500 -- [-795.932] (-798.630) (-805.182) (-792.270) * (-803.759) (-795.228) (-802.426) [-790.590] -- 0:00:52
      533000 -- (-791.428) (-799.781) (-797.719) [-797.641] * (-800.510) (-799.843) [-797.539] (-799.253) -- 0:00:52
      533500 -- (-797.326) (-796.563) (-801.534) [-795.031] * [-791.342] (-797.047) (-796.638) (-795.324) -- 0:00:52
      534000 -- (-798.206) (-799.161) (-798.231) [-794.073] * [-795.667] (-796.817) (-794.234) (-798.097) -- 0:00:52
      534500 -- (-805.212) [-798.029] (-794.156) (-799.882) * (-795.870) (-796.573) [-792.983] (-796.107) -- 0:00:52
      535000 -- (-797.277) (-794.550) (-805.440) [-797.783] * (-804.937) (-798.689) (-794.873) [-798.459] -- 0:00:52

      Average standard deviation of split frequencies: 0.007388

      535500 -- [-802.848] (-800.039) (-798.259) (-805.264) * (-799.182) (-802.424) (-794.265) [-798.018] -- 0:00:52
      536000 -- (-804.336) [-796.037] (-798.542) (-796.739) * (-798.310) (-807.824) (-794.923) [-795.954] -- 0:00:51
      536500 -- (-796.530) (-795.421) (-797.811) [-800.533] * [-796.102] (-802.489) (-799.840) (-797.336) -- 0:00:51
      537000 -- (-800.048) (-795.315) (-795.787) [-796.640] * (-797.283) (-795.587) (-796.129) [-800.172] -- 0:00:51
      537500 -- (-799.346) (-798.564) [-797.162] (-796.561) * (-801.884) (-794.746) (-799.406) [-802.219] -- 0:00:51
      538000 -- (-798.109) [-794.156] (-798.664) (-799.213) * (-794.476) (-802.412) (-798.200) [-796.849] -- 0:00:51
      538500 -- [-793.091] (-798.618) (-797.271) (-800.476) * [-794.339] (-798.720) (-797.631) (-795.327) -- 0:00:51
      539000 -- (-807.198) (-797.889) [-791.675] (-800.757) * [-796.095] (-798.832) (-799.127) (-796.096) -- 0:00:51
      539500 -- [-810.135] (-796.603) (-792.796) (-796.650) * (-792.315) [-797.960] (-797.123) (-803.096) -- 0:00:52
      540000 -- [-799.831] (-799.437) (-796.292) (-793.789) * [-794.489] (-798.716) (-798.778) (-800.292) -- 0:00:51

      Average standard deviation of split frequencies: 0.007673

      540500 -- (-799.824) (-792.850) [-794.870] (-799.744) * (-795.751) (-802.462) [-799.409] (-801.822) -- 0:00:51
      541000 -- (-799.171) (-795.313) [-792.681] (-800.484) * (-801.205) [-798.026] (-795.438) (-794.738) -- 0:00:51
      541500 -- (-804.038) (-794.799) [-794.093] (-797.594) * (-793.602) (-800.689) [-791.987] (-795.011) -- 0:00:51
      542000 -- (-802.008) [-794.224] (-795.960) (-798.414) * (-803.578) (-796.879) (-797.129) [-798.462] -- 0:00:51
      542500 -- [-798.226] (-797.652) (-796.285) (-794.423) * (-797.492) (-797.407) [-799.288] (-799.101) -- 0:00:51
      543000 -- [-798.101] (-795.326) (-794.571) (-797.816) * (-802.331) (-795.738) (-814.498) [-796.890] -- 0:00:51
      543500 -- (-792.094) [-791.045] (-796.692) (-801.724) * (-799.300) (-801.110) (-801.443) [-797.874] -- 0:00:51
      544000 -- (-793.870) (-796.081) (-800.847) [-796.196] * [-796.308] (-804.233) (-803.966) (-793.975) -- 0:00:51
      544500 -- (-797.369) (-793.173) [-802.438] (-796.462) * (-796.327) (-796.039) [-795.428] (-798.155) -- 0:00:51
      545000 -- [-794.596] (-800.198) (-796.062) (-798.520) * (-795.909) (-806.398) [-796.238] (-793.952) -- 0:00:50

      Average standard deviation of split frequencies: 0.008116

      545500 -- (-796.158) (-796.686) [-794.867] (-796.389) * (-795.509) (-803.071) (-795.058) [-792.579] -- 0:00:50
      546000 -- (-795.975) [-797.415] (-799.310) (-805.259) * (-802.813) (-791.811) [-798.366] (-799.373) -- 0:00:50
      546500 -- (-798.022) [-798.191] (-800.076) (-801.661) * (-796.710) (-794.349) (-797.804) [-800.182] -- 0:00:50
      547000 -- (-797.814) [-793.321] (-796.432) (-807.474) * (-803.744) (-795.507) [-796.776] (-795.647) -- 0:00:50
      547500 -- (-802.577) (-794.736) (-798.599) [-801.772] * (-801.384) (-795.517) [-794.664] (-806.993) -- 0:00:50
      548000 -- (-790.108) (-796.876) (-801.103) [-795.563] * (-794.747) (-798.467) [-798.205] (-795.072) -- 0:00:51
      548500 -- (-794.582) (-794.519) [-796.122] (-795.818) * [-792.650] (-794.628) (-801.266) (-799.576) -- 0:00:51
      549000 -- (-805.087) (-794.147) (-794.878) [-794.530] * (-800.736) (-794.201) [-799.049] (-804.183) -- 0:00:50
      549500 -- (-798.789) (-794.511) [-794.019] (-792.917) * (-798.317) (-797.913) [-793.604] (-794.099) -- 0:00:50
      550000 -- (-801.526) (-801.378) [-799.270] (-797.211) * (-798.470) (-804.693) (-793.608) [-801.464] -- 0:00:50

      Average standard deviation of split frequencies: 0.008561

      550500 -- [-794.712] (-799.952) (-800.446) (-795.466) * (-801.992) [-796.731] (-794.844) (-791.949) -- 0:00:50
      551000 -- (-802.937) (-794.949) [-798.260] (-798.881) * (-801.201) (-797.550) [-793.473] (-794.197) -- 0:00:50
      551500 -- [-796.166] (-795.634) (-801.979) (-798.242) * (-801.233) (-796.370) (-802.736) [-795.563] -- 0:00:50
      552000 -- (-798.855) (-804.752) [-796.052] (-795.991) * (-802.751) (-797.479) [-799.914] (-795.704) -- 0:00:50
      552500 -- (-805.454) [-791.941] (-797.296) (-802.554) * (-796.969) (-796.239) [-803.149] (-798.857) -- 0:00:50
      553000 -- (-797.472) [-797.595] (-805.523) (-791.906) * (-795.467) [-796.463] (-800.056) (-797.194) -- 0:00:50
      553500 -- (-801.258) (-801.310) [-807.524] (-796.682) * [-795.462] (-797.733) (-795.787) (-797.791) -- 0:00:50
      554000 -- (-804.376) (-801.512) [-801.273] (-797.668) * (-792.967) (-803.902) [-795.918] (-799.142) -- 0:00:49
      554500 -- (-796.770) (-796.191) [-796.421] (-799.941) * (-801.745) (-799.505) [-798.497] (-799.035) -- 0:00:49
      555000 -- (-801.871) (-795.639) [-796.682] (-802.657) * (-800.276) (-799.013) (-801.809) [-799.236] -- 0:00:49

      Average standard deviation of split frequencies: 0.008648

      555500 -- [-799.858] (-796.788) (-801.640) (-796.022) * (-796.156) [-795.820] (-797.624) (-793.621) -- 0:00:49
      556000 -- (-798.763) (-799.576) (-802.335) [-796.149] * (-795.378) [-801.879] (-799.761) (-804.799) -- 0:00:49
      556500 -- (-806.349) (-793.900) (-795.461) [-791.774] * (-797.863) (-796.814) [-792.925] (-806.959) -- 0:00:49
      557000 -- (-798.667) [-799.184] (-802.439) (-798.198) * [-792.894] (-799.363) (-795.130) (-805.659) -- 0:00:50
      557500 -- [-797.306] (-798.847) (-797.793) (-807.163) * (-794.513) (-801.404) (-797.815) [-798.494] -- 0:00:50
      558000 -- (-797.240) [-798.838] (-799.322) (-793.252) * (-795.274) (-801.629) [-794.588] (-798.061) -- 0:00:49
      558500 -- (-794.075) (-799.958) [-796.162] (-794.884) * (-801.299) (-796.473) (-799.185) [-795.815] -- 0:00:49
      559000 -- [-796.587] (-806.144) (-793.763) (-798.499) * [-796.356] (-801.966) (-798.676) (-799.126) -- 0:00:49
      559500 -- (-794.153) [-793.937] (-795.862) (-795.368) * (-799.014) (-806.032) [-797.417] (-799.856) -- 0:00:49
      560000 -- (-805.678) (-804.681) (-793.062) [-795.296] * (-797.096) (-795.740) [-798.658] (-796.089) -- 0:00:49

      Average standard deviation of split frequencies: 0.008408

      560500 -- [-802.982] (-798.842) (-795.423) (-801.727) * (-799.233) [-791.212] (-801.166) (-794.651) -- 0:00:49
      561000 -- (-797.382) [-800.458] (-799.175) (-794.018) * [-791.349] (-800.035) (-802.972) (-796.600) -- 0:00:49
      561500 -- [-798.183] (-794.506) (-795.617) (-798.140) * (-806.178) (-801.260) (-795.834) [-798.660] -- 0:00:49
      562000 -- [-809.780] (-795.664) (-798.132) (-794.351) * (-800.517) [-797.253] (-798.449) (-803.652) -- 0:00:49
      562500 -- (-797.503) (-791.267) (-796.618) [-799.430] * (-800.706) (-802.972) [-790.830] (-795.393) -- 0:00:49
      563000 -- (-791.924) (-798.669) (-799.555) [-800.697] * (-797.417) [-794.268] (-793.169) (-796.829) -- 0:00:48
      563500 -- (-801.114) (-796.148) [-796.496] (-806.192) * (-797.554) [-796.121] (-791.069) (-794.533) -- 0:00:48
      564000 -- (-803.172) [-796.610] (-796.283) (-793.129) * (-798.391) (-798.746) [-795.854] (-801.887) -- 0:00:48
      564500 -- (-793.264) (-796.474) (-793.466) [-790.751] * [-797.129] (-799.135) (-796.882) (-795.246) -- 0:00:48
      565000 -- (-802.380) (-795.130) (-798.613) [-797.683] * (-798.407) (-792.979) (-799.150) [-799.314] -- 0:00:48

      Average standard deviation of split frequencies: 0.007329

      565500 -- (-792.696) [-799.238] (-802.397) (-800.457) * [-794.137] (-799.506) (-804.836) (-794.560) -- 0:00:48
      566000 -- (-806.887) (-792.250) (-801.538) [-793.905] * (-798.356) (-799.285) (-801.745) [-795.002] -- 0:00:49
      566500 -- (-795.368) [-794.444] (-799.400) (-795.981) * (-799.880) [-796.612] (-795.260) (-796.584) -- 0:00:48
      567000 -- (-793.144) [-793.594] (-797.717) (-797.962) * [-796.213] (-795.195) (-799.749) (-792.865) -- 0:00:48
      567500 -- (-796.901) [-796.848] (-803.306) (-797.329) * (-797.801) [-795.068] (-795.810) (-803.322) -- 0:00:48
      568000 -- (-801.136) (-800.640) (-798.150) [-798.184] * [-800.574] (-797.036) (-802.385) (-791.800) -- 0:00:48
      568500 -- (-801.268) [-802.759] (-798.038) (-791.595) * (-801.399) [-797.541] (-798.127) (-792.004) -- 0:00:48
      569000 -- (-797.130) (-800.955) [-794.721] (-797.227) * (-798.446) (-794.370) (-809.193) [-799.130] -- 0:00:48
      569500 -- [-805.625] (-797.556) (-807.449) (-792.020) * [-791.607] (-793.013) (-799.834) (-802.102) -- 0:00:48
      570000 -- [-801.283] (-796.382) (-803.594) (-801.405) * (-794.742) [-793.651] (-797.399) (-797.093) -- 0:00:48

      Average standard deviation of split frequencies: 0.007600

      570500 -- [-798.109] (-800.162) (-796.899) (-801.672) * [-801.866] (-803.989) (-797.246) (-797.261) -- 0:00:48
      571000 -- [-797.294] (-798.870) (-796.400) (-803.434) * (-798.670) (-793.927) (-807.989) [-794.054] -- 0:00:48
      571500 -- (-800.104) (-798.946) [-800.289] (-797.872) * (-807.877) [-794.790] (-798.334) (-802.234) -- 0:00:47
      572000 -- (-797.522) (-798.368) (-798.449) [-801.934] * [-792.650] (-802.797) (-798.774) (-797.660) -- 0:00:47
      572500 -- (-794.736) [-792.963] (-803.028) (-795.239) * (-799.570) (-799.833) (-797.077) [-792.081] -- 0:00:47
      573000 -- (-804.576) (-793.044) [-798.740] (-795.125) * (-797.783) [-795.150] (-797.978) (-795.086) -- 0:00:47
      573500 -- (-797.045) [-795.893] (-796.676) (-796.441) * (-793.381) (-796.360) [-796.102] (-792.216) -- 0:00:47
      574000 -- (-793.841) (-795.768) (-804.604) [-795.500] * (-804.156) (-795.632) (-795.962) [-794.984] -- 0:00:47
      574500 -- (-799.972) [-797.223] (-796.090) (-795.255) * (-795.702) (-806.256) [-790.095] (-799.236) -- 0:00:47
      575000 -- (-795.194) [-796.045] (-797.250) (-798.098) * (-797.836) (-800.881) [-793.997] (-796.386) -- 0:00:48

