--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:48:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2359/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1084.57 -1087.26
2 -1084.63 -1087.75
--------------------------------------
TOTAL -1084.60 -1087.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906501 0.088721 0.398354 1.526107 0.874581 1358.58 1429.79 1.002
r(A<->C){all} 0.164771 0.017856 0.000004 0.432517 0.131971 258.74 281.21 1.000
r(A<->G){all} 0.170833 0.019332 0.000038 0.446101 0.139209 198.21 270.59 1.002
r(A<->T){all} 0.184000 0.024146 0.000130 0.498017 0.140291 192.80 197.25 1.001
r(C<->G){all} 0.155486 0.019446 0.000032 0.450868 0.117257 174.46 203.59 1.000
r(C<->T){all} 0.154445 0.017156 0.000041 0.424082 0.121694 269.03 284.98 1.004
r(G<->T){all} 0.170465 0.020300 0.000020 0.462038 0.134338 147.96 179.32 1.006
pi(A){all} 0.221170 0.000217 0.191885 0.250276 0.220703 1109.05 1169.88 1.000
pi(C){all} 0.242604 0.000225 0.214190 0.272717 0.242524 1159.16 1267.44 1.001
pi(G){all} 0.274599 0.000244 0.245259 0.306715 0.274110 1010.67 1148.67 1.000
pi(T){all} 0.261627 0.000232 0.234159 0.294011 0.261062 1191.68 1248.85 1.001
alpha{1,2} 0.423876 0.242447 0.000171 1.396295 0.256191 1153.36 1232.82 1.000
alpha{3} 0.499297 0.300309 0.000533 1.545741 0.314733 1240.60 1244.60 1.000
pinvar{all} 0.998028 0.000005 0.993630 0.999998 0.998732 1261.48 1323.34 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1057.960283
Model 2: PositiveSelection -1057.960283
Model 0: one-ratio -1057.960556
Model 7: beta -1057.960283
Model 8: beta&w>1 -1057.960283
Model 0 vs 1 5.460000002130982E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C2
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C3
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C4
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C5
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C6
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=261
C1 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C2 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C3 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C4 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C5 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C6 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
**************************************************
C1 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C2 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C3 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C4 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C5 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C6 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
**************************************************
C1 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C2 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C3 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C4 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C5 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C6 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
**************************************************
C1 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C2 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C3 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C4 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C5 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C6 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
**************************************************
C1 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C2 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C3 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C4 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C5 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C6 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
**************************************************
C1 EDKTLEWCDRA
C2 EDKTLEWCDRA
C3 EDKTLEWCDRA
C4 EDKTLEWCDRA
C5 EDKTLEWCDRA
C6 EDKTLEWCDRA
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 261 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 261 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7830]--->[7830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.816 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C2 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C3 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C4 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C5 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
C6 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
**************************************************
C1 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C2 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C3 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C4 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C5 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
C6 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
**************************************************
C1 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C2 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C3 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C4 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C5 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
C6 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
**************************************************
C1 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C2 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C3 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C4 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C5 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
C6 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
**************************************************
C1 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C2 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C3 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C4 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C5 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
C6 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
**************************************************
C1 EDKTLEWCDRA
C2 EDKTLEWCDRA
C3 EDKTLEWCDRA
C4 EDKTLEWCDRA
C5 EDKTLEWCDRA
C6 EDKTLEWCDRA
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
C2 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
C3 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
C4 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
C5 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
C6 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
**************************************************
C1 GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
C2 GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
C3 GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
C4 GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
C5 GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
C6 GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
**************************************************
C1 TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
C2 TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
C3 TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
C4 TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
C5 TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
C6 TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
**************************************************
C1 TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
C2 TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
C3 TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
C4 TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
C5 TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
C6 TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
**************************************************
C1 TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
C2 TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
C3 TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
C4 TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
C5 TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
C6 TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
**************************************************
C1 TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
C2 TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
C3 TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
C4 TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
C5 TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
C6 TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
**************************************************
C1 TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
C2 TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
C3 TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
C4 TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
C5 TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
C6 TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
**************************************************
C1 CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
C2 CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
C3 CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
C4 CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
C5 CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
C6 CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
**************************************************
C1 CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
C2 CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
C3 CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
C4 CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
C5 CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
C6 CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
**************************************************
C1 ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
C2 ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
C3 ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
C4 ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
C5 ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
C6 ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