      Average standard deviation of split frequencies: 0.007366

      575500 -- (-795.692) (-802.928) (-793.951) [-798.683] * (-803.105) (-795.292) [-793.540] (-795.472) -- 0:00:47
      576000 -- (-795.877) [-795.220] (-800.736) (-799.631) * (-805.468) (-793.632) (-793.304) [-802.864] -- 0:00:47
      576500 -- (-796.287) (-798.217) [-796.432] (-795.167) * (-796.953) [-793.167] (-796.551) (-798.841) -- 0:00:47
      577000 -- [-801.031] (-802.047) (-799.501) (-798.909) * (-794.162) (-799.119) (-798.036) [-793.482] -- 0:00:47
      577500 -- [-794.075] (-801.750) (-795.063) (-799.417) * (-801.565) (-798.190) (-795.950) [-795.672] -- 0:00:47
      578000 -- [-795.103] (-795.126) (-805.197) (-798.184) * (-800.250) (-795.527) (-796.747) [-795.568] -- 0:00:47
      578500 -- (-799.303) [-794.984] (-796.522) (-804.193) * (-805.100) (-792.604) (-796.675) [-802.268] -- 0:00:47
      579000 -- (-793.770) (-795.025) (-800.328) [-796.166] * [-799.733] (-791.672) (-795.040) (-799.751) -- 0:00:47
      579500 -- [-795.980] (-799.083) (-795.138) (-800.205) * (-796.257) [-805.743] (-796.391) (-800.814) -- 0:00:47
      580000 -- (-799.177) (-804.116) [-795.911] (-799.412) * [-800.549] (-796.177) (-795.649) (-798.295) -- 0:00:47

      Average standard deviation of split frequencies: 0.007794

      580500 -- (-802.894) [-797.051] (-791.793) (-797.624) * [-800.916] (-796.448) (-797.421) (-795.424) -- 0:00:46
      581000 -- [-798.072] (-794.306) (-796.476) (-795.016) * (-794.781) (-793.729) (-805.106) [-793.154] -- 0:00:46
      581500 -- [-800.637] (-795.128) (-799.203) (-795.887) * [-795.034] (-801.930) (-798.761) (-794.878) -- 0:00:46
      582000 -- (-802.916) (-797.222) (-798.460) [-797.482] * (-799.285) (-804.056) [-795.176] (-793.646) -- 0:00:46
      582500 -- (-799.135) (-797.824) [-792.694] (-798.049) * [-795.488] (-794.258) (-800.126) (-801.479) -- 0:00:46
      583000 -- [-793.913] (-798.752) (-801.455) (-796.677) * [-794.667] (-794.650) (-798.320) (-810.248) -- 0:00:46
      583500 -- (-800.100) (-797.783) [-795.314] (-796.269) * (-797.538) (-800.940) [-797.587] (-802.825) -- 0:00:46
      584000 -- (-797.122) (-804.484) [-798.322] (-796.920) * (-800.688) (-802.652) [-792.871] (-800.806) -- 0:00:47
      584500 -- (-795.035) (-797.275) [-794.325] (-801.278) * (-798.626) (-803.043) [-796.885] (-807.353) -- 0:00:46
      585000 -- [-796.847] (-796.630) (-800.014) (-798.395) * (-797.055) (-799.902) [-795.525] (-802.268) -- 0:00:46

      Average standard deviation of split frequencies: 0.007884

      585500 -- (-802.810) [-793.000] (-800.070) (-799.101) * [-799.130] (-801.806) (-794.575) (-799.303) -- 0:00:46
      586000 -- (-800.857) [-794.084] (-799.480) (-800.175) * [-792.423] (-794.759) (-793.139) (-803.550) -- 0:00:46
      586500 -- (-802.409) (-791.278) (-805.380) [-793.889] * (-793.818) (-795.508) (-794.457) [-792.419] -- 0:00:46
      587000 -- (-799.934) (-800.643) [-797.352] (-797.845) * (-799.472) (-791.989) [-795.754] (-794.026) -- 0:00:46
      587500 -- [-793.058] (-800.166) (-792.891) (-797.102) * [-794.726] (-798.510) (-800.320) (-799.000) -- 0:00:46
      588000 -- (-794.496) [-797.557] (-800.340) (-792.305) * (-795.285) [-791.931] (-797.193) (-796.279) -- 0:00:46
      588500 -- (-799.673) [-794.913] (-804.796) (-797.872) * (-802.776) (-795.970) (-800.008) [-806.267] -- 0:00:46
      589000 -- (-798.064) (-798.959) [-794.556] (-798.261) * [-796.654] (-802.032) (-795.608) (-798.156) -- 0:00:46
      589500 -- (-797.481) (-792.862) [-799.843] (-797.949) * (-795.839) [-794.531] (-797.124) (-803.782) -- 0:00:45
      590000 -- (-795.279) [-796.248] (-800.156) (-799.624) * (-797.037) (-799.137) [-793.738] (-796.949) -- 0:00:45

      Average standard deviation of split frequencies: 0.008300

      590500 -- [-795.957] (-796.322) (-801.958) (-793.729) * (-795.167) (-798.065) (-794.634) [-800.753] -- 0:00:45
      591000 -- [-797.220] (-804.298) (-794.534) (-793.715) * (-799.332) (-800.145) (-799.328) [-800.629] -- 0:00:45
      591500 -- (-801.297) [-797.687] (-796.663) (-798.403) * (-798.333) (-795.280) [-798.437] (-803.017) -- 0:00:45
      592000 -- (-794.977) (-797.176) (-797.277) [-795.786] * (-799.001) (-802.417) (-798.946) [-797.050] -- 0:00:45
      592500 -- [-794.077] (-800.427) (-793.088) (-792.149) * (-791.809) [-795.548] (-798.480) (-800.411) -- 0:00:45
      593000 -- [-795.306] (-802.426) (-795.132) (-797.782) * (-796.955) [-796.622] (-794.714) (-801.598) -- 0:00:45
      593500 -- (-798.454) (-805.026) (-796.484) [-796.185] * (-796.659) [-793.324] (-792.829) (-802.366) -- 0:00:45
      594000 -- (-796.962) [-805.431] (-799.049) (-793.537) * (-804.071) (-794.230) [-793.331] (-794.701) -- 0:00:45
      594500 -- (-797.855) [-797.279] (-791.988) (-802.448) * (-795.727) (-800.102) (-798.594) [-800.530] -- 0:00:45
      595000 -- (-798.138) (-797.684) (-803.986) [-801.763] * (-803.668) (-800.399) [-793.725] (-799.763) -- 0:00:45

      Average standard deviation of split frequencies: 0.009017

      595500 -- (-797.050) [-798.095] (-797.105) (-800.210) * (-805.988) (-801.205) (-801.984) [-799.637] -- 0:00:45
      596000 -- (-792.784) [-794.359] (-804.624) (-800.728) * (-799.409) (-796.891) [-796.561] (-796.191) -- 0:00:45
      596500 -- (-801.937) (-807.193) (-800.472) [-795.488] * (-798.554) (-797.281) (-794.821) [-795.500] -- 0:00:45
      597000 -- [-795.950] (-794.581) (-804.517) (-796.141) * (-797.855) (-792.658) (-795.728) [-793.148] -- 0:00:45
      597500 -- (-795.492) [-796.023] (-799.190) (-793.998) * (-796.920) (-795.601) [-794.475] (-799.308) -- 0:00:45
      598000 -- (-797.959) [-796.625] (-796.115) (-793.948) * (-797.443) (-800.700) (-801.955) [-796.879] -- 0:00:45
      598500 -- (-801.814) [-796.926] (-800.440) (-799.606) * (-794.578) (-801.428) [-805.014] (-798.614) -- 0:00:44
      599000 -- (-799.413) [-796.250] (-797.874) (-798.513) * (-799.146) [-796.717] (-802.171) (-801.035) -- 0:00:44
      599500 -- (-794.238) (-791.480) (-801.769) [-797.251] * (-797.349) (-797.855) (-797.641) [-795.239] -- 0:00:44
      600000 -- (-799.706) (-799.239) (-797.971) [-790.865] * (-798.096) (-795.506) [-795.062] (-796.170) -- 0:00:44

      Average standard deviation of split frequencies: 0.008790

      600500 -- [-798.155] (-803.110) (-796.504) (-798.650) * [-802.256] (-801.210) (-797.892) (-797.558) -- 0:00:44
      601000 -- [-800.314] (-793.948) (-799.777) (-798.031) * [-796.071] (-801.670) (-795.499) (-796.305) -- 0:00:44
      601500 -- (-795.691) [-794.626] (-798.682) (-804.043) * [-796.590] (-797.741) (-801.515) (-791.741) -- 0:00:44
      602000 -- (-800.053) [-800.616] (-794.474) (-801.208) * (-800.357) (-803.283) [-798.283] (-796.791) -- 0:00:44
      602500 -- (-799.183) (-797.802) [-797.551] (-804.675) * (-795.551) (-796.323) [-798.717] (-796.172) -- 0:00:44
      603000 -- (-798.586) [-796.447] (-800.260) (-802.065) * [-795.718] (-794.521) (-800.538) (-796.250) -- 0:00:44
      603500 -- (-793.893) (-796.738) [-795.352] (-793.463) * [-796.894] (-799.485) (-805.220) (-795.889) -- 0:00:44
      604000 -- (-803.180) (-798.482) [-799.068] (-798.687) * (-793.576) (-801.848) (-801.424) [-798.218] -- 0:00:44
      604500 -- (-805.242) (-792.714) (-796.396) [-793.658] * (-797.752) (-796.175) [-794.047] (-799.048) -- 0:00:44
      605000 -- (-794.255) (-797.481) (-802.232) [-798.559] * (-798.718) [-800.282] (-806.274) (-798.419) -- 0:00:44

      Average standard deviation of split frequencies: 0.009179

      605500 -- [-791.924] (-805.655) (-798.421) (-796.031) * [-798.255] (-797.206) (-807.508) (-798.999) -- 0:00:44
      606000 -- [-796.188] (-796.371) (-797.318) (-790.463) * (-796.348) [-794.875] (-802.662) (-801.416) -- 0:00:44
      606500 -- (-796.524) [-794.305] (-796.668) (-799.901) * (-796.494) (-800.986) [-796.008] (-797.360) -- 0:00:44
      607000 -- (-800.056) [-792.786] (-800.485) (-797.256) * [-803.131] (-800.530) (-799.006) (-798.672) -- 0:00:44
      607500 -- (-799.389) (-800.215) (-794.821) [-791.221] * (-796.864) (-799.829) (-799.267) [-800.114] -- 0:00:43
      608000 -- [-801.203] (-801.428) (-792.239) (-804.468) * (-799.903) (-806.683) [-793.678] (-804.147) -- 0:00:43
      608500 -- (-799.728) (-799.851) (-794.282) [-799.268] * (-796.742) [-795.911] (-796.891) (-800.191) -- 0:00:43
      609000 -- (-799.393) [-804.360] (-796.252) (-801.975) * [-794.277] (-795.917) (-803.051) (-801.047) -- 0:00:43
      609500 -- (-799.328) (-797.972) (-793.195) [-793.740] * (-798.762) (-792.531) [-792.229] (-800.554) -- 0:00:43
      610000 -- (-794.918) (-794.621) (-803.198) [-789.937] * (-804.817) [-795.364] (-795.939) (-795.438) -- 0:00:43

      Average standard deviation of split frequencies: 0.008800

      610500 -- [-797.777] (-795.290) (-799.840) (-797.807) * (-795.546) [-796.902] (-795.111) (-795.519) -- 0:00:43
      611000 -- [-795.905] (-790.797) (-801.228) (-797.851) * (-796.208) (-801.929) (-793.311) [-799.455] -- 0:00:43
      611500 -- (-793.862) (-804.841) (-801.937) [-795.893] * [-803.420] (-798.062) (-797.469) (-794.992) -- 0:00:43
      612000 -- (-796.730) [-791.766] (-797.780) (-792.008) * (-796.176) (-792.626) [-797.289] (-800.320) -- 0:00:43
      612500 -- [-800.999] (-797.254) (-795.966) (-801.445) * (-793.880) (-803.237) [-797.397] (-800.979) -- 0:00:43
      613000 -- (-805.857) (-801.281) (-794.098) [-794.925] * (-797.757) (-800.549) [-795.358] (-798.690) -- 0:00:43
      613500 -- [-797.968] (-800.356) (-793.085) (-793.375) * (-796.854) (-798.498) (-800.572) [-794.607] -- 0:00:43
      614000 -- (-795.703) (-802.258) [-793.910] (-805.680) * [-794.490] (-795.301) (-799.470) (-797.877) -- 0:00:43
      614500 -- (-794.648) [-791.868] (-796.051) (-804.759) * (-798.517) (-797.238) [-797.820] (-796.196) -- 0:00:43
      615000 -- (-800.812) [-795.109] (-806.727) (-796.601) * (-804.647) (-796.666) [-799.561] (-794.292) -- 0:00:43

      Average standard deviation of split frequencies: 0.008571

      615500 -- (-797.367) [-796.318] (-802.270) (-796.638) * (-795.673) (-794.260) [-795.058] (-797.344) -- 0:00:43
      616000 -- (-802.618) [-796.537] (-805.440) (-800.251) * (-796.688) [-798.007] (-803.013) (-794.969) -- 0:00:43
      616500 -- (-803.329) (-797.073) [-793.766] (-796.505) * [-795.593] (-798.335) (-805.384) (-800.846) -- 0:00:42
      617000 -- (-795.927) [-797.040] (-801.707) (-795.306) * [-793.346] (-796.641) (-798.472) (-796.413) -- 0:00:42
      617500 -- [-801.295] (-799.777) (-801.148) (-793.942) * (-799.602) (-798.596) [-794.910] (-794.657) -- 0:00:42
      618000 -- (-797.095) (-794.386) (-802.257) [-797.803] * (-799.269) (-798.654) [-798.896] (-789.772) -- 0:00:42
      618500 -- (-794.744) (-797.217) [-796.426] (-800.213) * (-797.303) (-795.716) (-797.276) [-793.991] -- 0:00:42
      619000 -- (-798.414) (-801.258) [-796.390] (-802.041) * (-794.302) (-797.331) (-796.009) [-793.894] -- 0:00:42
      619500 -- (-794.550) (-795.519) (-807.377) [-796.196] * (-793.012) (-801.278) [-794.992] (-795.495) -- 0:00:42
      620000 -- (-799.590) (-801.892) [-800.172] (-803.623) * (-797.237) (-796.087) [-799.621] (-795.233) -- 0:00:42

      Average standard deviation of split frequencies: 0.008658

      620500 -- (-799.493) (-795.933) (-794.508) [-793.992] * (-796.536) [-801.238] (-799.156) (-793.367) -- 0:00:42
      621000 -- (-802.483) (-796.166) (-806.075) [-801.288] * (-800.120) (-800.553) [-797.760] (-795.380) -- 0:00:42
      621500 -- [-796.690] (-799.087) (-799.065) (-796.262) * (-801.538) [-792.413] (-798.377) (-799.264) -- 0:00:42
      622000 -- [-792.815] (-798.152) (-803.495) (-795.607) * (-793.628) [-792.766] (-798.857) (-795.965) -- 0:00:42
      622500 -- (-796.284) (-793.895) [-799.173] (-799.839) * (-796.097) [-794.325] (-798.714) (-793.934) -- 0:00:42
      623000 -- [-796.410] (-803.567) (-795.386) (-798.948) * [-794.483] (-800.092) (-800.446) (-800.481) -- 0:00:42
      623500 -- [-796.945] (-805.362) (-800.202) (-795.432) * (-794.679) (-797.614) (-793.477) [-790.047] -- 0:00:42
      624000 -- (-798.589) (-802.324) (-806.773) [-797.410] * [-797.320] (-794.054) (-797.919) (-794.088) -- 0:00:42
      624500 -- (-809.998) [-800.813] (-800.148) (-795.593) * (-805.247) [-796.491] (-802.288) (-795.508) -- 0:00:42
      625000 -- [-800.849] (-801.310) (-799.757) (-799.419) * (-803.990) [-794.384] (-805.292) (-802.277) -- 0:00:42

      Average standard deviation of split frequencies: 0.008735

      625500 -- (-797.964) (-808.392) (-796.364) [-794.208] * (-796.198) (-795.723) (-796.572) [-798.909] -- 0:00:41
      626000 -- (-796.277) (-799.599) [-797.487] (-799.137) * (-799.606) (-801.190) (-799.718) [-797.866] -- 0:00:41
      626500 -- (-808.567) (-796.322) (-795.468) [-797.503] * [-794.053] (-795.016) (-792.332) (-794.969) -- 0:00:41
      627000 -- (-797.905) (-799.983) (-801.069) [-798.749] * [-798.812] (-801.024) (-793.039) (-794.785) -- 0:00:41
      627500 -- (-797.085) [-794.280] (-800.750) (-793.419) * [-797.434] (-801.414) (-796.772) (-794.724) -- 0:00:41
      628000 -- (-794.541) [-800.042] (-794.871) (-795.387) * [-798.387] (-801.563) (-802.150) (-795.817) -- 0:00:41
      628500 -- (-798.419) (-799.861) (-798.513) [-797.384] * [-796.019] (-796.588) (-804.270) (-794.078) -- 0:00:41
      629000 -- (-800.427) (-797.687) (-804.435) [-799.373] * (-800.960) (-798.725) (-794.880) [-799.263] -- 0:00:41
      629500 -- [-790.428] (-795.531) (-808.549) (-794.471) * (-795.807) (-799.205) [-790.825] (-805.815) -- 0:00:41
      630000 -- (-798.702) [-799.159] (-802.155) (-797.078) * [-795.015] (-798.373) (-795.111) (-799.893) -- 0:00:41

      Average standard deviation of split frequencies: 0.009568

      630500 -- (-797.180) (-801.402) [-794.463] (-795.389) * (-792.064) (-804.478) [-793.109] (-798.632) -- 0:00:41
      631000 -- (-794.718) (-806.319) (-800.426) [-792.661] * [-793.320] (-793.523) (-795.605) (-804.241) -- 0:00:41
      631500 -- (-796.632) [-800.625] (-793.875) (-796.012) * (-796.286) [-790.757] (-801.202) (-796.877) -- 0:00:41
      632000 -- (-793.713) [-798.044] (-797.401) (-798.142) * [-791.979] (-792.379) (-803.350) (-803.046) -- 0:00:41
      632500 -- (-792.233) (-797.349) [-798.063] (-793.932) * (-792.097) (-797.791) [-799.818] (-796.104) -- 0:00:41
      633000 -- (-797.167) (-796.301) [-798.389] (-799.451) * (-795.220) (-797.165) [-797.618] (-801.543) -- 0:00:41
      633500 -- (-800.151) (-801.035) [-794.414] (-799.916) * (-801.541) (-803.113) (-792.180) [-795.589] -- 0:00:41
      634000 -- (-794.143) (-804.888) [-798.140] (-805.508) * (-794.247) [-798.489] (-798.584) (-793.638) -- 0:00:40
      634500 -- (-799.036) [-803.717] (-793.631) (-799.503) * (-798.430) (-798.282) (-796.958) [-801.078] -- 0:00:40
      635000 -- (-797.321) (-794.041) [-793.614] (-797.219) * (-794.705) [-792.933] (-801.587) (-797.483) -- 0:00:40

      Average standard deviation of split frequencies: 0.009487

      635500 -- (-797.505) [-797.106] (-799.287) (-798.435) * (-796.264) [-799.889] (-797.850) (-804.315) -- 0:00:40
      636000 -- (-798.081) [-796.174] (-792.400) (-792.609) * [-799.316] (-791.781) (-797.416) (-801.429) -- 0:00:40
      636500 -- (-798.297) (-796.878) [-802.987] (-795.065) * [-796.402] (-792.695) (-803.938) (-799.439) -- 0:00:40
      637000 -- (-794.593) [-792.812] (-798.364) (-795.436) * [-792.445] (-794.115) (-794.012) (-795.854) -- 0:00:40
      637500 -- (-794.738) [-795.562] (-801.599) (-804.075) * (-800.369) [-791.628] (-795.970) (-793.452) -- 0:00:40
      638000 -- [-793.195] (-799.477) (-801.795) (-797.431) * [-796.240] (-801.117) (-797.739) (-798.217) -- 0:00:40
      638500 -- [-794.709] (-795.882) (-797.680) (-799.824) * (-795.771) (-796.664) [-794.171] (-796.192) -- 0:00:40
      639000 -- (-793.255) (-796.578) [-795.828] (-797.730) * (-795.669) [-797.058] (-793.545) (-799.197) -- 0:00:40
      639500 -- (-794.745) [-793.973] (-809.452) (-797.257) * (-795.380) [-796.123] (-794.428) (-797.986) -- 0:00:40
      640000 -- [-792.193] (-795.663) (-806.888) (-797.821) * [-794.551] (-803.311) (-792.529) (-802.454) -- 0:00:40

      Average standard deviation of split frequencies: 0.010007

      640500 -- [-796.072] (-796.235) (-802.428) (-794.017) * (-804.144) (-793.403) [-796.851] (-800.811) -- 0:00:40
      641000 -- (-794.414) [-794.628] (-800.197) (-795.802) * [-801.997] (-793.025) (-804.652) (-804.626) -- 0:00:40
      641500 -- [-793.246] (-795.768) (-797.421) (-794.498) * [-799.264] (-802.832) (-794.746) (-793.791) -- 0:00:40
      642000 -- (-796.286) [-793.151] (-801.868) (-798.253) * (-799.471) (-793.732) [-797.668] (-797.737) -- 0:00:40
      642500 -- (-797.103) (-795.500) (-797.123) [-800.239] * (-793.311) (-800.706) [-797.942] (-795.012) -- 0:00:40
      643000 -- [-799.366] (-799.819) (-808.495) (-795.108) * (-794.032) (-798.362) (-795.810) [-795.312] -- 0:00:39
      643500 -- (-792.114) (-804.012) (-801.332) [-794.944] * (-796.317) (-801.042) (-797.852) [-798.826] -- 0:00:39
      644000 -- (-798.470) (-794.731) (-804.081) [-794.397] * (-798.320) [-796.373] (-797.574) (-798.795) -- 0:00:39
      644500 -- (-793.507) (-797.582) (-807.115) [-792.600] * (-810.272) (-797.543) [-794.371] (-795.444) -- 0:00:39
      645000 -- (-792.303) (-795.172) (-802.227) [-799.553] * (-800.468) (-793.070) [-800.768] (-801.923) -- 0:00:39

      Average standard deviation of split frequencies: 0.009486

      645500 -- (-799.726) [-794.947] (-803.165) (-811.358) * (-799.180) (-801.343) [-794.688] (-804.252) -- 0:00:39
      646000 -- [-794.467] (-795.131) (-798.685) (-798.868) * (-796.524) [-794.332] (-796.621) (-802.657) -- 0:00:39
      646500 -- (-801.633) (-792.765) (-800.663) [-798.840] * (-795.602) (-800.321) (-799.775) [-798.671] -- 0:00:39
      647000 -- [-796.897] (-797.250) (-808.617) (-808.106) * (-796.020) [-796.441] (-799.025) (-795.265) -- 0:00:39
      647500 -- (-796.014) (-797.651) (-802.788) [-799.541] * [-798.549] (-809.206) (-793.021) (-796.918) -- 0:00:39
      648000 -- [-797.777] (-799.314) (-808.611) (-801.520) * (-794.559) (-802.787) (-798.111) [-795.222] -- 0:00:39
      648500 -- (-796.825) [-800.272] (-798.935) (-800.858) * (-799.296) (-803.468) [-797.014] (-795.002) -- 0:00:39
      649000 -- (-796.345) [-794.517] (-796.723) (-795.251) * (-796.456) (-794.869) (-796.988) [-796.595] -- 0:00:39
      649500 -- [-794.894] (-806.450) (-798.751) (-793.575) * (-798.457) [-795.122] (-794.353) (-802.894) -- 0:00:39
      650000 -- [-795.786] (-796.429) (-795.149) (-801.029) * (-797.985) (-795.654) [-795.536] (-801.569) -- 0:00:39

      Average standard deviation of split frequencies: 0.011012

      650500 -- (-796.725) [-798.689] (-801.367) (-797.353) * (-798.569) (-793.287) [-798.241] (-799.967) -- 0:00:39
      651000 -- [-790.201] (-796.054) (-794.848) (-791.000) * (-798.694) (-794.832) [-797.567] (-800.038) -- 0:00:39
      651500 -- (-795.604) (-799.965) [-796.438] (-789.765) * (-798.931) (-799.359) (-798.318) [-792.488] -- 0:00:39
      652000 -- (-794.665) [-795.746] (-795.414) (-794.825) * (-799.585) (-803.660) (-793.946) [-794.916] -- 0:00:38
      652500 -- (-794.396) [-795.800] (-794.492) (-791.494) * (-798.018) [-794.259] (-795.500) (-798.126) -- 0:00:38
      653000 -- (-802.614) (-799.853) (-797.002) [-791.738] * (-799.224) [-795.013] (-800.765) (-796.744) -- 0:00:38
      653500 -- (-799.653) (-807.315) [-795.601] (-797.006) * (-796.528) (-803.182) [-802.585] (-803.308) -- 0:00:38
      654000 -- (-793.789) [-794.764] (-801.021) (-800.581) * (-798.262) (-795.752) [-793.057] (-799.146) -- 0:00:38
      654500 -- [-791.660] (-795.825) (-798.869) (-798.433) * (-801.781) (-799.821) [-795.660] (-798.998) -- 0:00:38
      655000 -- (-796.501) (-796.161) [-797.908] (-800.965) * [-793.701] (-799.797) (-796.018) (-797.662) -- 0:00:38

      Average standard deviation of split frequencies: 0.010923

      655500 -- (-793.499) [-796.498] (-796.263) (-801.505) * (-802.035) (-800.230) (-813.263) [-794.087] -- 0:00:38
      656000 -- (-798.098) (-798.905) [-795.093] (-802.201) * [-798.993] (-797.772) (-797.507) (-809.992) -- 0:00:38
      656500 -- (-799.827) (-801.025) (-795.802) [-795.943] * (-796.302) [-796.235] (-801.912) (-797.166) -- 0:00:38
      657000 -- (-808.324) (-794.055) (-806.673) [-801.358] * [-795.212] (-802.147) (-801.207) (-792.944) -- 0:00:38
      657500 -- (-799.047) [-798.179] (-796.257) (-797.614) * (-798.025) (-800.135) (-795.181) [-797.469] -- 0:00:38
      658000 -- (-791.959) [-797.746] (-811.482) (-797.729) * (-796.277) [-794.913] (-798.238) (-803.349) -- 0:00:38
      658500 -- (-797.930) (-797.386) (-798.252) [-793.573] * [-803.773] (-794.142) (-794.908) (-792.208) -- 0:00:38
      659000 -- [-792.765] (-795.624) (-796.896) (-802.571) * (-795.869) [-792.700] (-802.839) (-800.557) -- 0:00:38
      659500 -- [-796.576] (-801.419) (-802.265) (-797.325) * (-800.546) [-797.348] (-805.171) (-793.445) -- 0:00:38
      660000 -- (-798.474) (-797.860) [-799.901] (-797.872) * (-793.649) (-794.722) [-797.755] (-796.898) -- 0:00:38