**************************************************
C1 GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
C2 GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
C3 GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
C4 GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
C5 GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
C6 GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
**************************************************
C1 TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
C2 TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
C3 TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
C4 TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
C5 TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
C6 TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
**************************************************
C1 TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
C2 TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
C3 TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
C4 TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
C5 TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
C6 TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
**************************************************
C1 GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
C2 GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
C3 GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
C4 GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
C5 GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
C6 GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
**************************************************
C1 GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
C2 GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
C3 GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
C4 GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
C5 GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
C6 GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
**************************************************
C1 GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
C2 GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
C3 GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
C4 GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
C5 GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
C6 GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
*********************************
>C1
ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>C2
ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>C3
ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>C4
ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>C5
ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>C6
ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC
GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT
TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG
TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA
TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA
TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT
TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT
CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG
CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT
ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA
GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA
TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT
TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA
GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG
GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA
GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>C1
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C2
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C3
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C4
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C5
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
>C6
MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
EDKTLEWCDRA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 783 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855600
Setting output file names to "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1374648218
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5263563589
Seed = 508282465
Swapseed = 1579855600
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1752.391535 -- -24.965149
Chain 2 -- -1752.391433 -- -24.965149
Chain 3 -- -1752.391535 -- -24.965149
Chain 4 -- -1752.391535 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1752.391433 -- -24.965149
Chain 2 -- -1752.391535 -- -24.965149
Chain 3 -- -1752.391268 -- -24.965149
Chain 4 -- -1752.391433 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1752.392] (-1752.391) (-1752.392) (-1752.392) * [-1752.391] (-1752.392) (-1752.391) (-1752.391)
500 -- (-1099.672) [-1104.685] (-1095.627) (-1091.352) * (-1092.606) (-1100.177) (-1096.812) [-1090.473] -- 0:00:00
1000 -- (-1095.857) [-1090.747] (-1099.128) (-1091.372) * (-1096.665) (-1096.010) [-1088.853] (-1093.421) -- 0:00:00
1500 -- (-1093.354) [-1089.586] (-1093.857) (-1096.463) * [-1094.792] (-1097.373) (-1097.324) (-1089.856) -- 0:00:00
2000 -- (-1090.696) (-1095.215) [-1094.301] (-1094.098) * [-1090.227] (-1098.180) (-1114.613) (-1093.397) -- 0:00:00
2500 -- (-1091.940) (-1099.113) [-1095.681] (-1091.008) * (-1094.875) (-1105.412) (-1103.945) [-1093.846] -- 0:00:00
3000 -- [-1091.701] (-1091.226) (-1090.330) (-1095.956) * [-1092.849] (-1094.295) (-1091.889) (-1094.383) -- 0:00:00
3500 -- (-1102.090) (-1094.196) [-1099.351] (-1093.945) * (-1088.001) (-1093.255) [-1089.310] (-1092.637) -- 0:00:00
4000 -- (-1099.592) (-1094.620) [-1095.351] (-1097.852) * (-1095.489) (-1100.225) [-1094.200] (-1098.429) -- 0:00:00
4500 -- [-1092.206] (-1096.735) (-1091.848) (-1098.005) * (-1089.744) (-1092.794) (-1092.557) [-1092.542] -- 0:00:00
5000 -- [-1091.702] (-1088.886) (-1099.807) (-1091.255) * [-1092.577] (-1092.145) (-1102.261) (-1101.010) -- 0:00:00
Average standard deviation of split frequencies: 0.089791
5500 -- (-1089.883) [-1088.909] (-1099.624) (-1091.712) * [-1095.782] (-1101.758) (-1099.684) (-1089.544) -- 0:00:00
6000 -- [-1098.277] (-1093.154) (-1097.873) (-1095.137) * (-1091.398) (-1095.535) [-1093.821] (-1093.641) -- 0:02:45
6500 -- (-1095.684) (-1093.525) (-1090.305) [-1092.744] * (-1091.579) [-1092.427] (-1093.283) (-1096.658) -- 0:02:32
7000 -- (-1101.964) (-1092.078) [-1096.404] (-1089.818) * (-1099.704) (-1098.336) [-1091.591] (-1094.823) -- 0:02:21
7500 -- (-1096.118) (-1096.356) [-1093.701] (-1093.199) * [-1094.197] (-1090.856) (-1096.448) (-1100.609) -- 0:02:12
8000 -- (-1098.667) (-1095.618) [-1098.091] (-1089.285) * (-1093.748) [-1090.767] (-1098.267) (-1097.326) -- 0:02:04
8500 -- [-1098.973] (-1095.371) (-1095.654) (-1095.795) * [-1091.966] (-1091.891) (-1094.180) (-1101.073) -- 0:01:56
9000 -- (-1091.684) (-1091.549) (-1098.491) [-1091.625] * [-1093.061] (-1093.821) (-1090.912) (-1101.643) -- 0:01:50
9500 -- (-1096.965) (-1098.384) [-1089.839] (-1103.726) * (-1093.870) [-1093.883] (-1098.391) (-1101.831) -- 0:01:44
10000 -- (-1096.832) (-1092.478) [-1102.402] (-1099.471) * [-1091.723] (-1092.580) (-1090.474) (-1091.044) -- 0:01:39
Average standard deviation of split frequencies: 0.077866
10500 -- (-1102.403) (-1098.591) [-1098.156] (-1098.673) * [-1097.428] (-1099.879) (-1093.004) (-1095.815) -- 0:01:34
11000 -- (-1092.251) [-1093.725] (-1090.714) (-1095.477) * (-1097.361) [-1095.587] (-1098.852) (-1097.842) -- 0:01:29
11500 -- (-1092.317) [-1093.607] (-1096.355) (-1090.349) * (-1099.059) (-1098.031) (-1097.372) [-1093.168] -- 0:01:25
12000 -- (-1099.492) (-1100.426) [-1089.168] (-1095.999) * [-1091.826] (-1100.167) (-1099.847) (-1091.230) -- 0:01:22
12500 -- (-1096.493) [-1090.651] (-1095.223) (-1092.436) * (-1097.909) (-1101.908) [-1099.591] (-1085.534) -- 0:01:19
13000 -- (-1097.186) (-1104.515) [-1090.452] (-1091.206) * [-1089.478] (-1097.664) (-1099.501) (-1085.402) -- 0:01:15
13500 -- (-1100.547) [-1091.071] (-1090.607) (-1097.775) * (-1090.357) [-1094.875] (-1097.785) (-1084.106) -- 0:01:13
14000 -- (-1090.857) [-1093.389] (-1098.057) (-1102.717) * [-1095.738] (-1102.942) (-1098.952) (-1084.497) -- 0:01:10
14500 -- (-1092.978) (-1099.915) (-1096.069) [-1091.143] * (-1094.124) (-1106.391) (-1096.332) [-1084.841] -- 0:01:07
15000 -- (-1103.067) (-1096.824) (-1097.395) [-1089.889] * (-1101.985) (-1094.380) (-1089.542) [-1085.265] -- 0:01:05
Average standard deviation of split frequencies: 0.066291
15500 -- [-1091.354] (-1100.557) (-1099.204) (-1096.456) * (-1097.131) (-1100.175) [-1091.713] (-1083.947) -- 0:01:03
16000 -- (-1101.897) (-1097.019) [-1086.719] (-1093.669) * (-1092.642) (-1100.365) (-1093.096) [-1086.516] -- 0:01:01
16500 -- (-1097.753) (-1100.661) (-1084.305) [-1095.973] * (-1092.491) (-1098.632) [-1090.002] (-1087.716) -- 0:00:59
17000 -- (-1092.454) [-1093.542] (-1085.444) (-1106.179) * (-1094.600) (-1092.319) (-1091.722) [-1088.786] -- 0:00:57
17500 -- (-1092.963) [-1092.651] (-1085.185) (-1108.915) * (-1104.579) (-1099.323) [-1095.285] (-1084.547) -- 0:00:56
18000 -- [-1089.544] (-1099.258) (-1090.326) (-1098.345) * (-1091.373) (-1092.292) (-1100.431) [-1090.406] -- 0:00:54
18500 -- (-1096.399) [-1092.457] (-1085.909) (-1089.639) * (-1093.692) (-1092.283) [-1084.031] (-1088.275) -- 0:00:53
19000 -- (-1092.667) (-1102.361) [-1087.490] (-1094.818) * [-1089.877] (-1093.648) (-1086.703) (-1084.697) -- 0:00:51
19500 -- (-1091.792) (-1100.257) (-1085.884) [-1092.810] * [-1099.353] (-1099.665) (-1086.790) (-1085.781) -- 0:00:50
20000 -- (-1089.214) (-1103.850) (-1086.290) [-1091.916] * (-1098.048) (-1093.785) (-1088.619) [-1085.416] -- 0:00:49
Average standard deviation of split frequencies: 0.070711
20500 -- (-1097.752) (-1093.131) [-1087.606] (-1103.361) * (-1094.328) (-1096.365) [-1084.932] (-1084.296) -- 0:00:47
21000 -- (-1093.473) (-1088.467) [-1084.795] (-1094.251) * [-1098.340] (-1096.159) (-1087.245) (-1086.184) -- 0:00:46
21500 -- (-1092.354) [-1089.328] (-1087.397) (-1098.574) * (-1099.031) (-1101.580) (-1084.886) [-1083.895] -- 0:01:31
22000 -- (-1109.484) (-1086.279) [-1085.948] (-1090.575) * (-1094.159) (-1097.600) (-1084.247) [-1084.682] -- 0:01:28