      Average standard deviation of split frequencies: 0.011416

      660500 -- (-793.439) [-791.914] (-805.923) (-795.257) * [-796.569] (-792.245) (-795.862) (-800.828) -- 0:00:38
      661000 -- [-790.810] (-798.048) (-793.807) (-809.031) * (-791.370) (-796.911) (-798.323) [-795.696] -- 0:00:37
      661500 -- (-796.087) (-793.757) (-797.223) [-795.722] * (-801.663) (-798.277) (-794.117) [-800.716] -- 0:00:37
      662000 -- [-793.680] (-796.272) (-796.256) (-798.643) * [-804.019] (-796.241) (-793.279) (-798.558) -- 0:00:37
      662500 -- (-798.451) [-791.718] (-793.578) (-800.205) * (-795.468) [-795.293] (-795.179) (-796.129) -- 0:00:37
      663000 -- (-797.212) [-794.038] (-796.972) (-799.299) * (-800.658) [-798.711] (-791.468) (-810.545) -- 0:00:37
      663500 -- [-794.248] (-801.262) (-792.428) (-801.435) * (-799.397) (-799.112) (-793.926) [-794.398] -- 0:00:37
      664000 -- (-796.575) [-797.009] (-812.094) (-799.587) * (-797.767) [-792.730] (-791.633) (-803.640) -- 0:00:37
      664500 -- (-805.733) [-797.398] (-797.971) (-802.211) * [-797.675] (-807.829) (-798.173) (-796.019) -- 0:00:37
      665000 -- (-799.590) (-801.155) [-798.728] (-796.294) * (-799.099) [-796.834] (-818.509) (-793.625) -- 0:00:37

      Average standard deviation of split frequencies: 0.011750

      665500 -- (-802.432) (-795.385) [-797.460] (-793.190) * [-797.748] (-799.160) (-799.751) (-799.367) -- 0:00:37
      666000 -- [-797.796] (-796.681) (-799.504) (-797.872) * [-796.998] (-799.659) (-802.414) (-796.837) -- 0:00:37
      666500 -- (-807.666) [-794.373] (-795.450) (-801.837) * [-794.425] (-803.242) (-801.564) (-799.301) -- 0:00:37
      667000 -- [-795.411] (-794.610) (-795.162) (-792.713) * (-800.557) [-798.510] (-797.452) (-801.567) -- 0:00:37
      667500 -- (-800.861) (-800.062) (-807.283) [-792.738] * [-793.489] (-801.882) (-799.594) (-797.727) -- 0:00:37
      668000 -- (-793.286) (-804.342) [-794.628] (-795.997) * [-797.092] (-797.067) (-799.517) (-797.942) -- 0:00:37
      668500 -- (-795.976) (-796.489) [-794.187] (-797.246) * (-795.859) (-799.524) (-799.884) [-796.402] -- 0:00:37
      669000 -- [-797.762] (-808.424) (-795.712) (-800.654) * (-809.063) (-799.680) [-796.766] (-799.437) -- 0:00:37
      669500 -- (-799.462) (-801.629) (-798.883) [-795.066] * (-800.892) (-795.537) (-802.418) [-796.133] -- 0:00:37
      670000 -- (-800.113) (-804.891) (-798.722) [-800.081] * (-806.232) (-796.063) (-791.947) [-797.991] -- 0:00:36

      Average standard deviation of split frequencies: 0.011387

      670500 -- (-797.265) (-794.786) (-801.882) [-805.460] * (-796.988) (-804.234) (-794.921) [-795.236] -- 0:00:36
      671000 -- [-796.042] (-798.794) (-801.683) (-798.781) * (-802.217) (-798.494) (-796.023) [-798.090] -- 0:00:36
      671500 -- [-796.334] (-797.169) (-796.886) (-799.835) * (-802.850) (-801.751) [-792.607] (-801.370) -- 0:00:36
      672000 -- (-794.537) (-796.911) [-796.910] (-794.556) * (-799.081) (-800.688) (-797.112) [-797.172] -- 0:00:36
      672500 -- (-800.373) (-794.914) (-800.049) [-794.579] * (-798.515) (-807.210) [-792.820] (-793.119) -- 0:00:36
      673000 -- (-800.322) [-800.621] (-800.136) (-793.193) * [-796.756] (-796.992) (-798.553) (-795.438) -- 0:00:36
      673500 -- (-799.902) [-801.098] (-796.712) (-794.487) * (-796.753) (-800.647) (-799.974) [-794.241] -- 0:00:36
      674000 -- [-793.123] (-793.966) (-795.788) (-797.145) * (-796.440) (-796.425) (-800.747) [-796.057] -- 0:00:36
      674500 -- (-796.374) [-797.073] (-792.063) (-797.325) * (-805.806) (-796.765) [-797.489] (-805.707) -- 0:00:36
      675000 -- [-794.396] (-798.277) (-795.906) (-795.909) * (-798.772) [-795.964] (-794.018) (-805.045) -- 0:00:36

      Average standard deviation of split frequencies: 0.010879

      675500 -- (-792.888) [-795.656] (-796.846) (-796.181) * (-801.230) (-795.772) [-794.527] (-802.807) -- 0:00:36
      676000 -- [-792.408] (-798.369) (-796.888) (-795.352) * (-798.423) [-791.469] (-794.342) (-794.588) -- 0:00:36
      676500 -- (-796.570) (-796.005) [-793.447] (-797.668) * (-800.805) [-794.223] (-793.994) (-801.665) -- 0:00:36
      677000 -- (-800.814) (-795.983) (-793.260) [-794.042] * (-797.075) (-791.689) (-796.668) [-795.623] -- 0:00:36
      677500 -- (-803.227) (-805.897) [-793.549] (-802.146) * (-801.007) [-795.924] (-803.021) (-799.795) -- 0:00:36
      678000 -- (-798.929) [-798.178] (-796.361) (-807.188) * [-794.283] (-795.391) (-797.325) (-796.544) -- 0:00:36
      678500 -- [-798.995] (-796.729) (-792.442) (-803.495) * (-795.020) (-806.968) [-796.672] (-795.166) -- 0:00:36
      679000 -- (-791.085) (-792.485) [-794.728] (-794.469) * (-796.497) (-802.596) [-798.943] (-805.854) -- 0:00:35
      679500 -- (-794.451) [-792.218] (-796.939) (-795.144) * (-797.233) (-797.346) (-798.487) [-796.036] -- 0:00:35
      680000 -- (-794.741) (-795.278) (-800.443) [-795.915] * [-801.655] (-808.099) (-795.140) (-795.966) -- 0:00:35

      Average standard deviation of split frequencies: 0.010942

      680500 -- (-793.502) (-791.784) (-807.720) [-793.152] * [-795.339] (-796.064) (-801.302) (-803.393) -- 0:00:35
      681000 -- (-796.563) (-796.511) (-794.792) [-798.814] * (-796.210) (-798.536) [-798.458] (-793.300) -- 0:00:35
      681500 -- (-797.806) (-801.387) [-798.296] (-800.235) * (-795.989) [-800.823] (-796.779) (-795.464) -- 0:00:35
      682000 -- (-801.718) [-793.509] (-802.376) (-795.032) * (-793.940) (-792.171) [-792.168] (-798.728) -- 0:00:35
      682500 -- (-804.274) (-798.170) (-795.739) [-801.258] * (-801.000) (-798.691) (-797.092) [-797.287] -- 0:00:35
      683000 -- (-803.503) [-799.062] (-798.480) (-801.704) * (-807.253) (-795.335) [-792.294] (-798.889) -- 0:00:35
      683500 -- (-795.488) (-801.196) (-802.047) [-799.756] * [-797.157] (-799.302) (-794.945) (-800.183) -- 0:00:35
      684000 -- [-799.392] (-799.443) (-808.083) (-801.516) * (-799.007) (-805.487) [-798.203] (-800.976) -- 0:00:35
      684500 -- (-797.040) [-798.603] (-800.485) (-795.867) * (-798.306) [-795.891] (-795.488) (-792.389) -- 0:00:35
      685000 -- (-796.491) (-798.314) [-796.848] (-796.473) * [-797.671] (-797.801) (-796.384) (-806.572) -- 0:00:35

      Average standard deviation of split frequencies: 0.010308

      685500 -- [-799.304] (-795.710) (-799.281) (-799.052) * [-796.852] (-797.515) (-796.090) (-802.277) -- 0:00:35
      686000 -- [-795.866] (-797.476) (-800.920) (-802.735) * (-800.648) (-799.045) (-797.406) [-792.830] -- 0:00:35
      686500 -- (-795.845) (-804.170) (-799.249) [-794.839] * (-796.252) (-798.113) [-797.009] (-798.191) -- 0:00:35
      687000 -- (-796.555) (-799.351) (-800.328) [-795.899] * [-797.193] (-797.222) (-798.980) (-793.443) -- 0:00:35
      687500 -- (-792.965) (-795.493) (-804.264) [-806.805] * (-795.635) (-805.451) [-795.040] (-799.336) -- 0:00:35
      688000 -- (-801.145) (-805.739) (-803.870) [-799.752] * (-796.884) (-798.777) [-799.303] (-805.173) -- 0:00:34
      688500 -- (-796.985) (-794.032) [-793.087] (-800.998) * (-801.948) (-801.128) [-793.902] (-794.205) -- 0:00:34
      689000 -- (-797.765) [-800.305] (-798.746) (-798.552) * (-797.150) (-795.525) (-797.816) [-798.576] -- 0:00:34
      689500 -- [-799.308] (-796.458) (-806.369) (-801.070) * (-794.253) (-806.781) [-795.418] (-796.590) -- 0:00:34
      690000 -- (-799.647) (-795.479) [-797.664] (-791.892) * (-794.267) [-795.318] (-794.950) (-797.294) -- 0:00:34

      Average standard deviation of split frequencies: 0.009829

      690500 -- (-800.135) (-800.537) (-794.817) [-792.868] * (-791.163) (-795.739) (-800.070) [-798.956] -- 0:00:34
      691000 -- (-800.133) (-794.949) [-792.439] (-797.054) * (-794.092) [-795.416] (-796.628) (-798.408) -- 0:00:34
      691500 -- (-802.794) (-798.104) [-798.028] (-801.932) * (-804.420) (-801.462) [-794.973] (-798.613) -- 0:00:34
      692000 -- [-794.576] (-794.543) (-799.907) (-794.135) * (-798.017) (-794.357) (-794.965) [-795.611] -- 0:00:34
      692500 -- (-801.521) (-798.430) [-796.659] (-796.969) * (-797.167) [-797.302] (-804.600) (-798.268) -- 0:00:34
      693000 -- [-809.701] (-794.159) (-794.079) (-797.196) * (-795.256) (-802.254) (-801.589) [-791.267] -- 0:00:34
      693500 -- (-799.717) (-798.513) (-794.938) [-793.165] * (-796.236) [-800.367] (-797.242) (-801.858) -- 0:00:34
      694000 -- (-793.203) [-800.657] (-797.484) (-797.566) * (-794.862) [-792.232] (-797.962) (-802.308) -- 0:00:34
      694500 -- (-792.769) [-796.625] (-800.282) (-795.447) * (-800.050) (-797.304) (-803.263) [-796.043] -- 0:00:34
      695000 -- [-794.408] (-795.988) (-796.163) (-795.428) * (-797.492) [-791.912] (-793.821) (-794.698) -- 0:00:34

      Average standard deviation of split frequencies: 0.009753

      695500 -- (-799.138) [-803.690] (-800.691) (-791.402) * (-798.116) (-796.480) (-798.763) [-792.248] -- 0:00:34
      696000 -- (-795.419) (-797.855) (-807.726) [-796.787] * [-794.449] (-806.757) (-807.849) (-796.804) -- 0:00:34
      696500 -- (-796.330) (-795.576) [-797.992] (-799.235) * (-794.861) [-798.828] (-797.631) (-794.347) -- 0:00:33
      697000 -- (-811.618) [-795.069] (-798.616) (-800.699) * (-795.631) (-793.401) (-799.580) [-794.450] -- 0:00:33
      697500 -- [-793.961] (-802.063) (-804.327) (-801.471) * (-795.597) (-794.016) (-798.953) [-798.704] -- 0:00:33
      698000 -- (-794.291) (-796.706) (-801.329) [-794.937] * (-795.344) (-795.833) (-805.302) [-796.891] -- 0:00:33
      698500 -- [-794.978] (-801.905) (-809.024) (-796.586) * (-798.034) [-800.925] (-799.610) (-793.771) -- 0:00:33
      699000 -- (-795.708) (-795.782) [-795.789] (-811.532) * (-805.053) [-794.888] (-797.723) (-795.619) -- 0:00:33
      699500 -- (-799.917) (-793.903) (-793.087) [-794.967] * (-799.353) (-792.594) [-795.116] (-801.227) -- 0:00:33
      700000 -- (-804.420) (-794.798) [-797.870] (-799.924) * [-795.083] (-796.905) (-799.385) (-794.692) -- 0:00:33