22500 -- (-1091.622) [-1087.032] (-1085.939) (-1095.685) * (-1093.214) (-1098.480) [-1085.155] (-1084.937) -- 0:01:26
23000 -- [-1092.856] (-1087.780) (-1083.691) (-1097.507) * (-1092.351) [-1090.175] (-1084.279) (-1084.020) -- 0:01:24
23500 -- [-1091.656] (-1085.964) (-1084.105) (-1104.477) * [-1096.690] (-1094.428) (-1086.242) (-1083.627) -- 0:01:23
24000 -- (-1094.692) [-1085.395] (-1087.749) (-1086.329) * [-1087.835] (-1094.259) (-1084.869) (-1083.870) -- 0:01:21
24500 -- (-1096.840) (-1084.995) (-1087.511) [-1087.786] * (-1100.902) [-1093.323] (-1084.885) (-1085.323) -- 0:01:19
25000 -- (-1097.981) [-1086.695] (-1084.037) (-1089.492) * [-1096.747] (-1092.379) (-1085.173) (-1084.571) -- 0:01:18
Average standard deviation of split frequencies: 0.057546
25500 -- (-1092.817) [-1085.136] (-1086.745) (-1084.306) * (-1098.242) (-1088.080) [-1085.857] (-1085.427) -- 0:01:16
26000 -- (-1096.248) (-1086.424) [-1083.209] (-1088.377) * (-1086.975) [-1096.084] (-1083.833) (-1089.200) -- 0:01:14
26500 -- (-1092.569) (-1087.269) (-1087.508) [-1083.899] * [-1093.004] (-1096.860) (-1083.898) (-1085.177) -- 0:01:13
27000 -- (-1094.236) [-1087.217] (-1086.992) (-1085.339) * (-1095.709) [-1089.757] (-1083.896) (-1086.407) -- 0:01:12
27500 -- (-1091.020) [-1086.187] (-1086.102) (-1085.720) * [-1090.405] (-1091.800) (-1085.291) (-1087.143) -- 0:01:10
28000 -- (-1116.113) (-1086.243) [-1083.565] (-1085.047) * (-1096.628) [-1099.104] (-1084.793) (-1085.894) -- 0:01:09
28500 -- (-1085.297) (-1085.262) [-1083.985] (-1085.337) * (-1098.032) (-1097.698) [-1085.290] (-1088.567) -- 0:01:08
29000 -- (-1085.851) (-1083.657) (-1083.698) [-1086.592] * [-1098.752] (-1091.948) (-1088.319) (-1086.693) -- 0:01:06
29500 -- [-1084.529] (-1083.452) (-1083.246) (-1084.161) * (-1092.582) [-1092.109] (-1090.101) (-1088.744) -- 0:01:05
30000 -- (-1084.487) (-1084.372) (-1083.024) [-1083.804] * [-1099.464] (-1095.700) (-1084.070) (-1088.358) -- 0:01:04
Average standard deviation of split frequencies: 0.052404
30500 -- [-1085.859] (-1085.041) (-1083.554) (-1083.560) * (-1103.750) [-1102.068] (-1088.879) (-1083.634) -- 0:01:03
31000 -- (-1088.089) (-1091.607) (-1083.848) [-1083.582] * [-1102.974] (-1092.795) (-1088.748) (-1083.914) -- 0:01:02
31500 -- (-1086.261) (-1084.512) [-1086.353] (-1083.999) * (-1098.606) [-1092.380] (-1084.029) (-1083.719) -- 0:01:01
32000 -- (-1084.657) (-1087.519) (-1087.538) [-1084.219] * (-1095.167) (-1091.673) (-1084.311) [-1083.347] -- 0:01:00
32500 -- (-1085.250) [-1086.208] (-1093.006) (-1085.260) * (-1096.950) (-1093.083) [-1084.637] (-1084.868) -- 0:00:59
33000 -- [-1085.164] (-1086.282) (-1088.112) (-1085.227) * (-1099.358) [-1093.608] (-1090.300) (-1085.386) -- 0:00:58
33500 -- [-1083.542] (-1087.504) (-1086.437) (-1085.420) * (-1096.114) [-1095.716] (-1084.781) (-1084.148) -- 0:00:57
34000 -- (-1083.896) (-1087.222) [-1086.463] (-1084.708) * (-1099.770) [-1092.832] (-1084.042) (-1083.684) -- 0:00:56
34500 -- (-1084.419) (-1088.516) (-1087.023) [-1085.783] * (-1097.501) (-1102.320) [-1086.653] (-1085.967) -- 0:00:55
35000 -- (-1085.189) [-1086.842] (-1088.054) (-1084.749) * [-1094.262] (-1095.744) (-1087.060) (-1085.239) -- 0:00:55
Average standard deviation of split frequencies: 0.049759
35500 -- (-1084.404) (-1088.292) [-1087.837] (-1083.938) * (-1105.650) (-1093.467) (-1084.255) [-1088.765] -- 0:00:54
36000 -- [-1083.660] (-1084.214) (-1083.312) (-1084.154) * [-1097.487] (-1095.366) (-1084.504) (-1088.303) -- 0:00:53
36500 -- (-1085.586) (-1084.489) [-1083.288] (-1087.002) * [-1089.262] (-1095.480) (-1084.541) (-1085.595) -- 0:00:52
37000 -- [-1085.147] (-1089.614) (-1084.414) (-1083.278) * (-1097.104) (-1098.238) (-1084.309) [-1085.576] -- 0:00:52
37500 -- (-1083.304) (-1093.223) (-1086.023) [-1087.507] * [-1091.537] (-1097.617) (-1085.347) (-1084.101) -- 0:01:17
38000 -- (-1085.389) [-1086.124] (-1089.419) (-1083.079) * (-1092.896) (-1094.424) (-1084.532) [-1084.010] -- 0:01:15
38500 -- (-1086.658) [-1085.868] (-1087.979) (-1088.961) * (-1093.582) (-1093.998) [-1084.126] (-1087.283) -- 0:01:14
39000 -- (-1083.862) (-1085.932) (-1087.749) [-1086.735] * (-1093.993) [-1092.905] (-1086.980) (-1085.605) -- 0:01:13
39500 -- [-1084.438] (-1088.028) (-1090.469) (-1086.877) * (-1098.959) (-1099.111) [-1084.217] (-1084.998) -- 0:01:12
40000 -- (-1084.585) [-1086.945] (-1084.638) (-1084.868) * [-1091.734] (-1095.910) (-1086.798) (-1083.838) -- 0:01:12
Average standard deviation of split frequencies: 0.056129
40500 -- (-1085.645) (-1087.195) (-1085.181) [-1086.780] * (-1098.208) [-1095.122] (-1084.939) (-1083.533) -- 0:01:11
41000 -- (-1089.275) [-1088.647] (-1083.902) (-1089.911) * [-1089.284] (-1097.855) (-1089.180) (-1086.771) -- 0:01:10
41500 -- [-1084.575] (-1084.542) (-1085.634) (-1085.002) * (-1090.866) (-1107.060) (-1090.186) [-1084.698] -- 0:01:09
42000 -- (-1087.714) (-1087.340) (-1085.810) [-1083.921] * (-1094.081) (-1098.903) (-1086.016) [-1087.328] -- 0:01:08
42500 -- (-1084.719) (-1084.386) (-1088.416) [-1086.246] * (-1096.835) (-1093.661) (-1085.114) [-1089.267] -- 0:01:07
43000 -- (-1085.785) [-1086.232] (-1084.853) (-1087.610) * (-1095.123) (-1099.997) [-1085.348] (-1090.434) -- 0:01:06
43500 -- (-1085.634) (-1087.957) [-1083.234] (-1087.002) * (-1099.951) (-1090.813) [-1085.565] (-1088.330) -- 0:01:05
44000 -- (-1083.785) (-1088.290) [-1084.431] (-1085.792) * [-1090.418] (-1092.130) (-1087.439) (-1086.152) -- 0:01:05
44500 -- (-1083.801) (-1087.572) (-1083.821) [-1088.087] * (-1095.419) (-1092.937) (-1084.873) [-1084.115] -- 0:01:04
45000 -- (-1086.119) [-1085.511] (-1088.685) (-1086.796) * (-1093.148) (-1091.542) [-1086.113] (-1086.388) -- 0:01:03
Average standard deviation of split frequencies: 0.049082
45500 -- [-1086.827] (-1085.095) (-1083.775) (-1083.533) * (-1091.952) (-1101.174) (-1085.322) [-1083.879] -- 0:01:02
46000 -- (-1086.697) (-1084.593) [-1083.802] (-1085.564) * (-1096.082) (-1094.212) (-1085.523) [-1083.315] -- 0:01:02
46500 -- (-1086.952) (-1086.076) (-1083.568) [-1084.158] * (-1092.067) [-1098.203] (-1084.932) (-1085.245) -- 0:01:01
47000 -- (-1083.789) (-1085.091) [-1083.568] (-1083.780) * (-1095.125) (-1099.691) [-1084.268] (-1086.790) -- 0:01:00
47500 -- [-1083.865] (-1085.287) (-1083.752) (-1085.766) * (-1096.648) (-1093.287) (-1086.910) [-1083.200] -- 0:01:00
48000 -- (-1084.417) [-1086.812] (-1084.166) (-1088.883) * (-1097.987) (-1104.986) (-1085.893) [-1083.628] -- 0:00:59
48500 -- (-1084.895) [-1086.156] (-1085.115) (-1086.391) * (-1101.883) [-1090.695] (-1085.786) (-1086.771) -- 0:00:58
49000 -- (-1088.354) (-1087.002) [-1084.228] (-1085.751) * [-1092.501] (-1093.009) (-1086.751) (-1089.552) -- 0:00:58
49500 -- (-1084.778) [-1086.705] (-1086.113) (-1087.309) * (-1101.460) [-1099.966] (-1086.103) (-1090.531) -- 0:00:57
50000 -- [-1085.376] (-1088.961) (-1086.135) (-1089.642) * [-1092.975] (-1088.311) (-1085.214) (-1088.496) -- 0:00:57
Average standard deviation of split frequencies: 0.045125
50500 -- [-1084.740] (-1084.724) (-1085.295) (-1088.869) * (-1092.323) [-1092.395] (-1085.768) (-1085.879) -- 0:00:56
51000 -- (-1085.664) [-1084.722] (-1085.266) (-1085.603) * (-1090.870) [-1091.161] (-1083.285) (-1095.076) -- 0:00:55
51500 -- (-1087.019) (-1086.391) [-1084.178] (-1084.574) * (-1095.399) (-1094.821) [-1084.939] (-1087.185) -- 0:00:55
52000 -- [-1085.561] (-1089.540) (-1084.300) (-1084.459) * (-1096.152) (-1093.593) (-1087.271) [-1090.122] -- 0:00:54
52500 -- [-1084.967] (-1088.571) (-1088.928) (-1083.681) * (-1092.392) [-1089.046] (-1083.724) (-1090.007) -- 0:00:54
53000 -- [-1087.032] (-1084.627) (-1087.049) (-1083.240) * [-1092.577] (-1099.009) (-1084.429) (-1085.642) -- 0:00:53
53500 -- [-1085.058] (-1084.178) (-1083.833) (-1084.631) * (-1092.333) (-1102.671) (-1084.396) [-1088.731] -- 0:01:10
54000 -- (-1087.916) (-1085.170) (-1083.761) [-1087.386] * [-1088.746] (-1099.011) (-1085.163) (-1088.173) -- 0:01:10
54500 -- (-1088.284) [-1088.161] (-1086.092) (-1086.623) * (-1097.842) [-1093.884] (-1088.598) (-1086.866) -- 0:01:09
55000 -- (-1087.168) [-1085.547] (-1085.854) (-1085.959) * (-1091.757) [-1092.089] (-1089.675) (-1087.083) -- 0:01:08
Average standard deviation of split frequencies: 0.042090
55500 -- [-1084.701] (-1083.999) (-1085.742) (-1084.851) * (-1097.095) (-1097.630) (-1085.370) [-1085.544] -- 0:01:08
56000 -- [-1083.906] (-1086.555) (-1087.505) (-1084.356) * (-1105.130) (-1089.785) (-1084.489) [-1085.945] -- 0:01:07
56500 -- (-1084.470) [-1085.698] (-1086.081) (-1084.913) * (-1103.979) (-1099.253) (-1084.249) [-1085.360] -- 0:01:06
57000 -- (-1086.143) (-1087.682) (-1085.483) [-1088.228] * (-1091.464) (-1089.603) (-1083.097) [-1086.474] -- 0:01:06
57500 -- (-1085.647) [-1083.813] (-1086.184) (-1086.209) * (-1103.546) [-1097.469] (-1084.321) (-1087.439) -- 0:01:05
58000 -- (-1084.223) [-1083.445] (-1085.411) (-1086.819) * (-1097.240) (-1090.739) (-1090.323) [-1084.685] -- 0:01:04
58500 -- (-1085.767) (-1085.951) [-1085.693] (-1086.398) * (-1097.721) (-1102.522) (-1084.038) [-1085.071] -- 0:01:04
59000 -- (-1085.688) (-1084.441) [-1087.195] (-1087.436) * (-1097.285) (-1094.914) [-1083.236] (-1086.709) -- 0:01:03
59500 -- (-1084.361) (-1085.043) [-1087.566] (-1088.787) * (-1105.541) [-1090.822] (-1085.248) (-1088.423) -- 0:01:03
60000 -- (-1085.443) (-1086.263) (-1086.011) [-1087.581] * [-1092.981] (-1100.294) (-1083.379) (-1089.602) -- 0:01:02
Average standard deviation of split frequencies: 0.037625
60500 -- (-1084.381) [-1083.160] (-1086.971) (-1087.673) * (-1097.825) (-1092.409) [-1086.792] (-1087.255) -- 0:01:02
61000 -- (-1084.371) (-1083.232) (-1084.801) [-1087.177] * (-1096.777) [-1089.982] (-1085.767) (-1086.894) -- 0:01:01
61500 -- (-1084.401) (-1083.255) (-1085.371) [-1085.015] * (-1092.015) [-1088.037] (-1085.659) (-1085.940) -- 0:01:01
62000 -- (-1086.531) [-1084.027] (-1087.562) (-1087.992) * (-1091.908) (-1097.488) (-1085.473) [-1086.684] -- 0:01:00
62500 -- (-1087.087) [-1084.936] (-1085.105) (-1091.787) * (-1097.097) (-1097.041) [-1085.493] (-1087.910) -- 0:01:00
63000 -- (-1085.884) [-1087.195] (-1083.707) (-1089.489) * [-1091.554] (-1094.918) (-1085.170) (-1085.655) -- 0:00:59
63500 -- (-1088.420) (-1084.527) [-1089.624] (-1085.692) * [-1094.172] (-1095.912) (-1086.545) (-1089.602) -- 0:00:58
64000 -- (-1085.679) (-1084.956) (-1084.246) [-1084.900] * (-1094.607) (-1103.184) [-1084.923] (-1088.999) -- 0:00:58
64500 -- (-1085.431) (-1087.754) (-1083.360) [-1084.087] * (-1094.645) (-1092.944) [-1083.588] (-1087.708) -- 0:00:58
65000 -- (-1086.893) (-1085.283) [-1084.856] (-1085.034) * (-1093.280) [-1088.410] (-1086.680) (-1085.715) -- 0:00:57
Average standard deviation of split frequencies: 0.036644
65500 -- (-1086.214) (-1085.926) [-1087.114] (-1085.804) * (-1093.889) [-1088.276] (-1084.114) (-1086.016) -- 0:00:57
66000 -- [-1085.455] (-1087.464) (-1088.771) (-1085.596) * (-1097.268) (-1096.045) (-1085.346) [-1085.092] -- 0:00:56
66500 -- (-1086.154) (-1088.533) (-1086.618) [-1084.414] * (-1094.516) [-1096.624] (-1085.140) (-1083.977) -- 0:00:56
67000 -- (-1084.721) (-1084.705) (-1085.531) [-1084.128] * [-1091.660] (-1094.863) (-1085.666) (-1086.155) -- 0:00:55
67500 -- [-1083.495] (-1084.707) (-1083.863) (-1084.554) * (-1090.856) (-1096.018) [-1085.563] (-1083.838) -- 0:00:55
68000 -- [-1084.328] (-1085.597) (-1083.850) (-1085.350) * [-1093.898] (-1101.642) (-1088.989) (-1084.791) -- 0:00:54
68500 -- (-1088.455) [-1085.905] (-1085.865) (-1084.691) * (-1102.061) [-1093.779] (-1087.084) (-1085.639) -- 0:00:54
69000 -- (-1085.299) [-1085.478] (-1086.392) (-1087.220) * (-1095.113) [-1088.892] (-1083.586) (-1085.438) -- 0:00:53
69500 -- [-1085.183] (-1089.873) (-1084.304) (-1086.273) * (-1094.444) (-1096.019) (-1083.627) [-1085.671] -- 0:01:06
70000 -- (-1085.632) (-1086.008) (-1084.302) [-1086.510] * (-1104.526) (-1094.381) (-1083.984) [-1084.628] -- 0:01:06
Average standard deviation of split frequencies: 0.035355
70500 -- [-1086.531] (-1085.840) (-1085.135) (-1084.109) * (-1098.196) [-1089.712] (-1083.626) (-1083.814) -- 0:01:05
71000 -- (-1086.805) (-1083.845) (-1085.766) [-1084.008] * (-1089.762) [-1090.761] (-1086.388) (-1083.274) -- 0:01:05
71500 -- (-1086.026) [-1083.447] (-1086.465) (-1083.899) * (-1091.182) [-1094.263] (-1084.197) (-1083.391) -- 0:01:04
72000 -- (-1084.351) (-1086.101) (-1086.268) [-1083.628] * [-1091.051] (-1099.684) (-1084.238) (-1085.443) -- 0:01:04
72500 -- [-1084.156] (-1089.634) (-1090.978) (-1083.867) * (-1101.819) (-1102.546) [-1084.128] (-1084.780) -- 0:01:03
73000 -- (-1088.730) (-1088.331) (-1086.287) [-1083.585] * (-1102.337) (-1098.490) (-1084.302) [-1087.543] -- 0:01:03
73500 -- (-1087.111) [-1084.725] (-1088.072) (-1085.281) * [-1094.112] (-1092.848) (-1084.021) (-1084.407) -- 0:01:03
74000 -- (-1086.759) [-1088.628] (-1087.683) (-1085.653) * (-1097.773) (-1091.369) (-1083.453) [-1083.641] -- 0:01:02
74500 -- [-1083.999] (-1083.293) (-1083.363) (-1085.693) * (-1095.792) (-1102.130) (-1083.300) [-1088.718] -- 0:01:02
75000 -- (-1086.535) (-1085.414) (-1083.673) [-1090.572] * (-1099.758) [-1093.119] (-1084.440) (-1084.987) -- 0:01:01
Average standard deviation of split frequencies: 0.033495
75500 -- [-1085.324] (-1085.932) (-1085.076) (-1085.420) * (-1096.954) [-1094.140] (-1092.710) (-1084.829) -- 0:01:01
76000 -- (-1085.344) (-1088.479) (-1084.242) [-1084.187] * (-1101.090) [-1097.061] (-1086.323) (-1085.623) -- 0:01:00
76500 -- (-1084.093) (-1086.362) (-1083.882) [-1084.153] * (-1090.003) [-1094.474] (-1086.695) (-1084.834) -- 0:01:00
77000 -- [-1084.162] (-1084.535) (-1085.346) (-1084.154) * (-1095.856) (-1100.531) (-1084.975) [-1085.439] -- 0:00:59
77500 -- (-1083.829) [-1084.346] (-1090.955) (-1083.922) * [-1089.139] (-1093.864) (-1088.292) (-1084.075) -- 0:00:59
78000 -- [-1083.825] (-1084.576) (-1091.509) (-1084.860) * (-1096.390) (-1105.037) (-1085.040) [-1085.807] -- 0:00:59
78500 -- (-1085.432) [-1087.780] (-1085.764) (-1084.261) * (-1095.535) (-1093.232) [-1084.473] (-1083.250) -- 0:00:58
79000 -- (-1083.464) [-1085.749] (-1088.515) (-1085.733) * (-1096.925) (-1104.552) [-1083.383] (-1084.224) -- 0:00:58
79500 -- (-1084.603) (-1085.911) (-1088.223) [-1084.907] * (-1092.584) (-1091.267) [-1083.126] (-1086.039) -- 0:00:57
80000 -- (-1085.307) [-1084.339] (-1084.914) (-1085.384) * (-1094.619) (-1095.643) [-1086.557] (-1087.224) -- 0:00:57
Average standard deviation of split frequencies: 0.033218
80500 -- (-1089.768) (-1086.742) [-1085.636] (-1086.624) * (-1096.046) (-1090.649) (-1084.219) [-1087.165] -- 0:00:57
81000 -- [-1084.683] (-1084.889) (-1085.623) (-1085.440) * (-1096.347) [-1094.520] (-1083.319) (-1087.331) -- 0:00:56
81500 -- (-1085.821) [-1083.568] (-1086.946) (-1085.528) * (-1100.548) (-1089.379) (-1085.720) [-1085.649] -- 0:00:56
82000 -- (-1089.448) (-1083.647) (-1084.334) [-1084.910] * [-1092.949] (-1100.744) (-1091.264) (-1084.391) -- 0:00:55
82500 -- (-1085.617) (-1087.833) [-1084.817] (-1084.400) * [-1089.574] (-1097.273) (-1089.399) (-1084.796) -- 0:00:55
83000 -- [-1089.332] (-1084.511) (-1085.781) (-1086.353) * (-1095.639) (-1095.340) [-1087.432] (-1086.238) -- 0:00:55
83500 -- (-1087.678) (-1085.908) (-1085.498) [-1086.828] * (-1097.892) [-1097.762] (-1085.202) (-1086.246) -- 0:00:54
84000 -- (-1084.682) (-1088.141) (-1087.492) [-1084.637] * (-1097.907) (-1090.970) [-1086.233] (-1087.848) -- 0:00:54
84500 -- (-1084.731) [-1086.629] (-1085.653) (-1085.600) * [-1089.468] (-1093.179) (-1090.281) (-1085.402) -- 0:00:54
85000 -- (-1085.035) (-1088.932) [-1085.888] (-1085.046) * [-1090.828] (-1092.011) (-1086.322) (-1083.865) -- 0:00:53
Average standard deviation of split frequencies: 0.030801
85500 -- (-1088.861) (-1091.406) [-1086.377] (-1084.170) * (-1103.086) (-1107.784) (-1087.266) [-1088.282] -- 0:01:04
86000 -- (-1085.809) [-1084.044] (-1084.596) (-1084.423) * (-1095.415) [-1093.998] (-1087.237) (-1086.745) -- 0:01:03
86500 -- (-1083.824) (-1084.585) [-1084.878] (-1085.055) * [-1094.984] (-1098.511) (-1084.839) (-1086.745) -- 0:01:03
87000 -- [-1083.889] (-1087.576) (-1086.164) (-1086.134) * (-1098.354) (-1094.499) [-1085.304] (-1083.519) -- 0:01:02
87500 -- [-1085.644] (-1085.108) (-1088.237) (-1086.564) * (-1105.726) [-1092.890] (-1085.972) (-1085.583) -- 0:01:02
88000 -- (-1090.036) (-1084.547) (-1085.232) [-1084.811] * (-1099.762) [-1096.052] (-1087.410) (-1084.584) -- 0:01:02
88500 -- [-1087.835] (-1087.024) (-1086.895) (-1089.636) * (-1095.238) [-1092.916] (-1085.966) (-1093.225) -- 0:01:01
89000 -- [-1083.203] (-1085.409) (-1086.033) (-1083.785) * (-1092.928) [-1095.162] (-1085.334) (-1084.268) -- 0:01:01
89500 -- (-1084.724) (-1086.433) [-1084.290] (-1083.248) * (-1102.806) (-1095.021) (-1090.030) [-1084.361] -- 0:01:01
90000 -- [-1085.764] (-1084.993) (-1085.615) (-1083.410) * (-1092.093) (-1094.450) (-1088.978) [-1085.315] -- 0:01:00
Average standard deviation of split frequencies: 0.026270
90500 -- (-1085.888) (-1087.280) (-1086.034) [-1084.630] * (-1100.545) [-1095.856] (-1085.561) (-1090.121) -- 0:01:00
91000 -- (-1085.281) [-1083.870] (-1089.418) (-1083.936) * [-1087.732] (-1090.406) (-1087.595) (-1086.680) -- 0:00:59
91500 -- (-1085.148) (-1086.718) (-1090.145) [-1085.442] * [-1097.734] (-1087.438) (-1088.305) (-1092.329) -- 0:00:59
92000 -- (-1085.078) [-1084.212] (-1088.796) (-1085.424) * (-1089.157) (-1086.157) [-1086.095] (-1088.333) -- 0:00:59
92500 -- (-1085.041) [-1084.506] (-1091.280) (-1084.824) * [-1090.687] (-1085.217) (-1085.459) (-1087.737) -- 0:00:58
93000 -- (-1086.741) (-1084.733) (-1089.667) [-1085.364] * [-1091.379] (-1088.752) (-1083.735) (-1089.277) -- 0:00:58
93500 -- (-1083.280) (-1085.215) [-1085.687] (-1083.532) * [-1099.221] (-1086.247) (-1085.118) (-1087.902) -- 0:00:58
94000 -- (-1084.423) (-1084.838) (-1087.471) [-1086.099] * (-1096.757) (-1085.594) [-1085.259] (-1087.901) -- 0:00:57
94500 -- (-1084.865) [-1084.578] (-1085.617) (-1086.087) * (-1097.440) (-1088.756) (-1084.910) [-1089.177] -- 0:00:57
95000 -- (-1086.083) [-1084.871] (-1085.767) (-1083.261) * (-1095.502) (-1085.800) [-1083.676] (-1089.734) -- 0:00:57
Average standard deviation of split frequencies: 0.028972
95500 -- (-1086.090) (-1086.025) [-1086.367] (-1083.903) * (-1089.699) (-1087.853) [-1087.382] (-1090.677) -- 0:00:56
96000 -- (-1085.341) (-1091.617) (-1086.170) [-1086.123] * (-1099.547) [-1084.045] (-1084.682) (-1084.868) -- 0:00:56
96500 -- (-1084.659) (-1087.250) (-1083.961) [-1085.778] * [-1090.698] (-1085.617) (-1084.963) (-1084.759) -- 0:00:56
97000 -- (-1087.282) [-1085.711] (-1084.993) (-1083.447) * (-1093.500) (-1084.781) (-1085.958) [-1088.433] -- 0:00:55
97500 -- (-1090.730) [-1086.404] (-1086.973) (-1083.389) * (-1104.592) (-1090.299) [-1085.055] (-1087.056) -- 0:00:55
98000 -- (-1086.884) (-1086.368) [-1087.166] (-1083.986) * (-1091.568) (-1089.133) (-1084.302) [-1085.619] -- 0:00:55
98500 -- (-1083.542) (-1094.426) (-1091.975) [-1084.383] * (-1094.629) (-1085.888) [-1083.816] (-1088.781) -- 0:00:54
99000 -- (-1084.212) (-1098.151) (-1085.200) [-1084.138] * (-1092.989) (-1086.043) (-1083.464) [-1085.512] -- 0:00:54
99500 -- (-1084.143) (-1090.552) (-1084.611) [-1083.427] * (-1097.539) (-1086.299) [-1084.368] (-1083.461) -- 0:00:54
100000 -- (-1084.697) (-1088.622) [-1084.713] (-1084.175) * [-1094.184] (-1085.418) (-1084.537) (-1084.270) -- 0:00:54
Average standard deviation of split frequencies: 0.030562
100500 -- (-1085.229) [-1086.511] (-1084.654) (-1083.833) * (-1097.730) (-1085.232) [-1085.177] (-1084.722) -- 0:00:53
101000 -- (-1083.933) [-1083.983] (-1090.750) (-1085.325) * (-1092.459) [-1084.703] (-1086.090) (-1088.114) -- 0:01:02
101500 -- (-1084.045) (-1084.158) [-1090.685] (-1085.263) * (-1093.209) (-1084.646) (-1084.537) [-1085.848] -- 0:01:01
102000 -- (-1084.432) [-1085.367] (-1086.880) (-1085.870) * [-1091.837] (-1084.331) (-1085.983) (-1084.006) -- 0:01:01
102500 -- [-1085.040] (-1084.264) (-1086.583) (-1091.639) * [-1091.024] (-1087.831) (-1084.429) (-1084.754) -- 0:01:01
103000 -- (-1084.904) (-1085.011) (-1090.815) [-1085.035] * (-1089.488) [-1085.760] (-1088.091) (-1083.263) -- 0:01:00
103500 -- [-1085.362] (-1083.787) (-1087.043) (-1085.871) * [-1086.974] (-1085.016) (-1086.154) (-1083.393) -- 0:01:00
104000 -- (-1086.029) (-1085.618) (-1085.784) [-1087.008] * (-1093.857) (-1085.532) [-1086.422] (-1083.273) -- 0:01:00
104500 -- (-1084.792) [-1086.605] (-1084.589) (-1090.450) * [-1092.845] (-1084.832) (-1087.041) (-1085.412) -- 0:00:59