      Average standard deviation of split frequencies: 0.010226

      700500 -- (-798.533) (-799.204) (-801.574) [-798.307] * (-799.737) (-794.804) [-798.899] (-793.080) -- 0:00:33
      701000 -- (-797.056) (-795.589) [-798.635] (-798.429) * (-796.568) (-794.096) (-803.086) [-795.890] -- 0:00:33
      701500 -- (-805.631) (-793.768) [-801.623] (-793.499) * (-801.975) (-794.717) (-797.707) [-797.215] -- 0:00:33
      702000 -- [-791.175] (-803.760) (-798.421) (-793.393) * (-795.365) (-796.798) [-800.697] (-799.381) -- 0:00:33
      702500 -- (-800.598) [-792.445] (-800.642) (-796.968) * [-801.083] (-798.281) (-796.413) (-800.831) -- 0:00:33
      703000 -- (-801.127) (-798.988) (-796.164) [-795.880] * (-802.772) [-795.304] (-794.222) (-800.342) -- 0:00:33
      703500 -- (-797.588) (-797.981) [-791.839] (-794.122) * (-804.359) [-790.756] (-796.657) (-796.172) -- 0:00:33
      704000 -- (-800.690) (-793.825) [-791.526] (-799.648) * (-799.656) (-796.239) [-794.136] (-795.989) -- 0:00:33
      704500 -- [-794.428] (-796.342) (-798.663) (-791.995) * (-799.672) (-797.786) [-796.420] (-796.636) -- 0:00:33
      705000 -- (-793.707) [-795.497] (-795.105) (-795.213) * (-797.056) (-799.514) [-797.776] (-799.351) -- 0:00:33

      Average standard deviation of split frequencies: 0.010817

      705500 -- [-793.267] (-799.576) (-800.160) (-793.722) * [-795.943] (-803.193) (-795.731) (-800.424) -- 0:00:32
      706000 -- [-797.672] (-793.450) (-798.758) (-799.139) * (-798.890) [-799.225] (-797.669) (-804.473) -- 0:00:32
      706500 -- (-793.433) (-796.153) (-795.151) [-796.215] * (-798.370) (-790.732) [-803.103] (-795.666) -- 0:00:32
      707000 -- (-795.887) [-796.795] (-801.295) (-798.608) * (-796.139) (-795.576) (-793.315) [-799.701] -- 0:00:32
      707500 -- (-803.428) (-793.655) [-799.455] (-795.569) * (-796.601) (-799.011) [-793.028] (-799.136) -- 0:00:32
      708000 -- (-795.221) (-797.524) [-794.840] (-793.777) * (-801.859) [-797.828] (-801.652) (-799.724) -- 0:00:32
      708500 -- (-802.593) (-794.142) [-793.032] (-793.787) * (-798.333) [-801.356] (-794.036) (-799.864) -- 0:00:32
      709000 -- (-794.203) [-795.472] (-796.801) (-799.448) * (-804.263) [-799.388] (-797.095) (-795.018) -- 0:00:32
      709500 -- (-796.593) [-793.990] (-798.557) (-798.750) * (-800.975) (-795.535) (-799.512) [-793.928] -- 0:00:32
      710000 -- (-792.337) (-795.403) (-798.010) [-800.293] * (-799.244) (-807.144) [-798.950] (-796.825) -- 0:00:32

      Average standard deviation of split frequencies: 0.011011

      710500 -- (-796.261) (-797.876) (-798.604) [-793.652] * (-808.691) (-807.130) (-797.154) [-796.395] -- 0:00:32
      711000 -- (-796.837) (-803.766) [-796.884] (-800.876) * (-801.747) (-802.408) (-803.452) [-794.720] -- 0:00:32
      711500 -- (-799.552) [-796.018] (-798.210) (-803.974) * [-797.546] (-796.027) (-803.353) (-800.277) -- 0:00:32
      712000 -- (-795.648) (-794.663) [-794.604] (-797.861) * (-796.738) (-799.166) (-800.279) [-797.206] -- 0:00:32
      712500 -- (-793.984) [-794.750] (-799.909) (-800.627) * (-797.900) (-802.112) [-797.376] (-806.540) -- 0:00:32
      713000 -- [-793.155] (-795.901) (-797.245) (-795.331) * (-803.159) (-798.014) [-799.267] (-802.558) -- 0:00:32
      713500 -- (-800.863) (-795.947) [-796.684] (-794.226) * [-795.100] (-806.099) (-802.036) (-792.413) -- 0:00:32
      714000 -- (-798.183) [-796.430] (-802.132) (-798.906) * (-796.518) [-795.748] (-807.709) (-795.260) -- 0:00:32
      714500 -- (-795.884) [-794.194] (-800.878) (-797.127) * (-796.372) [-795.673] (-794.667) (-797.310) -- 0:00:31
      715000 -- [-798.517] (-802.938) (-799.756) (-796.583) * [-795.999] (-797.968) (-802.846) (-799.195) -- 0:00:31

      Average standard deviation of split frequencies: 0.010534

      715500 -- (-796.225) (-794.710) [-796.410] (-794.623) * (-796.842) (-798.223) [-797.297] (-800.558) -- 0:00:31
      716000 -- (-803.105) [-797.273] (-798.459) (-798.534) * [-800.453] (-794.431) (-797.665) (-799.199) -- 0:00:31
      716500 -- (-800.880) (-794.042) [-795.687] (-792.725) * [-799.328] (-792.704) (-801.196) (-799.324) -- 0:00:31
      717000 -- [-798.863] (-799.307) (-791.931) (-801.036) * [-801.401] (-798.171) (-794.624) (-800.013) -- 0:00:31
      717500 -- [-801.187] (-798.181) (-795.084) (-801.659) * (-798.150) (-793.639) [-795.262] (-799.102) -- 0:00:31
      718000 -- (-798.931) [-797.744] (-798.518) (-804.705) * [-796.991] (-795.981) (-796.535) (-796.346) -- 0:00:31
      718500 -- (-805.128) (-795.977) (-803.125) [-804.409] * (-796.574) [-790.954] (-799.411) (-796.755) -- 0:00:31
      719000 -- (-792.664) [-796.195] (-790.353) (-796.403) * (-808.249) (-794.961) (-797.405) [-795.626] -- 0:00:31
      719500 -- (-799.868) [-791.880] (-796.909) (-792.086) * (-795.251) (-798.944) (-797.453) [-796.633] -- 0:00:31
      720000 -- (-802.636) (-797.017) (-796.932) [-800.444] * (-800.950) (-804.823) (-798.545) [-802.497] -- 0:00:31

      Average standard deviation of split frequencies: 0.010466

      720500 -- [-795.988] (-803.504) (-792.995) (-802.979) * (-800.662) [-798.225] (-801.902) (-802.283) -- 0:00:31
      721000 -- [-798.712] (-811.181) (-796.836) (-799.682) * (-803.694) [-789.710] (-794.879) (-797.297) -- 0:00:31
      721500 -- (-798.313) [-795.443] (-796.874) (-794.856) * [-793.272] (-793.795) (-797.700) (-805.907) -- 0:00:31
      722000 -- [-792.410] (-800.114) (-797.440) (-795.704) * [-795.324] (-800.299) (-805.486) (-800.567) -- 0:00:31
      722500 -- [-796.615] (-799.297) (-792.598) (-805.542) * (-801.143) (-795.284) [-797.653] (-800.985) -- 0:00:31
      723000 -- (-795.899) (-793.698) (-793.866) [-799.289] * [-797.701] (-797.791) (-796.701) (-798.364) -- 0:00:31
      723500 -- (-800.643) (-799.866) [-792.909] (-798.298) * (-800.633) (-805.566) [-794.754] (-797.727) -- 0:00:30
      724000 -- (-794.538) (-799.976) [-794.992] (-798.327) * (-796.083) (-794.869) [-795.781] (-801.265) -- 0:00:30
      724500 -- [-795.584] (-802.243) (-803.517) (-801.160) * (-797.217) [-794.280] (-796.313) (-807.244) -- 0:00:30
      725000 -- [-793.162] (-799.900) (-798.660) (-796.431) * [-797.785] (-799.263) (-794.406) (-805.710) -- 0:00:30

      Average standard deviation of split frequencies: 0.010519

      725500 -- (-799.303) (-799.402) [-793.871] (-798.453) * (-795.653) [-795.977] (-799.772) (-792.097) -- 0:00:30
      726000 -- [-796.554] (-795.749) (-797.066) (-800.172) * (-802.245) (-800.011) [-793.188] (-799.692) -- 0:00:30
      726500 -- (-806.124) (-794.924) (-800.778) [-796.097] * (-795.142) (-797.918) (-799.734) [-793.133] -- 0:00:30
      727000 -- (-794.071) (-797.971) (-797.737) [-793.829] * [-796.235] (-803.665) (-799.137) (-801.052) -- 0:00:30
      727500 -- [-801.131] (-800.186) (-799.476) (-797.425) * [-792.370] (-801.967) (-796.247) (-797.312) -- 0:00:30
      728000 -- (-801.188) (-803.053) [-797.742] (-803.929) * (-793.969) [-793.810] (-795.483) (-791.063) -- 0:00:30
      728500 -- (-797.989) (-798.637) [-796.610] (-799.668) * (-794.433) (-795.176) [-801.105] (-792.398) -- 0:00:30
      729000 -- (-794.825) (-804.886) (-801.929) [-798.673] * (-795.078) (-796.056) [-798.504] (-796.000) -- 0:00:30
      729500 -- (-799.344) (-802.912) (-803.505) [-798.818] * (-794.569) [-796.323] (-802.118) (-798.652) -- 0:00:30
      730000 -- (-794.590) [-798.087] (-794.832) (-805.845) * (-793.042) [-798.256] (-797.446) (-798.298) -- 0:00:30

      Average standard deviation of split frequencies: 0.009549

      730500 -- (-806.137) (-798.488) [-792.223] (-796.675) * (-797.947) (-803.483) (-796.984) [-795.975] -- 0:00:30
      731000 -- (-797.506) (-798.292) [-795.893] (-802.040) * (-795.978) (-795.468) [-807.340] (-801.372) -- 0:00:30
      731500 -- (-805.519) (-799.853) [-797.698] (-795.047) * (-793.163) [-793.429] (-800.540) (-797.566) -- 0:00:30
      732000 -- (-795.334) [-800.065] (-797.042) (-796.072) * [-795.432] (-797.483) (-800.826) (-792.747) -- 0:00:30
      732500 -- (-797.473) [-795.831] (-793.902) (-795.045) * (-794.356) [-799.763] (-799.165) (-797.404) -- 0:00:29
      733000 -- (-799.248) (-792.906) [-795.852] (-796.372) * (-798.340) (-796.949) (-802.339) [-796.700] -- 0:00:29
      733500 -- (-804.124) [-793.580] (-799.331) (-792.870) * (-792.828) [-797.148] (-804.529) (-794.466) -- 0:00:29
      734000 -- (-796.925) [-798.034] (-802.913) (-793.439) * (-795.724) [-789.634] (-796.200) (-791.594) -- 0:00:29
      734500 -- (-796.037) [-802.907] (-793.995) (-796.731) * (-800.370) (-800.326) [-795.093] (-795.059) -- 0:00:29
      735000 -- (-799.670) (-798.606) (-796.822) [-799.586] * (-798.219) [-799.656] (-799.499) (-798.953) -- 0:00:29

      Average standard deviation of split frequencies: 0.009992

      735500 -- (-805.145) (-801.507) (-800.734) [-796.217] * (-799.735) (-796.245) [-800.445] (-799.554) -- 0:00:29
      736000 -- (-795.015) [-796.664] (-801.605) (-797.580) * [-804.759] (-795.529) (-798.606) (-800.423) -- 0:00:29
      736500 -- (-800.240) (-806.040) (-793.859) [-798.336] * (-795.270) (-801.853) (-796.977) [-795.231] -- 0:00:29
      737000 -- (-798.383) (-804.550) [-796.080] (-795.681) * [-795.812] (-803.102) (-796.101) (-799.121) -- 0:00:29
      737500 -- (-800.301) (-798.315) (-797.098) [-794.195] * [-793.580] (-809.698) (-794.831) (-799.939) -- 0:00:29
      738000 -- (-809.364) (-796.485) (-799.353) [-794.929] * (-792.411) (-802.315) (-796.060) [-795.413] -- 0:00:29
      738500 -- (-796.157) (-798.235) (-806.002) [-801.516] * (-796.640) (-802.529) [-802.723] (-799.419) -- 0:00:29
      739000 -- (-796.790) [-793.311] (-797.746) (-796.088) * (-796.989) (-800.410) [-796.810] (-798.449) -- 0:00:29
      739500 -- (-800.883) (-796.356) (-800.372) [-797.686] * (-797.890) (-800.031) (-795.599) [-795.297] -- 0:00:29
      740000 -- (-796.379) (-796.761) (-800.379) [-791.631] * (-794.197) (-804.665) [-794.958] (-795.448) -- 0:00:29

      Average standard deviation of split frequencies: 0.010183

      740500 -- (-795.816) (-792.139) [-796.515] (-796.733) * (-800.949) (-793.288) [-796.509] (-802.753) -- 0:00:29
      741000 -- [-793.492] (-795.292) (-798.179) (-798.587) * (-797.891) [-795.950] (-795.936) (-799.577) -- 0:00:29
      741500 -- (-794.284) (-799.206) (-791.370) [-796.553] * [-801.596] (-798.347) (-802.047) (-795.833) -- 0:00:28
      742000 -- [-797.630] (-804.801) (-793.964) (-797.997) * (-804.218) [-793.754] (-795.289) (-802.686) -- 0:00:28
      742500 -- (-800.156) [-793.915] (-794.703) (-801.723) * (-798.838) [-792.310] (-793.025) (-802.576) -- 0:00:28
      743000 -- (-797.428) (-796.777) (-797.093) [-795.288] * (-799.241) (-799.293) (-799.484) [-798.536] -- 0:00:28
      743500 -- (-797.082) [-801.249] (-798.019) (-795.667) * (-800.577) [-791.010] (-800.389) (-793.917) -- 0:00:28
      744000 -- (-799.258) [-797.992] (-789.404) (-793.928) * (-798.642) [-801.517] (-796.509) (-797.734) -- 0:00:28
      744500 -- (-798.427) (-802.922) [-796.936] (-795.468) * [-797.494] (-795.366) (-797.886) (-797.561) -- 0:00:28
      745000 -- (-805.556) (-793.466) (-799.947) [-800.206] * (-795.360) (-793.698) (-792.232) [-795.776] -- 0:00:28