105000 -- (-1085.759) (-1086.313) (-1084.249) [-1091.187] * (-1093.432) [-1085.216] (-1088.397) (-1085.539) -- 0:00:59
Average standard deviation of split frequencies: 0.026906
105500 -- [-1084.643] (-1085.619) (-1086.840) (-1086.338) * (-1098.721) (-1085.081) (-1085.922) [-1084.211] -- 0:00:59
106000 -- (-1084.521) (-1086.057) [-1086.243] (-1085.506) * (-1095.700) (-1084.135) [-1086.381] (-1084.606) -- 0:00:59
106500 -- [-1083.413] (-1083.686) (-1085.020) (-1088.368) * (-1097.405) [-1083.751] (-1086.852) (-1088.683) -- 0:00:58
107000 -- (-1083.613) (-1084.863) [-1083.434] (-1088.233) * (-1092.324) (-1083.869) (-1086.582) [-1086.536] -- 0:00:58
107500 -- (-1085.876) [-1085.134] (-1083.973) (-1087.323) * [-1087.785] (-1084.540) (-1084.498) (-1086.795) -- 0:00:58
108000 -- (-1086.539) [-1087.307] (-1085.605) (-1085.477) * (-1090.900) [-1085.998] (-1087.707) (-1084.326) -- 0:00:57
108500 -- (-1086.574) (-1087.360) [-1086.405] (-1086.038) * (-1095.865) [-1085.405] (-1084.730) (-1085.232) -- 0:00:57
109000 -- (-1087.785) (-1088.592) (-1087.171) [-1083.190] * (-1099.367) (-1084.856) (-1084.530) [-1083.165] -- 0:00:57
109500 -- [-1086.774] (-1085.350) (-1083.485) (-1087.543) * (-1088.290) (-1083.825) (-1084.422) [-1084.574] -- 0:00:56
110000 -- (-1085.331) (-1086.273) [-1084.877] (-1084.489) * (-1107.906) (-1086.406) [-1086.659] (-1083.405) -- 0:00:56
Average standard deviation of split frequencies: 0.024375
110500 -- [-1084.610] (-1085.947) (-1085.973) (-1085.588) * (-1095.666) [-1083.998] (-1084.249) (-1083.750) -- 0:00:56
111000 -- [-1083.639] (-1085.524) (-1084.384) (-1085.619) * [-1088.652] (-1084.147) (-1089.825) (-1083.668) -- 0:00:56
111500 -- (-1083.361) [-1084.891] (-1084.184) (-1092.471) * (-1088.960) (-1084.393) [-1085.825] (-1085.806) -- 0:00:55
112000 -- (-1085.324) [-1084.526] (-1085.504) (-1090.259) * (-1097.734) (-1086.321) (-1085.214) [-1084.989] -- 0:00:55
112500 -- (-1085.801) [-1084.914] (-1083.367) (-1087.393) * [-1088.637] (-1085.495) (-1085.019) (-1084.368) -- 0:00:55
113000 -- (-1085.433) [-1086.999] (-1083.977) (-1083.689) * [-1090.594] (-1085.400) (-1083.606) (-1084.730) -- 0:00:54
113500 -- (-1083.939) (-1085.162) (-1084.844) [-1086.905] * (-1094.131) (-1086.172) [-1083.901] (-1084.926) -- 0:00:54
114000 -- [-1084.675] (-1087.617) (-1088.344) (-1086.410) * [-1095.492] (-1083.487) (-1086.957) (-1084.793) -- 0:00:54
114500 -- (-1088.625) (-1087.266) [-1088.011] (-1083.366) * [-1090.147] (-1084.650) (-1087.956) (-1086.770) -- 0:00:54
115000 -- (-1088.923) (-1086.393) [-1085.277] (-1085.436) * (-1094.018) [-1084.110] (-1087.621) (-1086.837) -- 0:00:53
Average standard deviation of split frequencies: 0.026415
115500 -- (-1087.010) [-1085.678] (-1085.012) (-1085.676) * (-1092.760) [-1084.977] (-1088.006) (-1083.994) -- 0:00:53
116000 -- (-1086.863) [-1083.283] (-1085.197) (-1084.963) * (-1096.956) (-1088.670) [-1088.502] (-1084.501) -- 0:00:53
116500 -- (-1089.192) [-1084.953] (-1084.434) (-1085.106) * (-1096.195) (-1087.632) (-1088.437) [-1085.803] -- 0:00:53
117000 -- (-1086.972) (-1086.749) [-1084.336] (-1085.086) * (-1098.537) (-1083.891) [-1088.797] (-1084.652) -- 0:01:00
117500 -- (-1083.741) (-1088.392) [-1089.428] (-1086.742) * (-1097.878) [-1083.935] (-1085.789) (-1085.698) -- 0:01:00
118000 -- (-1083.107) [-1089.095] (-1087.946) (-1085.923) * (-1091.771) (-1087.732) (-1086.513) [-1083.466] -- 0:00:59
118500 -- (-1083.826) (-1084.297) (-1086.782) [-1084.135] * (-1099.038) [-1084.863] (-1086.568) (-1085.793) -- 0:00:59
119000 -- (-1083.934) [-1086.477] (-1087.062) (-1087.941) * (-1103.202) (-1088.844) (-1086.142) [-1083.818] -- 0:00:59
119500 -- (-1085.348) (-1088.026) (-1084.563) [-1084.296] * (-1098.170) (-1087.746) (-1085.963) [-1084.352] -- 0:00:58
120000 -- (-1086.222) [-1085.517] (-1086.295) (-1085.454) * (-1093.781) (-1083.862) [-1084.114] (-1085.656) -- 0:00:58
Average standard deviation of split frequencies: 0.024091
120500 -- (-1086.371) (-1085.853) (-1087.289) [-1087.155] * [-1089.368] (-1085.310) (-1085.308) (-1086.765) -- 0:00:58
121000 -- (-1084.378) [-1084.151] (-1084.556) (-1085.097) * [-1096.307] (-1084.041) (-1088.159) (-1083.790) -- 0:00:58
121500 -- [-1085.839] (-1085.986) (-1085.847) (-1085.609) * (-1095.195) (-1084.437) [-1085.598] (-1084.093) -- 0:00:57
122000 -- (-1084.768) (-1085.917) (-1085.398) [-1085.260] * (-1100.693) (-1084.063) (-1085.599) [-1085.950] -- 0:00:57
122500 -- (-1084.954) [-1092.919] (-1088.435) (-1085.385) * (-1092.205) (-1085.204) [-1084.717] (-1085.708) -- 0:00:57
123000 -- (-1087.091) (-1087.547) [-1086.157] (-1085.528) * (-1091.553) (-1085.934) [-1083.110] (-1084.894) -- 0:00:57
123500 -- (-1091.341) (-1085.791) [-1085.290] (-1087.548) * (-1096.639) (-1086.051) (-1084.813) [-1083.313] -- 0:00:56
124000 -- (-1087.376) (-1084.032) [-1086.220] (-1084.937) * (-1100.241) (-1087.126) [-1084.015] (-1084.184) -- 0:00:56
124500 -- [-1083.538] (-1083.811) (-1084.667) (-1086.642) * (-1089.115) [-1085.262] (-1084.324) (-1083.356) -- 0:00:56
125000 -- [-1084.153] (-1084.980) (-1088.108) (-1084.408) * (-1095.268) (-1084.175) (-1084.005) [-1084.017] -- 0:00:56
Average standard deviation of split frequencies: 0.022448
125500 -- (-1084.351) [-1086.890] (-1087.131) (-1083.798) * (-1095.174) [-1083.391] (-1084.727) (-1085.964) -- 0:00:55
126000 -- [-1083.319] (-1085.135) (-1086.053) (-1085.705) * (-1100.219) (-1085.361) [-1085.547] (-1084.804) -- 0:00:55
126500 -- (-1083.774) [-1085.930] (-1086.277) (-1084.657) * [-1095.303] (-1085.758) (-1083.652) (-1084.792) -- 0:00:55
127000 -- (-1084.435) [-1083.995] (-1087.527) (-1085.664) * (-1094.362) (-1083.999) [-1083.982] (-1086.872) -- 0:00:54
127500 -- (-1085.129) [-1084.318] (-1088.711) (-1084.807) * (-1089.835) (-1083.439) (-1089.664) [-1087.615] -- 0:00:54
128000 -- (-1083.914) (-1085.742) [-1086.369] (-1084.754) * (-1099.012) [-1083.687] (-1085.469) (-1085.031) -- 0:00:54
128500 -- (-1086.504) (-1084.527) [-1084.862] (-1084.445) * (-1099.857) (-1084.635) (-1084.096) [-1084.774] -- 0:00:54
129000 -- (-1085.536) (-1086.355) [-1083.108] (-1085.669) * (-1103.239) [-1084.208] (-1086.250) (-1086.845) -- 0:00:54
129500 -- (-1086.670) [-1084.347] (-1083.162) (-1087.608) * (-1089.449) (-1087.699) (-1091.081) [-1085.516] -- 0:00:53
130000 -- (-1087.120) (-1083.274) [-1084.939] (-1083.719) * (-1083.898) [-1085.067] (-1092.274) (-1086.425) -- 0:00:53
Average standard deviation of split frequencies: 0.021446
130500 -- (-1084.484) (-1083.423) (-1091.442) [-1083.982] * (-1084.759) (-1088.684) [-1089.490] (-1085.861) -- 0:00:53
131000 -- (-1086.357) [-1083.188] (-1086.975) (-1087.028) * (-1086.788) [-1084.688] (-1086.974) (-1085.828) -- 0:00:53
131500 -- (-1083.799) (-1083.118) (-1086.428) [-1084.587] * (-1084.392) [-1084.669] (-1087.887) (-1087.764) -- 0:00:52
132000 -- (-1085.240) (-1087.442) (-1087.994) [-1085.309] * (-1087.146) (-1085.797) (-1091.006) [-1084.065] -- 0:00:52
132500 -- (-1087.563) [-1085.185] (-1083.469) (-1087.399) * (-1085.430) (-1087.904) (-1088.491) [-1084.788] -- 0:00:52
133000 -- [-1085.194] (-1089.003) (-1083.372) (-1087.481) * [-1084.683] (-1085.190) (-1084.609) (-1083.575) -- 0:00:52
133500 -- [-1086.212] (-1085.257) (-1084.914) (-1085.661) * [-1086.437] (-1084.134) (-1084.594) (-1083.873) -- 0:00:58
134000 -- (-1088.435) [-1085.243] (-1086.391) (-1086.517) * [-1087.266] (-1087.048) (-1085.972) (-1085.449) -- 0:00:58
134500 -- (-1087.059) (-1083.692) [-1088.270] (-1086.573) * [-1087.548] (-1084.517) (-1084.290) (-1084.384) -- 0:00:57
135000 -- (-1086.215) (-1084.343) [-1084.376] (-1083.351) * [-1086.803] (-1085.689) (-1091.229) (-1086.539) -- 0:00:57
Average standard deviation of split frequencies: 0.021409
135500 -- (-1085.854) (-1084.710) [-1083.411] (-1085.205) * (-1089.349) (-1085.622) [-1085.165] (-1086.783) -- 0:00:57
136000 -- (-1089.411) [-1083.979] (-1086.597) (-1091.487) * [-1085.762] (-1086.583) (-1085.960) (-1084.224) -- 0:00:57
136500 -- [-1085.059] (-1085.233) (-1086.568) (-1086.155) * (-1088.912) [-1087.141] (-1088.559) (-1084.245) -- 0:00:56
137000 -- (-1084.053) (-1084.586) [-1086.017] (-1086.910) * (-1085.955) (-1083.941) (-1084.181) [-1086.831] -- 0:00:56
137500 -- [-1084.999] (-1085.539) (-1085.914) (-1086.376) * (-1084.859) (-1086.164) (-1084.295) [-1084.897] -- 0:00:56
138000 -- (-1083.599) (-1087.704) [-1089.611] (-1087.615) * [-1084.279] (-1084.102) (-1085.006) (-1087.265) -- 0:00:56
138500 -- (-1085.200) [-1086.709] (-1083.733) (-1085.065) * [-1086.548] (-1088.466) (-1085.180) (-1086.893) -- 0:00:55
139000 -- [-1083.918] (-1090.570) (-1084.853) (-1087.231) * (-1084.009) [-1085.211] (-1087.850) (-1089.770) -- 0:00:55
139500 -- (-1085.571) (-1085.414) [-1085.207] (-1083.522) * (-1084.995) (-1083.570) [-1084.461] (-1088.812) -- 0:00:55
140000 -- [-1083.620] (-1085.459) (-1084.686) (-1084.176) * (-1084.471) [-1085.144] (-1083.246) (-1086.853) -- 0:00:55
Average standard deviation of split frequencies: 0.019122
140500 -- (-1084.640) (-1084.796) (-1086.944) [-1085.074] * (-1085.553) [-1085.661] (-1086.394) (-1084.160) -- 0:00:55
141000 -- (-1084.392) [-1084.127] (-1083.389) (-1086.229) * (-1088.159) (-1088.210) [-1085.031] (-1086.106) -- 0:00:54
141500 -- (-1086.080) (-1083.082) [-1083.555] (-1084.359) * (-1086.383) (-1085.517) [-1083.906] (-1083.583) -- 0:00:54
142000 -- (-1084.478) (-1085.749) (-1087.685) [-1082.950] * (-1086.334) (-1084.953) (-1084.582) [-1085.714] -- 0:00:54
142500 -- (-1086.005) (-1084.970) [-1090.562] (-1083.773) * (-1089.736) (-1084.554) [-1085.297] (-1086.922) -- 0:00:54
143000 -- [-1084.888] (-1084.801) (-1085.807) (-1084.516) * (-1096.219) (-1085.921) (-1084.907) [-1084.140] -- 0:00:53
143500 -- [-1085.517] (-1085.004) (-1088.129) (-1087.073) * [-1085.640] (-1084.500) (-1085.230) (-1083.256) -- 0:00:53
144000 -- [-1084.869] (-1085.006) (-1084.124) (-1086.368) * (-1083.546) (-1084.554) (-1085.986) [-1084.014] -- 0:00:53
144500 -- (-1084.979) [-1083.336] (-1086.105) (-1087.366) * (-1086.313) [-1089.672] (-1085.970) (-1084.349) -- 0:00:53
145000 -- (-1085.621) [-1083.248] (-1089.197) (-1086.229) * [-1085.635] (-1087.919) (-1086.702) (-1086.093) -- 0:00:53
Average standard deviation of split frequencies: 0.017334
145500 -- (-1085.533) (-1083.942) [-1084.303] (-1088.007) * (-1085.688) (-1086.947) (-1085.168) [-1086.091] -- 0:00:52
146000 -- [-1087.162] (-1084.559) (-1083.861) (-1084.980) * (-1085.448) (-1087.616) [-1086.914] (-1084.274) -- 0:00:52
146500 -- (-1087.715) (-1086.389) [-1085.691] (-1084.477) * (-1084.515) (-1085.994) [-1089.268] (-1088.823) -- 0:00:52
147000 -- (-1086.770) [-1085.551] (-1086.527) (-1084.183) * (-1091.102) (-1087.752) [-1083.819] (-1088.985) -- 0:00:52
147500 -- (-1086.242) (-1084.767) [-1089.725] (-1083.976) * (-1086.974) [-1086.916] (-1086.452) (-1083.918) -- 0:00:52
148000 -- (-1084.198) (-1085.161) [-1089.372] (-1085.452) * (-1084.148) (-1086.923) (-1087.186) [-1084.533] -- 0:00:51
148500 -- (-1084.389) (-1085.087) (-1091.363) [-1084.745] * (-1087.485) (-1090.010) [-1083.812] (-1086.264) -- 0:00:51
149000 -- (-1085.192) [-1087.838] (-1088.587) (-1087.061) * (-1084.630) (-1088.012) [-1084.193] (-1085.788) -- 0:00:51
149500 -- [-1084.908] (-1085.382) (-1084.102) (-1084.306) * [-1084.630] (-1086.335) (-1084.618) (-1085.501) -- 0:00:51
150000 -- (-1085.411) (-1088.856) [-1087.275] (-1088.028) * (-1084.173) [-1086.555] (-1086.749) (-1090.383) -- 0:00:56
Average standard deviation of split frequencies: 0.015315
150500 -- (-1084.665) (-1087.925) [-1083.710] (-1088.755) * (-1085.902) (-1085.032) [-1086.116] (-1088.399) -- 0:00:56
151000 -- [-1083.671] (-1087.542) (-1087.134) (-1090.250) * (-1086.758) (-1085.832) [-1085.035] (-1086.726) -- 0:00:56
151500 -- (-1084.694) (-1088.214) (-1087.036) [-1088.967] * (-1086.884) [-1085.456] (-1084.007) (-1084.402) -- 0:00:56
152000 -- (-1089.054) [-1085.203] (-1084.977) (-1088.933) * (-1091.454) [-1083.900] (-1085.276) (-1086.672) -- 0:00:55
152500 -- (-1086.904) (-1084.369) [-1086.381] (-1085.770) * (-1087.132) [-1083.272] (-1084.716) (-1090.690) -- 0:00:55
153000 -- (-1085.073) (-1085.894) [-1089.101] (-1085.155) * (-1086.186) [-1085.230] (-1085.037) (-1088.449) -- 0:00:55
153500 -- (-1084.407) (-1085.097) [-1084.330] (-1084.369) * (-1085.268) (-1086.862) [-1085.857] (-1088.479) -- 0:00:55
154000 -- (-1084.352) (-1084.092) (-1084.282) [-1083.998] * (-1084.421) (-1084.316) [-1084.561] (-1086.946) -- 0:00:54
154500 -- (-1086.057) (-1084.544) [-1084.004] (-1089.066) * [-1085.194] (-1086.154) (-1086.210) (-1092.123) -- 0:00:54
155000 -- (-1088.359) (-1086.856) [-1085.722] (-1085.064) * (-1085.521) (-1085.033) [-1085.250] (-1088.348) -- 0:00:54
Average standard deviation of split frequencies: 0.014270
155500 -- (-1084.030) (-1084.322) [-1085.201] (-1085.776) * (-1084.876) [-1087.035] (-1087.851) (-1088.944) -- 0:00:54
156000 -- (-1084.673) (-1085.295) (-1083.496) [-1084.448] * (-1085.492) (-1085.849) (-1088.398) [-1084.246] -- 0:00:54
156500 -- (-1083.528) (-1084.840) (-1087.688) [-1082.982] * (-1084.943) [-1084.231] (-1086.923) (-1083.494) -- 0:00:53
157000 -- (-1084.920) (-1085.539) [-1083.139] (-1083.186) * [-1085.066] (-1085.011) (-1088.440) (-1083.497) -- 0:00:53
157500 -- (-1083.667) [-1083.737] (-1083.015) (-1084.918) * [-1086.436] (-1088.071) (-1086.822) (-1083.974) -- 0:00:53
158000 -- (-1083.093) [-1083.849] (-1083.409) (-1084.246) * (-1089.352) [-1089.888] (-1086.180) (-1085.393) -- 0:00:53
158500 -- (-1084.750) (-1085.756) (-1086.132) [-1083.744] * [-1084.699] (-1091.728) (-1086.728) (-1085.907) -- 0:00:53
159000 -- (-1084.618) (-1085.522) (-1088.530) [-1084.192] * (-1086.459) (-1084.037) [-1086.920] (-1083.208) -- 0:00:52
159500 -- (-1083.611) (-1085.487) (-1086.133) [-1085.301] * (-1088.025) (-1086.264) [-1085.437] (-1083.929) -- 0:00:52
160000 -- (-1083.726) (-1084.620) [-1085.880] (-1084.578) * [-1086.717] (-1085.230) (-1085.508) (-1084.385) -- 0:00:52
Average standard deviation of split frequencies: 0.013117
160500 -- (-1083.917) [-1085.186] (-1086.871) (-1086.396) * (-1087.313) (-1088.279) [-1083.531] (-1084.436) -- 0:00:52
161000 -- (-1087.537) (-1086.312) [-1087.106] (-1083.507) * (-1085.179) (-1084.935) (-1086.282) [-1086.018] -- 0:00:52
161500 -- (-1085.603) (-1086.701) [-1083.254] (-1084.203) * (-1086.414) (-1089.464) [-1085.578] (-1087.043) -- 0:00:51
162000 -- (-1088.318) (-1086.969) (-1084.217) [-1086.386] * (-1087.876) (-1084.717) (-1084.787) [-1084.923] -- 0:00:51
162500 -- (-1087.344) (-1086.930) [-1085.082] (-1087.683) * (-1085.520) [-1086.087] (-1087.226) (-1084.067) -- 0:00:51
163000 -- (-1083.648) (-1085.636) (-1085.958) [-1084.940] * [-1087.759] (-1084.079) (-1086.181) (-1089.172) -- 0:00:51
163500 -- (-1086.718) [-1083.630] (-1095.000) (-1083.970) * (-1085.784) (-1084.216) [-1089.092] (-1083.691) -- 0:00:51
164000 -- (-1085.811) (-1088.219) [-1086.451] (-1085.202) * (-1084.364) (-1084.290) (-1087.767) [-1084.583] -- 0:00:50
164500 -- (-1085.655) (-1086.831) [-1084.207] (-1084.956) * (-1085.563) [-1085.818] (-1086.856) (-1084.292) -- 0:00:50
165000 -- [-1085.775] (-1084.090) (-1083.788) (-1087.011) * (-1086.569) (-1085.030) [-1086.712] (-1085.726) -- 0:00:50
Average standard deviation of split frequencies: 0.013197
165500 -- (-1087.145) [-1084.244] (-1086.064) (-1087.772) * [-1085.077] (-1085.887) (-1085.058) (-1087.915) -- 0:00:50
166000 -- (-1087.516) [-1084.598] (-1084.975) (-1085.531) * (-1085.095) [-1085.204] (-1086.690) (-1087.049) -- 0:00:55
166500 -- [-1086.868] (-1085.358) (-1084.797) (-1085.249) * [-1086.868] (-1084.803) (-1088.289) (-1086.825) -- 0:00:55
167000 -- [-1087.216] (-1083.530) (-1085.164) (-1084.759) * (-1088.195) (-1083.470) [-1087.481] (-1091.843) -- 0:00:54
167500 -- (-1085.650) [-1083.734] (-1084.299) (-1088.769) * [-1087.528] (-1084.851) (-1091.662) (-1086.720) -- 0:00:54
168000 -- [-1083.280] (-1084.527) (-1083.452) (-1084.514) * (-1087.588) [-1084.809] (-1086.019) (-1085.849) -- 0:00:54
168500 -- [-1085.046] (-1084.860) (-1084.157) (-1085.690) * (-1086.431) (-1087.000) [-1085.663] (-1087.426) -- 0:00:54
169000 -- (-1084.298) [-1084.564] (-1084.159) (-1084.802) * (-1088.771) (-1088.826) (-1085.963) [-1086.557] -- 0:00:54
169500 -- (-1085.692) (-1085.289) [-1084.562] (-1086.087) * (-1088.887) [-1085.613] (-1085.792) (-1084.799) -- 0:00:53
170000 -- (-1086.391) (-1085.738) [-1085.440] (-1086.581) * [-1088.591] (-1085.831) (-1087.320) (-1087.013) -- 0:00:53
Average standard deviation of split frequencies: 0.013811
170500 -- (-1086.618) [-1085.797] (-1085.624) (-1085.331) * (-1086.073) (-1088.161) (-1087.179) [-1084.413] -- 0:00:53
171000 -- (-1090.283) (-1085.406) (-1085.320) [-1084.577] * (-1087.847) (-1086.338) [-1085.993] (-1086.909) -- 0:00:53
171500 -- (-1088.302) (-1083.692) (-1084.443) [-1085.949] * (-1086.954) (-1088.436) [-1086.546] (-1091.477) -- 0:00:53
172000 -- (-1085.247) (-1084.607) [-1087.382] (-1085.480) * (-1084.628) (-1089.621) [-1087.205] (-1086.023) -- 0:00:52
172500 -- (-1088.954) [-1086.006] (-1086.315) (-1089.176) * (-1083.921) (-1088.438) [-1083.640] (-1086.789) -- 0:00:52
173000 -- (-1086.825) [-1083.701] (-1085.943) (-1084.686) * (-1084.425) [-1084.722] (-1083.527) (-1084.593) -- 0:00:52
173500 -- (-1087.731) [-1083.405] (-1084.522) (-1084.968) * (-1088.349) [-1083.960] (-1085.241) (-1086.666) -- 0:00:52
174000 -- (-1085.684) [-1085.063] (-1086.253) (-1091.076) * (-1086.410) [-1083.871] (-1087.417) (-1087.156) -- 0:00:52
174500 -- (-1085.337) (-1088.511) [-1088.019] (-1084.924) * [-1087.268] (-1084.912) (-1085.084) (-1084.953) -- 0:00:52
175000 -- (-1088.648) [-1086.343] (-1085.764) (-1085.491) * (-1084.161) (-1083.861) (-1085.894) [-1086.988] -- 0:00:51
Average standard deviation of split frequencies: 0.013392
175500 -- [-1085.647] (-1085.256) (-1084.277) (-1086.475) * [-1089.567] (-1084.840) (-1083.409) (-1085.046) -- 0:00:51
176000 -- (-1085.153) [-1084.444] (-1084.277) (-1086.521) * (-1090.330) (-1083.768) [-1084.299] (-1087.135) -- 0:00:51
176500 -- (-1085.716) [-1084.634] (-1084.453) (-1084.916) * (-1086.061) (-1085.631) [-1083.618] (-1088.717) -- 0:00:51
177000 -- (-1085.087) (-1084.098) (-1086.191) [-1085.449] * [-1085.895] (-1083.336) (-1083.104) (-1086.348) -- 0:00:51
177500 -- (-1085.333) (-1084.800) (-1084.095) [-1088.857] * (-1086.197) (-1083.750) [-1084.087] (-1083.716) -- 0:00:50
178000 -- [-1084.336] (-1084.437) (-1084.436) (-1086.100) * (-1084.164) (-1083.265) [-1085.776] (-1083.712) -- 0:00:50
178500 -- (-1083.177) (-1083.031) (-1089.724) [-1084.201] * (-1088.228) [-1084.263] (-1085.039) (-1085.567) -- 0:00:50
179000 -- (-1083.546) (-1087.680) [-1084.935] (-1083.475) * (-1087.646) (-1085.751) (-1083.825) [-1087.587] -- 0:00:50
179500 -- (-1084.466) (-1085.392) [-1084.694] (-1088.051) * [-1087.744] (-1084.919) (-1085.466) (-1084.964) -- 0:00:50
180000 -- [-1083.735] (-1087.075) (-1084.308) (-1088.063) * [-1086.947] (-1084.835) (-1083.986) (-1085.182) -- 0:00:50
Average standard deviation of split frequencies: 0.010274
180500 -- [-1084.299] (-1086.190) (-1084.064) (-1088.354) * (-1087.493) (-1084.883) [-1086.115] (-1085.563) -- 0:00:49
181000 -- (-1085.837) [-1085.693] (-1084.238) (-1084.284) * (-1084.149) (-1084.069) [-1083.454] (-1082.925) -- 0:00:49
181500 -- [-1085.000] (-1085.994) (-1083.486) (-1087.146) * (-1084.842) [-1085.323] (-1086.620) (-1082.925) -- 0:00:49
182000 -- (-1084.370) [-1083.884] (-1085.243) (-1087.881) * [-1085.372] (-1084.249) (-1085.096) (-1083.492) -- 0:00:53
182500 -- (-1084.139) (-1086.154) [-1085.341] (-1088.248) * (-1086.318) [-1084.217] (-1084.506) (-1084.884) -- 0:00:53
183000 -- (-1084.291) (-1084.202) [-1084.124] (-1088.444) * (-1086.747) [-1084.907] (-1088.638) (-1085.746) -- 0:00:53
183500 -- (-1087.264) (-1084.013) (-1083.889) [-1085.510] * (-1086.542) (-1088.646) (-1088.219) [-1084.040] -- 0:00:53
184000 -- (-1086.815) [-1084.040] (-1090.274) (-1085.249) * (-1086.630) [-1083.696] (-1086.362) (-1083.821) -- 0:00:53
184500 -- (-1085.853) (-1083.519) [-1089.292] (-1085.015) * (-1088.561) (-1085.164) [-1084.830] (-1085.936) -- 0:00:53
185000 -- (-1085.918) (-1089.753) [-1084.749] (-1084.755) * [-1087.725] (-1084.775) (-1085.769) (-1085.240) -- 0:00:52
Average standard deviation of split frequencies: 0.010701
185500 -- (-1086.300) (-1086.709) (-1084.450) [-1087.034] * (-1088.113) (-1086.980) [-1083.905] (-1083.836) -- 0:00:52
186000 -- (-1084.971) (-1087.786) (-1084.167) [-1083.732] * (-1086.768) [-1084.166] (-1085.808) (-1083.836) -- 0:00:52
186500 -- (-1084.668) [-1085.529] (-1084.242) (-1084.607) * (-1084.718) [-1083.888] (-1085.793) (-1084.387) -- 0:00:52