      Average standard deviation of split frequencies: 0.009984

      745500 -- (-797.047) (-792.340) (-802.025) [-796.293] * [-793.141] (-795.697) (-800.102) (-793.712) -- 0:00:28
      746000 -- (-797.350) [-802.456] (-807.392) (-804.873) * (-794.746) [-802.381] (-793.726) (-800.450) -- 0:00:28
      746500 -- (-794.011) [-793.637] (-805.851) (-800.431) * [-793.889] (-801.194) (-794.665) (-801.756) -- 0:00:28
      747000 -- (-800.987) (-802.712) [-797.600] (-792.841) * [-801.356] (-806.308) (-797.357) (-800.676) -- 0:00:28
      747500 -- (-794.368) [-796.752] (-800.340) (-801.470) * (-804.332) [-805.791] (-794.648) (-798.084) -- 0:00:28
      748000 -- (-794.598) (-792.974) [-799.054] (-797.335) * (-798.884) (-800.976) [-797.844] (-799.721) -- 0:00:28
      748500 -- (-798.756) (-800.918) (-795.674) [-794.191] * [-795.405] (-801.101) (-794.048) (-799.707) -- 0:00:28
      749000 -- (-806.073) [-796.713] (-797.734) (-804.352) * (-796.955) [-797.978] (-799.303) (-794.378) -- 0:00:28
      749500 -- (-799.854) (-803.553) [-792.940] (-800.258) * (-798.494) (-801.267) [-794.033] (-799.536) -- 0:00:28
      750000 -- (-800.118) [-794.695] (-798.342) (-799.223) * (-799.128) (-800.196) (-798.889) [-792.706] -- 0:00:28

      Average standard deviation of split frequencies: 0.010048

      750500 -- [-796.998] (-797.635) (-795.020) (-800.680) * (-800.225) (-794.891) [-793.023] (-793.389) -- 0:00:27
      751000 -- (-801.714) (-794.402) (-800.486) [-796.211] * (-794.585) (-803.072) [-791.005] (-805.704) -- 0:00:27
      751500 -- (-801.412) (-799.011) (-794.538) [-792.063] * (-796.855) [-794.796] (-796.543) (-803.949) -- 0:00:27
      752000 -- (-807.715) (-799.741) (-803.524) [-794.164] * [-805.288] (-795.991) (-793.817) (-799.451) -- 0:00:27
      752500 -- (-793.600) [-799.299] (-802.849) (-799.998) * (-805.722) [-798.765] (-793.128) (-803.491) -- 0:00:27
      753000 -- (-795.324) [-795.040] (-805.901) (-797.974) * [-797.085] (-804.187) (-800.752) (-801.833) -- 0:00:27
      753500 -- (-796.884) (-795.526) (-793.001) [-792.308] * (-799.429) (-795.253) [-800.187] (-796.169) -- 0:00:27
      754000 -- (-792.701) (-795.326) (-797.514) [-802.640] * (-794.349) (-798.385) [-793.963] (-799.741) -- 0:00:27
      754500 -- [-793.842] (-792.530) (-797.464) (-794.083) * (-797.043) (-798.358) [-792.718] (-799.770) -- 0:00:27
      755000 -- [-800.386] (-799.872) (-797.661) (-801.405) * (-799.999) (-793.853) (-796.754) [-800.226] -- 0:00:27

      Average standard deviation of split frequencies: 0.009977

      755500 -- (-804.488) (-792.273) [-795.954] (-797.972) * [-799.833] (-797.419) (-801.278) (-806.733) -- 0:00:27
      756000 -- [-801.137] (-796.033) (-796.155) (-792.863) * [-796.224] (-796.814) (-803.726) (-799.704) -- 0:00:27
      756500 -- [-791.700] (-803.141) (-798.593) (-807.214) * (-800.330) (-796.842) (-804.530) [-795.756] -- 0:00:27
      757000 -- (-798.235) (-796.598) [-796.134] (-793.130) * (-798.048) [-791.323] (-801.003) (-795.562) -- 0:00:27
      757500 -- (-793.606) (-798.493) [-794.735] (-794.084) * (-804.074) [-796.997] (-798.924) (-796.027) -- 0:00:27
      758000 -- (-794.886) [-799.109] (-798.372) (-799.237) * (-796.011) (-802.418) (-800.344) [-795.182] -- 0:00:27
      758500 -- [-795.127] (-794.734) (-802.379) (-798.012) * (-801.714) [-799.520] (-800.518) (-804.995) -- 0:00:27
      759000 -- [-794.325] (-804.877) (-800.521) (-801.520) * (-802.883) (-808.139) [-794.416] (-796.858) -- 0:00:26
      759500 -- (-796.799) (-800.470) (-800.514) [-795.447] * (-803.844) [-796.009] (-799.686) (-801.217) -- 0:00:26
      760000 -- (-804.652) [-797.991] (-799.528) (-793.987) * (-799.203) [-800.741] (-802.857) (-792.543) -- 0:00:26

      Average standard deviation of split frequencies: 0.009916

      760500 -- [-796.378] (-801.179) (-800.084) (-797.561) * (-795.620) (-797.702) [-806.665] (-794.320) -- 0:00:26
      761000 -- (-790.219) [-803.909] (-801.352) (-796.168) * (-794.834) (-794.955) [-799.234] (-796.657) -- 0:00:26
      761500 -- (-793.935) (-796.234) (-795.223) [-792.230] * [-796.733] (-797.372) (-798.064) (-793.908) -- 0:00:26
      762000 -- (-795.169) [-798.528] (-798.017) (-799.052) * (-796.652) (-795.331) (-797.798) [-796.748] -- 0:00:26
      762500 -- [-793.089] (-794.089) (-794.085) (-796.333) * (-797.904) (-793.819) (-798.032) [-797.679] -- 0:00:26
      763000 -- (-800.021) [-795.266] (-796.260) (-803.294) * (-791.377) (-796.530) [-792.686] (-799.709) -- 0:00:26
      763500 -- [-794.356] (-796.752) (-795.781) (-800.242) * [-794.120] (-801.913) (-800.426) (-796.721) -- 0:00:26
      764000 -- (-803.047) (-797.158) (-796.829) [-798.956] * [-793.299] (-813.887) (-796.223) (-798.117) -- 0:00:26
      764500 -- (-798.444) (-797.730) (-800.472) [-799.425] * (-798.286) [-800.347] (-798.918) (-796.477) -- 0:00:26
      765000 -- (-800.657) (-799.019) [-795.167] (-795.760) * (-797.707) (-796.013) (-791.513) [-792.972] -- 0:00:26

      Average standard deviation of split frequencies: 0.008985

      765500 -- (-798.973) (-799.883) [-800.709] (-801.376) * (-796.219) [-797.603] (-797.108) (-800.113) -- 0:00:26
      766000 -- (-804.809) (-800.098) [-794.549] (-803.582) * (-797.868) (-796.323) [-794.948] (-807.985) -- 0:00:26
      766500 -- (-802.628) [-797.757] (-794.351) (-800.714) * (-800.807) (-797.504) (-798.932) [-792.913] -- 0:00:26
      767000 -- (-798.016) (-796.321) [-798.219] (-797.678) * [-792.749] (-800.779) (-795.924) (-792.753) -- 0:00:26
      767500 -- (-806.955) (-792.439) [-796.691] (-808.046) * (-794.419) [-797.091] (-794.754) (-799.233) -- 0:00:26
      768000 -- (-794.355) (-798.078) [-797.942] (-795.851) * (-794.515) (-792.707) [-795.832] (-801.260) -- 0:00:25
      768500 -- (-793.526) [-793.409] (-793.561) (-793.883) * (-803.315) [-796.303] (-798.019) (-800.091) -- 0:00:25
      769000 -- (-801.462) [-797.053] (-792.267) (-798.971) * [-803.273] (-793.937) (-792.775) (-795.526) -- 0:00:25
      769500 -- (-797.751) (-810.092) [-794.848] (-800.078) * (-796.390) (-796.138) [-797.281] (-798.049) -- 0:00:25
      770000 -- (-795.803) (-797.041) [-792.075] (-798.892) * [-790.403] (-799.613) (-796.070) (-796.230) -- 0:00:25

      Average standard deviation of split frequencies: 0.008808

      770500 -- (-801.411) [-795.593] (-799.737) (-801.061) * (-792.921) (-793.039) (-793.055) [-800.393] -- 0:00:25
      771000 -- (-800.582) (-793.010) (-798.142) [-799.662] * (-794.728) (-792.459) [-800.162] (-803.497) -- 0:00:25
      771500 -- (-799.340) [-792.351] (-808.315) (-795.831) * (-808.730) [-798.979] (-792.800) (-796.657) -- 0:00:25
      772000 -- (-798.936) (-805.551) (-798.072) [-796.829] * (-797.351) [-793.931] (-801.940) (-800.780) -- 0:00:25
      772500 -- (-796.660) (-796.128) (-797.275) [-798.504] * (-802.237) (-801.886) [-799.129] (-801.465) -- 0:00:25
      773000 -- (-803.623) (-797.666) (-791.210) [-797.374] * (-797.617) (-803.040) (-798.357) [-799.310] -- 0:00:25
      773500 -- (-796.044) (-799.777) [-797.048] (-793.259) * (-798.421) (-797.582) [-793.207] (-799.058) -- 0:00:25
      774000 -- [-794.416] (-796.447) (-794.744) (-794.656) * (-793.627) [-803.256] (-798.731) (-794.486) -- 0:00:25
      774500 -- (-795.174) (-801.437) (-797.541) [-802.242] * (-804.212) (-807.575) (-795.730) [-801.101] -- 0:00:25
      775000 -- (-798.516) [-802.117] (-794.236) (-796.648) * (-797.673) (-806.249) [-796.259] (-802.893) -- 0:00:25

      Average standard deviation of split frequencies: 0.008991

      775500 -- (-800.127) (-794.343) [-794.202] (-796.255) * (-798.433) (-794.061) [-795.207] (-795.223) -- 0:00:25
      776000 -- [-801.703] (-802.790) (-795.072) (-796.544) * (-801.423) (-795.155) [-798.413] (-796.727) -- 0:00:25
      776500 -- (-797.918) [-796.306] (-804.584) (-801.509) * (-796.159) [-796.863] (-794.263) (-795.397) -- 0:00:25
      777000 -- (-795.977) [-795.019] (-794.441) (-794.764) * (-796.043) (-799.066) (-794.709) [-796.976] -- 0:00:24
      777500 -- [-795.749] (-797.363) (-797.257) (-792.134) * (-800.056) (-798.437) [-795.324] (-806.833) -- 0:00:24
      778000 -- (-800.975) [-799.449] (-793.914) (-797.288) * (-796.114) [-799.743] (-793.440) (-802.930) -- 0:00:24
      778500 -- (-797.483) (-794.535) (-793.820) [-796.819] * (-795.334) (-797.036) [-791.519] (-796.007) -- 0:00:24
      779000 -- (-792.100) (-795.911) (-792.061) [-801.567] * [-792.252] (-802.502) (-791.202) (-806.721) -- 0:00:24
      779500 -- [-798.896] (-798.027) (-797.695) (-798.929) * (-800.295) (-799.397) [-794.258] (-795.284) -- 0:00:24
      780000 -- (-793.729) (-805.490) (-802.780) [-795.615] * (-799.648) (-796.116) [-798.117] (-800.420) -- 0:00:24

      Average standard deviation of split frequencies: 0.008816

      780500 -- (-796.437) [-795.157] (-794.839) (-796.440) * [-796.911] (-791.953) (-797.309) (-795.181) -- 0:00:24
      781000 -- (-800.651) [-801.591] (-798.388) (-797.678) * [-798.081] (-800.585) (-797.182) (-804.185) -- 0:00:24
      781500 -- (-800.224) (-811.962) (-794.662) [-795.222] * [-795.986] (-797.676) (-796.797) (-794.842) -- 0:00:24
      782000 -- (-798.391) (-801.444) [-794.372] (-792.005) * (-796.745) [-806.229] (-803.467) (-797.014) -- 0:00:24
      782500 -- (-798.753) (-813.351) (-793.855) [-796.168] * (-804.279) (-805.690) (-800.659) [-799.735] -- 0:00:24
      783000 -- (-801.549) (-804.530) (-797.285) [-795.342] * (-799.287) (-792.964) (-799.526) [-796.353] -- 0:00:24
      783500 -- [-799.587] (-797.704) (-796.939) (-794.880) * (-800.480) (-795.582) [-799.784] (-797.611) -- 0:00:24
      784000 -- (-796.166) [-798.352] (-793.929) (-799.412) * (-797.791) (-797.136) (-799.685) [-796.756] -- 0:00:24
      784500 -- [-800.988] (-799.711) (-792.860) (-803.210) * (-795.244) (-793.963) [-795.249] (-794.935) -- 0:00:24
      785000 -- (-801.117) (-801.784) [-797.092] (-801.651) * (-800.359) (-798.332) [-798.907] (-793.345) -- 0:00:24