187000 -- (-1084.782) [-1085.327] (-1085.932) (-1085.246) * (-1085.484) (-1085.897) (-1088.115) [-1084.809] -- 0:00:52
187500 -- (-1084.169) (-1089.047) [-1087.271] (-1087.389) * (-1086.688) (-1085.182) (-1087.327) [-1084.954] -- 0:00:52
188000 -- (-1084.005) [-1084.602] (-1085.448) (-1086.752) * (-1090.521) (-1086.646) [-1087.754] (-1084.882) -- 0:00:51
188500 -- (-1088.942) (-1085.372) (-1083.873) [-1086.469] * (-1089.882) (-1087.139) (-1086.346) [-1085.273] -- 0:00:51
189000 -- (-1085.897) (-1084.595) (-1087.014) [-1090.050] * (-1084.251) (-1085.220) (-1090.019) [-1084.265] -- 0:00:51
189500 -- (-1085.310) [-1085.217] (-1083.739) (-1083.793) * (-1084.423) (-1085.293) [-1088.233] (-1084.381) -- 0:00:51
190000 -- [-1085.324] (-1083.633) (-1087.221) (-1083.256) * (-1084.160) (-1086.649) [-1086.456] (-1084.504) -- 0:00:51
Average standard deviation of split frequencies: 0.012362
190500 -- [-1084.866] (-1087.443) (-1086.978) (-1085.830) * (-1085.582) (-1087.060) (-1086.739) [-1084.678] -- 0:00:50
191000 -- [-1085.070] (-1085.286) (-1086.796) (-1084.321) * (-1083.755) (-1087.616) (-1085.875) [-1085.616] -- 0:00:50
191500 -- (-1084.537) (-1085.870) [-1089.011] (-1084.148) * (-1083.672) (-1085.459) (-1086.912) [-1086.932] -- 0:00:50
192000 -- (-1085.991) [-1087.480] (-1086.324) (-1086.237) * [-1085.705] (-1084.595) (-1088.027) (-1083.793) -- 0:00:50
192500 -- (-1085.103) [-1090.181] (-1085.624) (-1088.512) * (-1085.085) [-1085.179] (-1087.439) (-1084.524) -- 0:00:50
193000 -- (-1085.934) (-1085.335) (-1084.737) [-1085.151] * (-1086.545) [-1083.683] (-1086.258) (-1085.297) -- 0:00:50
193500 -- [-1087.346] (-1084.031) (-1085.936) (-1084.855) * (-1084.370) (-1085.451) (-1084.276) [-1083.911] -- 0:00:50
194000 -- (-1083.882) (-1085.951) [-1085.604] (-1086.910) * [-1084.350] (-1084.125) (-1085.516) (-1086.767) -- 0:00:49
194500 -- (-1083.193) (-1083.488) (-1086.494) [-1085.957] * [-1083.765] (-1083.890) (-1084.189) (-1086.356) -- 0:00:49
195000 -- (-1088.693) (-1083.262) (-1084.714) [-1086.393] * (-1083.576) (-1086.259) (-1089.200) [-1086.423] -- 0:00:49
Average standard deviation of split frequencies: 0.012785
195500 -- [-1084.434] (-1084.107) (-1084.999) (-1084.633) * (-1083.610) (-1083.809) [-1086.710] (-1087.564) -- 0:00:49
196000 -- (-1083.444) [-1086.011] (-1086.983) (-1084.810) * [-1084.294] (-1085.029) (-1085.298) (-1086.006) -- 0:00:49
196500 -- (-1087.687) (-1086.656) (-1088.084) [-1086.597] * [-1084.874] (-1086.086) (-1084.151) (-1087.166) -- 0:00:49
197000 -- [-1087.305] (-1087.127) (-1085.484) (-1087.291) * [-1083.351] (-1085.842) (-1085.109) (-1086.818) -- 0:00:48
197500 -- [-1084.616] (-1090.461) (-1085.916) (-1083.740) * [-1084.558] (-1084.322) (-1086.840) (-1087.187) -- 0:00:48
198000 -- (-1085.546) (-1087.248) (-1084.597) [-1085.286] * (-1087.477) [-1084.142] (-1086.492) (-1088.665) -- 0:00:48
198500 -- (-1084.726) (-1084.460) [-1084.568] (-1083.991) * (-1087.701) [-1083.416] (-1086.918) (-1084.394) -- 0:00:52
199000 -- (-1088.289) (-1085.232) [-1084.046] (-1085.476) * (-1086.546) [-1086.190] (-1085.417) (-1085.490) -- 0:00:52
199500 -- (-1085.044) (-1084.990) (-1085.323) [-1083.677] * (-1087.463) (-1085.644) (-1084.360) [-1085.340] -- 0:00:52
200000 -- [-1086.170] (-1084.631) (-1084.143) (-1083.173) * (-1085.015) [-1086.611] (-1083.619) (-1084.379) -- 0:00:51
Average standard deviation of split frequencies: 0.014095
200500 -- [-1086.217] (-1084.935) (-1084.159) (-1084.869) * [-1084.251] (-1086.964) (-1083.858) (-1085.562) -- 0:00:51
201000 -- (-1088.283) (-1085.439) (-1088.024) [-1083.583] * (-1083.709) [-1086.075] (-1085.171) (-1083.286) -- 0:00:51
201500 -- (-1087.162) [-1084.396] (-1083.946) (-1084.292) * (-1085.371) (-1085.538) [-1084.749] (-1084.542) -- 0:00:51
202000 -- [-1085.431] (-1087.634) (-1084.463) (-1083.676) * (-1086.501) (-1085.858) (-1093.103) [-1087.499] -- 0:00:51
202500 -- (-1087.824) (-1089.474) [-1084.118] (-1085.544) * (-1084.040) (-1085.911) (-1086.453) [-1084.143] -- 0:00:51
203000 -- [-1083.298] (-1087.533) (-1084.510) (-1084.083) * (-1083.411) (-1087.168) (-1085.778) [-1085.887] -- 0:00:51
203500 -- (-1085.916) [-1083.992] (-1087.261) (-1087.222) * (-1084.032) (-1086.077) [-1084.715] (-1084.562) -- 0:00:50
204000 -- (-1086.489) [-1086.051] (-1084.279) (-1085.275) * (-1085.399) (-1084.525) [-1084.675] (-1086.633) -- 0:00:50
204500 -- [-1084.726] (-1086.489) (-1085.847) (-1085.699) * (-1084.732) [-1084.898] (-1084.045) (-1086.718) -- 0:00:50
205000 -- [-1085.596] (-1084.978) (-1083.530) (-1087.947) * (-1084.211) (-1086.595) [-1083.980] (-1087.899) -- 0:00:50
Average standard deviation of split frequencies: 0.011060
205500 -- (-1086.363) (-1086.384) (-1085.835) [-1084.865] * [-1085.516] (-1086.306) (-1084.767) (-1086.569) -- 0:00:50
206000 -- (-1090.799) (-1086.052) [-1085.468] (-1087.894) * (-1084.575) [-1085.610] (-1087.843) (-1084.713) -- 0:00:50
206500 -- [-1087.497] (-1083.809) (-1087.712) (-1084.969) * (-1083.904) (-1088.032) [-1085.062] (-1088.340) -- 0:00:49
207000 -- (-1084.793) [-1084.556] (-1085.242) (-1084.269) * [-1087.410] (-1087.934) (-1084.093) (-1086.792) -- 0:00:49
207500 -- (-1083.991) (-1085.387) [-1085.253] (-1084.304) * [-1084.330] (-1086.100) (-1083.674) (-1086.848) -- 0:00:49
208000 -- (-1084.083) (-1083.891) [-1084.340] (-1085.742) * (-1087.310) (-1086.223) (-1086.036) [-1086.385] -- 0:00:49
208500 -- (-1086.918) [-1084.794] (-1085.465) (-1085.549) * (-1086.943) (-1088.468) [-1087.706] (-1087.617) -- 0:00:49
209000 -- (-1088.350) (-1084.035) [-1084.603] (-1083.819) * (-1088.420) [-1084.239] (-1085.923) (-1085.264) -- 0:00:49
209500 -- (-1086.392) [-1083.941] (-1086.342) (-1084.730) * (-1088.199) [-1084.367] (-1089.820) (-1086.218) -- 0:00:49
210000 -- (-1084.692) (-1083.814) [-1085.995] (-1084.993) * [-1087.293] (-1083.567) (-1089.632) (-1084.437) -- 0:00:48
Average standard deviation of split frequencies: 0.011561
210500 -- [-1084.027] (-1087.432) (-1085.523) (-1087.750) * (-1086.505) (-1083.407) [-1086.391] (-1084.039) -- 0:00:48
211000 -- [-1084.020] (-1088.019) (-1084.482) (-1086.690) * (-1086.459) (-1086.016) [-1090.072] (-1087.383) -- 0:00:48
211500 -- (-1084.806) (-1087.399) [-1083.484] (-1086.792) * (-1086.681) (-1087.302) (-1088.849) [-1083.380] -- 0:00:48
212000 -- (-1089.766) (-1085.528) (-1085.578) [-1084.378] * (-1086.014) (-1092.147) (-1087.326) [-1083.297] -- 0:00:48
212500 -- (-1083.855) [-1085.902] (-1086.501) (-1084.694) * [-1084.410] (-1084.370) (-1085.023) (-1084.271) -- 0:00:48
213000 -- (-1085.081) (-1085.297) [-1084.294] (-1083.713) * (-1084.598) (-1085.507) [-1085.526] (-1086.554) -- 0:00:48
213500 -- (-1084.687) (-1086.256) (-1087.161) [-1085.543] * [-1087.802] (-1087.626) (-1084.938) (-1087.705) -- 0:00:51
214000 -- (-1086.783) [-1084.915] (-1085.881) (-1083.458) * (-1087.915) (-1085.620) [-1086.325] (-1089.593) -- 0:00:51
214500 -- [-1088.221] (-1083.636) (-1083.757) (-1088.027) * (-1087.894) (-1086.997) [-1083.466] (-1087.674) -- 0:00:51
215000 -- (-1085.024) (-1084.607) (-1084.638) [-1084.095] * [-1084.396] (-1085.745) (-1086.263) (-1086.728) -- 0:00:51
Average standard deviation of split frequencies: 0.010548
215500 -- [-1083.448] (-1083.486) (-1085.127) (-1084.222) * (-1087.297) (-1092.408) (-1085.082) [-1088.192] -- 0:00:50
216000 -- (-1084.664) [-1084.936] (-1084.911) (-1086.960) * (-1085.641) [-1085.569] (-1086.713) (-1087.083) -- 0:00:50
216500 -- (-1084.142) (-1083.233) (-1084.757) [-1085.060] * [-1085.938] (-1084.661) (-1084.771) (-1088.554) -- 0:00:50
217000 -- (-1086.967) (-1085.024) [-1085.989] (-1087.709) * (-1088.367) [-1090.456] (-1087.097) (-1085.729) -- 0:00:50
217500 -- (-1085.647) [-1084.529] (-1085.049) (-1087.237) * [-1084.151] (-1084.785) (-1086.249) (-1086.868) -- 0:00:50
218000 -- (-1085.159) (-1085.192) [-1083.823] (-1088.912) * (-1085.947) (-1084.776) (-1084.497) [-1083.590] -- 0:00:50
218500 -- (-1084.105) (-1085.494) (-1083.685) [-1090.716] * [-1087.975] (-1083.712) (-1087.542) (-1084.266) -- 0:00:50
219000 -- (-1085.134) [-1086.230] (-1086.518) (-1086.875) * (-1090.552) [-1083.627] (-1085.884) (-1085.608) -- 0:00:49
219500 -- [-1084.623] (-1085.457) (-1084.542) (-1086.348) * (-1088.615) [-1088.299] (-1087.212) (-1084.241) -- 0:00:49
220000 -- (-1084.133) [-1085.252] (-1086.033) (-1087.198) * [-1085.678] (-1084.118) (-1084.762) (-1085.295) -- 0:00:49
Average standard deviation of split frequencies: 0.009139
220500 -- (-1083.463) [-1084.752] (-1090.308) (-1084.602) * (-1085.057) (-1084.032) [-1087.492] (-1085.461) -- 0:00:49
221000 -- (-1084.327) (-1085.020) [-1087.620] (-1084.004) * (-1083.857) (-1083.484) [-1084.780] (-1083.717) -- 0:00:49
221500 -- (-1084.460) (-1087.995) [-1086.592] (-1084.140) * [-1084.173] (-1085.522) (-1086.260) (-1087.767) -- 0:00:49
222000 -- (-1083.382) (-1083.701) [-1085.725] (-1084.145) * (-1083.830) (-1083.916) (-1084.479) [-1084.570] -- 0:00:49
222500 -- [-1084.804] (-1084.009) (-1084.393) (-1084.460) * (-1085.718) (-1088.326) [-1084.542] (-1088.092) -- 0:00:48
223000 -- [-1088.058] (-1084.554) (-1084.197) (-1089.690) * (-1085.050) [-1085.608] (-1085.554) (-1085.741) -- 0:00:48
223500 -- (-1084.632) (-1085.390) (-1086.012) [-1085.429] * (-1087.664) [-1086.894] (-1084.808) (-1084.202) -- 0:00:48
224000 -- (-1085.009) (-1085.062) (-1083.284) [-1084.586] * (-1087.694) (-1086.365) (-1084.911) [-1086.430] -- 0:00:48
224500 -- (-1083.954) (-1084.013) [-1083.090] (-1083.196) * (-1084.792) (-1086.618) [-1085.910] (-1087.891) -- 0:00:48
225000 -- (-1084.232) (-1083.618) [-1084.564] (-1086.381) * (-1087.538) (-1084.560) [-1085.195] (-1084.362) -- 0:00:48
Average standard deviation of split frequencies: 0.010210
225500 -- [-1085.983] (-1086.144) (-1084.113) (-1084.104) * [-1086.594] (-1084.615) (-1086.177) (-1088.393) -- 0:00:48
226000 -- (-1085.332) (-1086.634) (-1085.067) [-1084.181] * [-1085.646] (-1083.698) (-1084.410) (-1084.073) -- 0:00:47
226500 -- (-1084.373) (-1087.867) [-1085.044] (-1084.181) * [-1084.638] (-1084.785) (-1083.563) (-1089.051) -- 0:00:47
227000 -- (-1083.632) [-1085.897] (-1085.268) (-1085.798) * (-1084.776) [-1085.608] (-1085.761) (-1091.237) -- 0:00:47
227500 -- (-1084.753) [-1086.726] (-1086.240) (-1085.193) * [-1086.219] (-1085.600) (-1085.324) (-1091.703) -- 0:00:47