      Average standard deviation of split frequencies: 0.008636

      785500 -- (-794.750) [-792.972] (-797.011) (-799.697) * (-792.873) (-799.179) (-794.547) [-800.079] -- 0:00:24
      786000 -- [-797.395] (-800.430) (-798.338) (-791.734) * [-799.878] (-799.958) (-800.922) (-802.629) -- 0:00:23
      786500 -- (-803.034) (-801.199) [-803.218] (-791.428) * [-796.785] (-797.177) (-804.316) (-796.724) -- 0:00:23
      787000 -- (-794.520) [-799.560] (-800.137) (-798.781) * (-798.661) (-807.430) [-802.602] (-797.458) -- 0:00:23
      787500 -- (-796.780) (-800.584) (-795.166) [-794.493] * (-798.825) [-797.199] (-801.189) (-801.883) -- 0:00:23
      788000 -- (-794.710) (-794.738) [-799.182] (-796.112) * (-802.205) (-798.610) (-801.438) [-796.584] -- 0:00:23
      788500 -- (-800.453) (-796.519) (-802.837) [-798.775] * (-801.596) (-794.234) (-804.219) [-798.096] -- 0:00:23
      789000 -- (-801.107) (-797.081) (-794.463) [-797.831] * (-797.981) (-796.252) (-800.824) [-798.136] -- 0:00:23
      789500 -- (-800.123) (-794.893) [-794.879] (-798.792) * [-793.830] (-796.290) (-793.703) (-796.208) -- 0:00:23
      790000 -- [-790.637] (-803.622) (-796.244) (-802.438) * (-794.719) (-798.740) (-795.855) [-794.355] -- 0:00:23

      Average standard deviation of split frequencies: 0.008466

      790500 -- (-801.660) (-799.500) (-800.136) [-795.141] * [-796.915] (-795.846) (-796.828) (-800.683) -- 0:00:23
      791000 -- [-795.389] (-796.683) (-793.967) (-793.687) * (-796.781) (-798.384) (-796.984) [-794.026] -- 0:00:23
      791500 -- (-794.508) (-801.338) [-795.341] (-796.307) * (-799.503) (-798.253) [-803.788] (-796.987) -- 0:00:23
      792000 -- (-800.776) [-795.061] (-798.779) (-798.789) * (-796.298) [-793.279] (-807.790) (-800.135) -- 0:00:23
      792500 -- [-800.210] (-809.275) (-798.229) (-801.138) * [-798.143] (-798.511) (-798.477) (-800.169) -- 0:00:23
      793000 -- (-801.035) (-801.830) [-795.767] (-793.631) * (-797.187) (-797.961) [-793.522] (-804.878) -- 0:00:23
      793500 -- (-807.445) (-795.193) [-793.156] (-802.611) * (-802.673) (-792.486) [-798.199] (-799.315) -- 0:00:23
      794000 -- (-800.251) [-792.993] (-792.320) (-792.849) * [-800.819] (-806.439) (-797.743) (-797.527) -- 0:00:23
      794500 -- (-798.896) [-800.057] (-795.617) (-804.961) * [-795.756] (-798.691) (-795.205) (-797.167) -- 0:00:23
      795000 -- (-791.599) (-796.340) (-794.940) [-800.672] * [-795.773] (-796.384) (-796.720) (-804.365) -- 0:00:22

      Average standard deviation of split frequencies: 0.007817

      795500 -- (-795.658) (-793.938) [-796.604] (-797.705) * [-799.144] (-797.249) (-801.294) (-798.201) -- 0:00:22
      796000 -- (-797.183) (-802.767) (-804.119) [-803.096] * (-799.424) (-798.622) [-798.419] (-808.226) -- 0:00:22
      796500 -- (-793.753) (-798.594) (-795.079) [-802.605] * (-799.246) (-798.267) (-812.369) [-794.647] -- 0:00:22
      797000 -- (-796.557) [-802.506] (-801.037) (-793.813) * (-795.843) [-794.857] (-802.706) (-798.200) -- 0:00:22
      797500 -- (-796.221) [-797.433] (-798.741) (-798.510) * [-794.543] (-795.092) (-800.776) (-792.561) -- 0:00:22
      798000 -- (-796.702) (-798.477) [-800.881] (-795.163) * (-796.239) (-797.091) (-801.047) [-796.096] -- 0:00:22
      798500 -- (-797.282) [-798.841] (-802.598) (-800.674) * (-800.474) [-794.388] (-802.523) (-799.469) -- 0:00:22
      799000 -- (-793.565) (-797.251) [-795.133] (-798.466) * (-799.544) (-802.559) [-797.174] (-795.822) -- 0:00:22
      799500 -- [-793.227] (-800.556) (-801.761) (-803.967) * (-792.783) (-793.215) (-798.551) [-799.840] -- 0:00:22
      800000 -- (-793.511) (-795.981) (-797.831) [-798.852] * (-796.047) [-794.924] (-794.334) (-800.668) -- 0:00:22

      Average standard deviation of split frequencies: 0.006712

      800500 -- (-799.693) [-795.700] (-802.927) (-793.792) * (-797.976) [-796.224] (-797.721) (-801.284) -- 0:00:22
      801000 -- (-802.964) [-793.829] (-796.529) (-796.246) * (-803.130) [-796.416] (-796.747) (-792.062) -- 0:00:22
      801500 -- (-798.822) [-800.606] (-795.318) (-797.403) * (-795.426) [-800.200] (-798.002) (-796.000) -- 0:00:22
      802000 -- [-797.890] (-797.334) (-800.914) (-796.561) * (-794.602) (-793.405) (-804.708) [-790.836] -- 0:00:22
      802500 -- (-795.575) [-798.980] (-800.166) (-800.161) * [-794.327] (-800.552) (-797.264) (-796.486) -- 0:00:22
      803000 -- [-803.751] (-794.372) (-799.604) (-797.645) * (-796.989) (-806.350) (-794.845) [-795.657] -- 0:00:22
      803500 -- (-802.236) (-792.240) (-799.952) [-793.928] * (-794.294) (-797.485) (-808.762) [-794.321] -- 0:00:22
      804000 -- (-796.200) [-795.058] (-797.688) (-799.089) * (-794.885) (-794.334) (-800.704) [-797.152] -- 0:00:21
      804500 -- (-794.826) (-798.217) (-796.447) [-792.233] * (-795.658) [-795.419] (-801.730) (-797.833) -- 0:00:21
      805000 -- [-798.797] (-802.892) (-799.303) (-795.433) * [-794.232] (-794.760) (-794.379) (-805.229) -- 0:00:21

      Average standard deviation of split frequencies: 0.007135

      805500 -- (-805.680) (-796.347) (-800.386) [-793.452] * (-797.335) [-798.654] (-795.994) (-793.848) -- 0:00:21
      806000 -- [-793.969] (-795.712) (-795.518) (-797.668) * (-799.863) (-805.228) (-800.886) [-793.976] -- 0:00:21
      806500 -- [-792.588] (-794.812) (-801.588) (-794.865) * (-799.350) [-795.046] (-798.656) (-790.836) -- 0:00:21
      807000 -- (-795.776) (-797.338) (-797.641) [-797.686] * (-797.267) [-794.203] (-804.172) (-798.266) -- 0:00:21
      807500 -- (-799.344) [-805.361] (-797.255) (-797.056) * (-796.695) [-794.571] (-801.172) (-803.390) -- 0:00:21
      808000 -- (-793.918) (-798.402) (-801.754) [-790.705] * (-796.282) (-803.297) [-797.241] (-802.195) -- 0:00:21
      808500 -- (-798.249) [-796.364] (-793.047) (-798.445) * [-797.948] (-796.136) (-794.477) (-805.553) -- 0:00:21
      809000 -- (-801.307) (-798.551) (-794.356) [-795.593] * (-796.467) (-798.490) [-799.504] (-796.192) -- 0:00:21
      809500 -- [-789.854] (-801.486) (-796.999) (-793.271) * (-799.007) (-796.534) [-793.600] (-792.624) -- 0:00:21
      810000 -- [-796.830] (-797.105) (-794.316) (-796.962) * [-802.526] (-794.282) (-794.668) (-798.314) -- 0:00:21

      Average standard deviation of split frequencies: 0.007211

      810500 -- [-792.574] (-806.202) (-798.496) (-798.144) * (-798.533) (-803.420) (-797.127) [-799.556] -- 0:00:21
      811000 -- (-804.521) (-808.216) [-795.628] (-791.757) * (-801.999) (-802.272) [-794.147] (-798.111) -- 0:00:21
      811500 -- (-803.137) (-801.671) (-794.451) [-798.407] * (-793.308) [-795.686] (-801.917) (-794.947) -- 0:00:21
      812000 -- [-793.877] (-798.384) (-804.444) (-794.471) * (-801.885) [-795.773] (-795.872) (-797.273) -- 0:00:21
      812500 -- (-799.908) (-799.926) (-799.386) [-793.529] * (-802.574) [-792.526] (-798.904) (-794.533) -- 0:00:21
      813000 -- (-795.967) (-795.277) [-798.770] (-797.445) * (-795.366) (-796.364) [-795.584] (-797.569) -- 0:00:20
      813500 -- (-794.243) (-795.816) (-795.337) [-796.489] * (-801.008) (-795.122) [-795.432] (-802.440) -- 0:00:20
      814000 -- (-792.154) [-793.594] (-797.589) (-799.431) * (-800.384) (-802.139) [-795.209] (-799.601) -- 0:00:20
      814500 -- (-797.859) (-798.108) [-799.932] (-795.264) * (-798.849) (-801.292) [-795.057] (-796.566) -- 0:00:20
      815000 -- (-795.526) [-798.104] (-801.890) (-795.949) * (-801.070) (-796.535) (-795.248) [-799.999] -- 0:00:20

      Average standard deviation of split frequencies: 0.007048

      815500 -- (-792.766) [-799.986] (-805.057) (-798.453) * (-801.738) (-795.261) (-800.647) [-796.041] -- 0:00:20
      816000 -- (-802.632) (-794.802) [-799.018] (-797.401) * (-800.511) [-796.061] (-794.526) (-796.627) -- 0:00:20
      816500 -- [-794.832] (-793.905) (-794.745) (-797.076) * (-795.782) (-799.507) (-794.403) [-797.076] -- 0:00:20
      817000 -- (-800.157) (-798.879) (-796.693) [-798.107] * [-797.853] (-800.663) (-795.061) (-801.950) -- 0:00:20
      817500 -- [-799.149] (-796.951) (-797.881) (-795.878) * (-797.581) [-793.005] (-791.872) (-794.480) -- 0:00:20
      818000 -- [-799.260] (-800.195) (-797.452) (-799.628) * (-797.009) [-801.225] (-798.131) (-795.539) -- 0:00:20
      818500 -- (-798.598) (-797.649) (-804.235) [-792.493] * (-795.250) (-798.195) (-796.045) [-796.717] -- 0:00:20
      819000 -- (-804.251) (-798.050) (-807.299) [-798.647] * [-793.635] (-803.343) (-803.967) (-797.173) -- 0:00:20
      819500 -- [-797.186] (-795.411) (-800.975) (-801.885) * (-794.446) (-794.337) (-797.743) [-796.063] -- 0:00:20
      820000 -- (-802.651) [-794.295] (-805.891) (-800.280) * (-796.900) [-795.621] (-800.187) (-802.711) -- 0:00:20

      Average standard deviation of split frequencies: 0.007123

      820500 -- [-792.588] (-794.438) (-807.176) (-798.920) * (-798.366) (-794.679) (-797.075) [-802.261] -- 0:00:20
      821000 -- (-797.746) (-796.651) (-801.012) [-798.760] * [-797.391] (-797.441) (-800.172) (-797.753) -- 0:00:20
      821500 -- (-798.779) [-804.417] (-803.735) (-793.020) * (-796.243) (-799.089) (-797.398) [-794.980] -- 0:00:19
      822000 -- (-798.621) [-796.192] (-799.659) (-791.476) * [-790.978] (-790.492) (-799.991) (-797.346) -- 0:00:19
      822500 -- (-795.878) [-795.537] (-798.474) (-797.129) * [-804.837] (-804.499) (-800.450) (-797.871) -- 0:00:19
      823000 -- [-794.746] (-799.801) (-800.324) (-792.755) * (-801.838) (-801.394) (-799.626) [-795.853] -- 0:00:19
      823500 -- (-793.487) (-798.343) (-801.111) [-799.001] * (-795.797) (-806.262) [-797.668] (-795.452) -- 0:00:19
      824000 -- [-792.211] (-798.789) (-804.278) (-801.120) * [-797.204] (-806.807) (-792.151) (-801.022) -- 0:00:19
      824500 -- (-798.695) [-793.962] (-798.471) (-795.788) * (-795.896) (-800.780) (-797.658) [-795.284] -- 0:00:19
      825000 -- [-792.330] (-798.478) (-794.716) (-792.088) * (-802.063) (-795.987) [-797.528] (-795.645) -- 0:00:19

      Average standard deviation of split frequencies: 0.007533

      825500 -- (-798.930) [-798.548] (-800.960) (-795.721) * [-798.483] (-802.869) (-797.359) (-801.348) -- 0:00:19
      826000 -- (-796.085) (-797.696) [-801.181] (-797.970) * (-802.194) (-794.333) (-803.321) [-791.447] -- 0:00:19
      826500 -- [-799.782] (-800.372) (-796.187) (-800.776) * (-800.951) (-798.631) (-794.754) [-795.213] -- 0:00:19
      827000 -- (-796.729) (-796.214) (-798.623) [-793.836] * (-798.317) [-797.683] (-798.759) (-800.685) -- 0:00:19
      827500 -- (-797.609) (-803.728) (-802.445) [-797.322] * (-793.624) [-800.220] (-807.525) (-805.563) -- 0:00:19
      828000 -- (-801.505) (-805.113) (-797.202) [-800.837] * (-802.879) (-801.482) [-795.413] (-806.420) -- 0:00:19
      828500 -- (-799.958) (-797.634) [-796.225] (-798.952) * (-794.737) [-802.828] (-798.729) (-805.869) -- 0:00:19
      829000 -- (-799.876) [-794.396] (-794.416) (-790.559) * [-796.277] (-795.756) (-801.937) (-803.770) -- 0:00:19
      829500 -- [-795.360] (-800.508) (-808.073) (-796.993) * (-799.186) (-798.008) [-790.976] (-805.229) -- 0:00:19
      830000 -- (-792.754) (-803.573) (-801.241) [-793.799] * (-796.680) [-797.201] (-798.391) (-801.513) -- 0:00:19

      Average standard deviation of split frequencies: 0.007832

      830500 -- (-802.029) (-796.126) [-792.707] (-794.103) * (-799.354) [-799.436] (-794.158) (-802.352) -- 0:00:18
      831000 -- (-796.950) [-793.807] (-802.488) (-804.988) * (-798.873) [-796.631] (-792.779) (-798.305) -- 0:00:18
      831500 -- (-794.541) (-794.066) (-803.644) [-794.868] * (-801.819) (-797.708) [-796.327] (-799.891) -- 0:00:18
      832000 -- (-798.093) (-799.765) (-800.873) [-795.233] * (-804.833) [-794.691] (-797.808) (-800.580) -- 0:00:18
      832500 -- [-799.273] (-801.444) (-798.618) (-806.077) * (-799.798) [-806.640] (-799.062) (-795.568) -- 0:00:18
      833000 -- [-799.558] (-796.855) (-795.163) (-794.801) * (-797.602) (-793.874) [-798.631] (-799.142) -- 0:00:18
      833500 -- (-797.052) (-797.192) [-801.122] (-802.410) * (-796.099) (-799.280) (-803.303) [-798.289] -- 0:00:18
      834000 -- (-801.976) (-798.424) (-790.667) [-797.188] * [-797.398] (-798.662) (-800.374) (-793.296) -- 0:00:18
      834500 -- (-798.335) (-794.834) (-799.141) [-799.729] * (-798.056) [-795.788] (-803.232) (-799.212) -- 0:00:18
      835000 -- (-796.351) [-799.440] (-801.338) (-794.076) * (-796.532) [-800.906] (-799.282) (-802.035) -- 0:00:18

      Average standard deviation of split frequencies: 0.007443

      835500 -- (-803.515) (-800.945) [-796.310] (-795.334) * (-795.698) [-797.623] (-805.286) (-796.230) -- 0:00:18
      836000 -- [-793.742] (-796.748) (-799.360) (-802.033) * (-798.740) (-792.645) (-801.306) [-793.734] -- 0:00:18
      836500 -- (-797.751) [-806.733] (-813.250) (-797.659) * (-800.419) [-796.733] (-799.230) (-793.282) -- 0:00:18
      837000 -- [-804.397] (-796.911) (-798.166) (-798.669) * [-798.541] (-795.998) (-800.777) (-799.230) -- 0:00:18
      837500 -- [-797.276] (-793.716) (-797.455) (-797.969) * (-798.141) (-799.233) (-795.903) [-801.392] -- 0:00:18
      838000 -- (-795.148) [-796.149] (-802.226) (-796.729) * (-797.696) [-794.491] (-798.239) (-798.208) -- 0:00:18
      838500 -- (-798.078) (-794.405) (-794.227) [-799.590] * (-796.232) (-795.681) [-793.934] (-795.214) -- 0:00:18
      839000 -- (-802.418) (-793.815) [-792.906] (-797.619) * (-802.203) (-796.939) [-796.997] (-797.389) -- 0:00:18
      839500 -- (-805.287) [-799.956] (-801.760) (-793.995) * (-796.894) (-796.276) (-798.029) [-796.698] -- 0:00:17
      840000 -- (-803.533) (-796.398) (-798.871) [-793.621] * (-796.213) [-804.233] (-795.419) (-794.824) -- 0:00:17

      Average standard deviation of split frequencies: 0.008523

      840500 -- (-793.730) (-797.381) [-795.253] (-796.728) * (-796.903) [-800.118] (-796.667) (-801.147) -- 0:00:17
      841000 -- [-800.790] (-796.943) (-798.043) (-797.069) * (-794.004) (-801.119) [-803.896] (-804.503) -- 0:00:17
      841500 -- (-801.816) [-801.923] (-802.144) (-793.741) * (-801.079) [-795.664] (-795.270) (-802.522) -- 0:00:17
      842000 -- (-804.072) [-795.205] (-804.489) (-797.162) * [-795.068] (-800.353) (-797.507) (-791.920) -- 0:00:17
      842500 -- (-796.564) (-797.869) [-797.959] (-795.554) * (-798.152) (-801.728) (-798.904) [-793.368] -- 0:00:17
      843000 -- (-800.807) (-800.533) [-797.823] (-800.052) * (-796.694) [-799.777] (-796.927) (-793.071) -- 0:00:17
      843500 -- (-803.262) (-796.166) [-795.896] (-797.933) * (-796.391) [-795.264] (-803.227) (-795.820) -- 0:00:17
      844000 -- (-794.936) (-795.130) (-794.310) [-796.081] * (-800.552) (-795.238) [-795.562] (-793.403) -- 0:00:17
      844500 -- [-796.304] (-795.035) (-799.193) (-796.314) * (-798.967) [-794.128] (-805.678) (-796.931) -- 0:00:17
      845000 -- (-800.660) (-796.165) (-800.642) [-799.067] * (-795.336) (-798.016) [-795.469] (-798.675) -- 0:00:17

      Average standard deviation of split frequencies: 0.008915

      845500 -- (-798.701) (-795.604) (-805.445) [-798.725] * [-795.088] (-798.668) (-800.034) (-800.373) -- 0:00:17
      846000 -- (-796.667) (-790.293) [-796.315] (-791.103) * (-796.151) (-794.822) [-797.284] (-797.081) -- 0:00:17
      846500 -- [-791.461] (-793.211) (-793.277) (-797.767) * [-803.089] (-796.541) (-801.585) (-797.260) -- 0:00:17
      847000 -- (-797.995) (-795.214) (-797.073) [-797.201] * [-800.935] (-795.511) (-793.653) (-800.737) -- 0:00:17
      847500 -- (-807.227) (-799.345) [-794.128] (-800.534) * [-793.822] (-796.888) (-796.331) (-796.902) -- 0:00:17
      848000 -- (-796.258) (-793.882) [-795.647] (-797.420) * [-795.556] (-808.016) (-794.158) (-801.649) -- 0:00:17
      848500 -- (-799.660) [-795.858] (-797.828) (-793.827) * (-800.782) (-802.485) (-804.806) [-796.626] -- 0:00:16
      849000 -- (-797.995) [-792.120] (-800.657) (-791.493) * (-796.251) (-794.344) (-798.394) [-799.971] -- 0:00:16
      849500 -- [-802.193] (-796.615) (-800.674) (-801.485) * (-795.198) (-794.535) [-793.144] (-801.905) -- 0:00:16
      850000 -- (-797.560) [-792.551] (-802.101) (-802.839) * (-798.623) [-793.788] (-794.969) (-794.242) -- 0:00:16

      Average standard deviation of split frequencies: 0.008756

      850500 -- (-795.987) [-790.397] (-796.271) (-801.141) * [-794.069] (-804.001) (-804.516) (-799.651) -- 0:00:16
      851000 -- [-797.335] (-795.477) (-799.868) (-796.238) * (-797.517) [-794.250] (-802.665) (-798.061) -- 0:00:16
      851500 -- (-798.899) [-805.281] (-801.747) (-802.907) * (-797.749) (-791.686) [-796.488] (-795.739) -- 0:00:16
      852000 -- (-801.549) (-792.838) (-805.016) [-794.965] * (-795.822) (-797.610) [-796.069] (-810.179) -- 0:00:16
      852500 -- [-797.195] (-796.479) (-797.223) (-794.969) * (-802.700) (-792.798) [-794.833] (-798.019) -- 0:00:16
      853000 -- (-804.459) (-799.153) (-796.893) [-791.806] * (-797.353) (-797.681) (-801.613) [-793.326] -- 0:00:16
      853500 -- (-802.119) (-795.995) (-796.251) [-792.799] * (-799.177) (-801.640) [-799.344] (-797.560) -- 0:00:16
      854000 -- (-796.836) (-797.153) (-799.103) [-796.409] * (-798.754) (-799.671) [-794.640] (-803.587) -- 0:00:16
      854500 -- [-796.444] (-794.428) (-797.385) (-792.667) * (-794.014) (-796.853) [-796.815] (-791.610) -- 0:00:16
      855000 -- (-797.117) (-800.439) (-800.101) [-796.885] * (-803.942) [-792.735] (-797.335) (-791.254) -- 0:00:16

      Average standard deviation of split frequencies: 0.009032

      855500 -- (-791.554) (-804.813) (-796.458) [-800.725] * [-797.231] (-795.879) (-794.205) (-796.940) -- 0:00:16
      856000 -- (-796.971) [-800.214] (-798.103) (-802.348) * (-802.097) (-791.294) [-793.792] (-796.601) -- 0:00:16
      856500 -- (-801.310) (-792.671) (-797.835) [-797.670] * (-797.203) [-795.092] (-798.269) (-799.171) -- 0:00:16
      857000 -- [-797.660] (-792.860) (-801.390) (-803.631) * (-803.493) (-800.059) (-800.347) [-791.144] -- 0:00:16
      857500 -- (-805.931) [-791.994] (-804.041) (-810.703) * (-801.329) [-797.470] (-792.304) (-804.812) -- 0:00:15
      858000 -- (-803.163) (-799.665) (-794.267) [-795.754] * (-794.947) [-798.043] (-798.780) (-797.475) -- 0:00:15
      858500 -- [-798.467] (-797.569) (-804.039) (-792.563) * (-796.325) (-804.116) (-799.319) [-792.852] -- 0:00:15
      859000 -- (-792.993) [-796.254] (-799.429) (-804.237) * (-797.142) (-798.990) (-800.363) [-796.196] -- 0:00:15
      859500 -- [-800.015] (-793.878) (-793.508) (-796.590) * (-799.465) (-796.417) [-797.057] (-805.311) -- 0:00:15
      860000 -- (-800.773) [-804.861] (-800.056) (-800.719) * (-800.564) (-799.154) (-800.355) [-802.012] -- 0:00:15

      Average standard deviation of split frequencies: 0.009092

      860500 -- (-797.871) (-798.350) [-792.343] (-795.549) * (-793.406) (-792.996) (-798.220) [-799.040] -- 0:00:15
      861000 -- (-799.860) (-793.693) (-796.706) [-798.554] * [-793.312] (-791.406) (-795.422) (-802.081) -- 0:00:15
      861500 -- [-796.751] (-801.933) (-802.481) (-805.932) * (-796.015) (-791.280) [-792.168] (-795.840) -- 0:00:15
      862000 -- (-798.601) (-795.757) (-797.684) [-796.262] * (-800.254) [-794.290] (-798.861) (-794.961) -- 0:00:15
      862500 -- (-797.606) (-791.884) [-800.034] (-801.605) * (-797.216) [-796.289] (-795.162) (-797.882) -- 0:00:15
      863000 -- [-796.748] (-801.704) (-793.675) (-794.059) * (-799.558) (-796.880) [-795.109] (-794.000) -- 0:00:15
      863500 -- (-796.957) (-797.405) [-796.684] (-794.405) * (-808.759) (-792.968) [-794.155] (-801.528) -- 0:00:15
      864000 -- (-801.138) [-795.515] (-797.665) (-795.579) * (-798.822) (-795.893) [-801.106] (-796.602) -- 0:00:15
      864500 -- (-798.942) (-800.229) (-800.192) [-795.009] * [-797.490] (-796.251) (-795.918) (-795.626) -- 0:00:15
      865000 -- (-800.191) (-797.211) [-796.725] (-798.452) * (-804.556) (-794.144) [-797.472] (-796.871) -- 0:00:15

      Average standard deviation of split frequencies: 0.009581

      865500 -- (-795.276) [-794.132] (-801.425) (-804.602) * [-796.137] (-796.470) (-800.160) (-791.985) -- 0:00:15
      866000 -- (-799.855) (-797.998) [-796.158] (-797.153) * (-795.357) (-796.391) (-794.152) [-793.973] -- 0:00:15
      866500 -- (-800.054) (-805.254) [-798.776] (-799.623) * (-800.213) (-794.218) [-791.283] (-797.339) -- 0:00:14
      867000 -- [-796.753] (-799.837) (-797.537) (-803.911) * (-797.378) (-798.552) [-797.705] (-796.046) -- 0:00:14
      867500 -- (-801.075) (-798.624) (-795.576) [-795.673] * [-791.940] (-806.997) (-795.936) (-804.702) -- 0:00:14
      868000 -- (-807.543) (-796.101) (-795.789) [-797.476] * (-801.034) (-792.757) (-797.497) [-795.747] -- 0:00:14
      868500 -- (-800.572) (-804.624) [-795.745] (-804.190) * (-799.895) (-793.609) [-796.061] (-797.091) -- 0:00:14
      869000 -- (-803.062) (-799.285) (-794.806) [-793.671] * [-795.323] (-798.599) (-798.993) (-793.671) -- 0:00:14
      869500 -- (-797.314) (-801.163) (-797.120) [-799.372] * (-799.615) (-797.353) [-800.951] (-796.890) -- 0:00:14
      870000 -- (-794.104)