228000 -- (-1085.394) (-1085.526) [-1086.450] (-1086.937) * (-1084.558) (-1087.984) (-1087.591) [-1085.878] -- 0:00:47
228500 -- (-1085.604) [-1085.534] (-1085.576) (-1086.476) * [-1085.503] (-1084.319) (-1084.000) (-1086.180) -- 0:00:47
229000 -- (-1085.782) (-1084.483) (-1086.433) [-1086.384] * [-1084.935] (-1084.724) (-1088.667) (-1086.076) -- 0:00:47
229500 -- (-1084.196) (-1087.958) (-1083.920) [-1084.279] * (-1085.443) [-1084.204] (-1088.364) (-1085.953) -- 0:00:50
230000 -- (-1086.617) (-1085.827) [-1089.218] (-1083.096) * (-1088.425) (-1087.852) (-1088.846) [-1086.314] -- 0:00:50
Average standard deviation of split frequencies: 0.009681
230500 -- (-1086.838) (-1083.509) (-1090.592) [-1083.536] * (-1086.133) (-1086.359) [-1084.193] (-1087.728) -- 0:00:50
231000 -- (-1085.517) (-1084.802) (-1085.662) [-1083.121] * (-1085.504) [-1083.539] (-1084.868) (-1085.799) -- 0:00:49
231500 -- [-1087.622] (-1088.191) (-1084.527) (-1084.079) * (-1083.886) (-1085.173) (-1085.026) [-1083.847] -- 0:00:49
232000 -- (-1088.318) [-1086.879] (-1091.105) (-1085.823) * [-1084.109] (-1084.777) (-1086.446) (-1083.185) -- 0:00:49
232500 -- [-1085.632] (-1087.164) (-1084.991) (-1085.962) * (-1084.980) [-1085.338] (-1084.980) (-1088.440) -- 0:00:49
233000 -- (-1086.166) (-1086.246) (-1083.926) [-1084.125] * (-1084.153) (-1084.855) (-1086.810) [-1085.359] -- 0:00:49
233500 -- (-1085.145) (-1086.040) [-1084.290] (-1084.868) * (-1083.435) (-1084.667) (-1085.264) [-1084.322] -- 0:00:49
234000 -- (-1086.383) (-1085.259) [-1084.449] (-1083.168) * [-1086.285] (-1085.331) (-1084.406) (-1084.452) -- 0:00:49
234500 -- (-1092.189) [-1085.724] (-1089.974) (-1085.246) * (-1087.335) (-1091.629) (-1084.666) [-1085.206] -- 0:00:48
235000 -- (-1086.391) [-1086.074] (-1087.340) (-1086.034) * (-1084.269) (-1087.683) (-1083.251) [-1084.829] -- 0:00:48
Average standard deviation of split frequencies: 0.008726
235500 -- (-1088.006) (-1086.689) [-1087.201] (-1088.143) * [-1084.199] (-1083.984) (-1087.072) (-1086.397) -- 0:00:48
236000 -- (-1085.365) [-1090.272] (-1090.412) (-1090.000) * (-1083.476) (-1086.660) (-1084.877) [-1085.848] -- 0:00:48
236500 -- (-1086.806) [-1085.708] (-1091.772) (-1083.659) * (-1083.181) (-1086.991) (-1083.349) [-1084.400] -- 0:00:48
237000 -- [-1086.665] (-1084.964) (-1086.123) (-1084.942) * (-1083.536) (-1085.541) (-1086.712) [-1089.099] -- 0:00:48
237500 -- [-1085.424] (-1086.226) (-1083.902) (-1088.894) * [-1084.203] (-1084.866) (-1087.447) (-1088.864) -- 0:00:48
238000 -- [-1086.716] (-1084.169) (-1086.291) (-1090.891) * (-1084.993) [-1086.510] (-1086.254) (-1083.674) -- 0:00:48
238500 -- (-1086.960) (-1085.822) [-1086.885] (-1086.022) * [-1084.909] (-1093.611) (-1087.617) (-1087.536) -- 0:00:47
239000 -- (-1086.176) (-1087.280) [-1084.389] (-1088.145) * (-1084.988) (-1091.741) (-1087.656) [-1083.602] -- 0:00:47
239500 -- (-1086.561) (-1087.368) (-1084.310) [-1085.204] * (-1085.956) (-1085.599) (-1087.428) [-1084.066] -- 0:00:47
240000 -- (-1088.074) (-1084.765) (-1083.516) [-1083.681] * (-1087.040) (-1086.077) [-1085.056] (-1084.771) -- 0:00:47
Average standard deviation of split frequencies: 0.008053
240500 -- (-1093.752) (-1086.372) (-1085.354) [-1086.659] * (-1086.627) (-1088.394) [-1086.142] (-1085.259) -- 0:00:47
241000 -- (-1086.977) (-1083.649) [-1083.901] (-1084.293) * (-1085.570) [-1084.011] (-1086.475) (-1087.446) -- 0:00:47
241500 -- (-1089.486) (-1089.344) [-1085.797] (-1086.833) * (-1084.142) [-1087.216] (-1084.319) (-1087.508) -- 0:00:47
242000 -- (-1084.331) [-1083.892] (-1085.233) (-1085.695) * (-1084.051) [-1087.843] (-1084.473) (-1085.560) -- 0:00:46
242500 -- [-1088.643] (-1085.677) (-1084.776) (-1088.725) * [-1085.000] (-1083.936) (-1084.940) (-1086.050) -- 0:00:46
243000 -- (-1085.871) (-1087.011) (-1083.831) [-1087.982] * [-1083.930] (-1086.857) (-1087.236) (-1085.129) -- 0:00:46
243500 -- [-1084.432] (-1085.742) (-1087.505) (-1088.631) * [-1086.229] (-1088.389) (-1086.403) (-1087.255) -- 0:00:46
244000 -- [-1085.324] (-1086.777) (-1087.555) (-1086.379) * (-1085.617) (-1089.834) [-1084.696] (-1087.803) -- 0:00:46
244500 -- (-1085.676) (-1087.999) [-1087.396] (-1087.203) * (-1089.601) (-1084.258) [-1083.991] (-1090.161) -- 0:00:46
245000 -- (-1089.565) (-1084.464) [-1084.916] (-1084.784) * (-1086.682) (-1083.786) (-1084.514) [-1086.938] -- 0:00:46
Average standard deviation of split frequencies: 0.009985
245500 -- (-1084.099) (-1084.170) [-1085.377] (-1084.261) * [-1084.117] (-1084.068) (-1087.255) (-1085.994) -- 0:00:49
246000 -- (-1084.418) [-1084.987] (-1086.644) (-1084.628) * (-1085.441) (-1084.152) [-1086.694] (-1090.174) -- 0:00:49
246500 -- [-1086.878] (-1084.635) (-1088.259) (-1086.802) * [-1087.555] (-1083.912) (-1084.439) (-1086.641) -- 0:00:48
247000 -- (-1089.378) (-1084.788) (-1087.998) [-1084.026] * (-1086.824) (-1083.954) (-1091.348) [-1085.175] -- 0:00:48
247500 -- [-1088.074] (-1084.688) (-1088.505) (-1084.295) * (-1085.002) (-1084.924) [-1085.868] (-1087.034) -- 0:00:48
248000 -- [-1087.897] (-1084.670) (-1085.205) (-1086.452) * (-1084.627) [-1083.646] (-1086.608) (-1086.522) -- 0:00:48
248500 -- (-1084.095) [-1086.385] (-1085.098) (-1084.877) * (-1086.231) (-1086.988) [-1085.024] (-1084.443) -- 0:00:48
249000 -- (-1086.078) [-1088.567] (-1084.771) (-1083.924) * (-1089.095) [-1087.768] (-1083.323) (-1084.743) -- 0:00:48
249500 -- (-1085.882) (-1088.431) [-1084.657] (-1083.235) * (-1084.728) (-1084.819) [-1085.109] (-1083.001) -- 0:00:48
250000 -- [-1085.661] (-1088.594) (-1083.898) (-1086.664) * (-1085.404) (-1086.795) (-1084.779) [-1083.242] -- 0:00:48
Average standard deviation of split frequencies: 0.010294
250500 -- [-1088.167] (-1087.486) (-1083.711) (-1083.416) * (-1083.714) (-1086.189) [-1083.302] (-1084.875) -- 0:00:47
251000 -- (-1088.300) (-1083.184) (-1084.597) [-1083.394] * (-1084.493) [-1088.569] (-1085.923) (-1086.030) -- 0:00:47
251500 -- (-1084.981) (-1085.424) (-1084.137) [-1085.080] * [-1085.786] (-1086.855) (-1087.726) (-1086.939) -- 0:00:47
252000 -- (-1087.582) (-1085.237) (-1084.320) [-1083.201] * (-1089.150) [-1088.206] (-1087.940) (-1087.502) -- 0:00:47
252500 -- (-1088.122) (-1089.453) [-1084.191] (-1083.232) * (-1087.228) [-1087.838] (-1085.810) (-1086.077) -- 0:00:47
253000 -- (-1086.568) (-1084.097) [-1084.579] (-1084.051) * [-1084.997] (-1085.994) (-1086.745) (-1084.133) -- 0:00:47
253500 -- (-1085.247) [-1085.006] (-1087.201) (-1083.561) * (-1084.418) (-1084.787) (-1084.998) [-1084.436] -- 0:00:47
254000 -- (-1087.235) (-1087.083) (-1088.424) [-1085.354] * (-1086.816) (-1085.343) (-1086.815) [-1083.946] -- 0:00:46
254500 -- (-1086.762) (-1085.915) [-1086.723] (-1085.455) * [-1085.360] (-1084.789) (-1088.982) (-1084.692) -- 0:00:46
255000 -- (-1085.478) (-1083.719) (-1086.412) [-1084.130] * (-1086.070) [-1083.858] (-1093.511) (-1083.522) -- 0:00:46
Average standard deviation of split frequencies: 0.009965
255500 -- [-1083.957] (-1088.831) (-1084.886) (-1086.566) * (-1087.599) (-1088.601) (-1086.423) [-1086.557] -- 0:00:46
256000 -- (-1084.953) [-1085.342] (-1084.423) (-1088.984) * (-1086.494) (-1087.314) (-1084.019) [-1087.657] -- 0:00:46
256500 -- (-1084.971) (-1086.108) [-1085.183] (-1086.488) * (-1086.734) (-1084.313) [-1085.280] (-1085.253) -- 0:00:46
257000 -- (-1084.857) [-1084.435] (-1086.307) (-1085.520) * (-1085.781) (-1089.805) [-1086.291] (-1084.488) -- 0:00:46
257500 -- (-1085.123) (-1085.711) [-1083.936] (-1086.755) * [-1086.966] (-1086.765) (-1084.375) (-1088.210) -- 0:00:46
258000 -- [-1084.277] (-1084.631) (-1090.962) (-1086.421) * (-1084.377) (-1086.109) (-1086.723) [-1085.243] -- 0:00:46
258500 -- (-1084.705) (-1087.013) [-1085.481] (-1085.720) * (-1084.369) [-1088.579] (-1085.689) (-1084.692) -- 0:00:45
259000 -- (-1084.340) [-1086.659] (-1083.836) (-1086.805) * (-1083.578) [-1086.308] (-1085.990) (-1089.479) -- 0:00:45
259500 -- (-1089.721) [-1087.208] (-1085.049) (-1085.281) * (-1084.569) [-1086.417] (-1085.443) (-1087.361) -- 0:00:45
260000 -- (-1086.637) [-1084.412] (-1098.223) (-1087.638) * (-1086.822) (-1084.391) [-1084.802] (-1085.132) -- 0:00:45
Average standard deviation of split frequencies: 0.009149
260500 -- [-1084.839] (-1084.244) (-1094.142) (-1088.632) * (-1083.794) [-1084.126] (-1085.499) (-1084.884) -- 0:00:45
261000 -- (-1086.576) [-1083.968] (-1085.695) (-1087.872) * (-1083.048) [-1085.267] (-1084.901) (-1086.410) -- 0:00:48
261500 -- [-1086.567] (-1085.698) (-1084.362) (-1086.710) * [-1083.756] (-1087.043) (-1085.095) (-1087.407) -- 0:00:48
262000 -- [-1084.789] (-1084.474) (-1084.186) (-1085.258) * (-1085.086) (-1089.870) (-1088.319) [-1089.492] -- 0:00:47
262500 -- (-1087.095) [-1084.664] (-1088.500) (-1085.335) * (-1084.817) (-1085.089) (-1087.692) [-1087.136] -- 0:00:47
263000 -- [-1086.533] (-1085.238) (-1088.601) (-1087.257) * [-1087.229] (-1090.786) (-1088.202) (-1087.920) -- 0:00:47
263500 -- (-1095.134) (-1085.042) [-1086.014] (-1085.660) * (-1089.811) (-1085.521) (-1086.100) [-1085.124] -- 0:00:47
264000 -- (-1087.957) [-1086.302] (-1086.284) (-1084.482) * (-1089.534) [-1085.155] (-1085.533) (-1084.979) -- 0:00:47
264500 -- (-1087.301) (-1083.991) [-1083.461] (-1086.041) * (-1083.250) [-1088.683] (-1085.683) (-1083.239) -- 0:00:47
265000 -- (-1085.350) (-1083.550) (-1084.111) [-1088.325] * (-1084.810) (-1087.727) (-1086.962) [-1085.090] -- 0:00:47
Average standard deviation of split frequencies: 0.010929
265500 -- (-1083.765) [-1085.419] (-1086.299) (-1084.490) * [-1085.486] (-1083.428) (-1085.157) (-1085.147) -- 0:00:47
266000 -- (-1084.545) (-1086.657) [-1085.023] (-1085.900) * [-1086.098] (-1090.587) (-1091.914) (-1083.837) -- 0:00:46
266500 -- (-1084.808) (-1087.012) (-1088.139) [-1085.773] * (-1084.232) (-1085.906) (-1084.467) [-1083.592] -- 0:00:46
267000 -- [-1085.817] (-1087.396) (-1087.354) (-1084.268) * (-1086.802) [-1087.160] (-1083.921) (-1085.794) -- 0:00:46
267500 -- (-1085.943) (-1086.003) (-1085.124) [-1088.103] * (-1086.070) (-1088.580) [-1085.016] (-1084.331) -- 0:00:46
268000 -- (-1085.325) [-1083.490] (-1084.056) (-1089.213) * [-1088.005] (-1084.216) (-1088.399) (-1084.785) -- 0:00:46
268500 -- (-1084.307) [-1085.037] (-1084.051) (-1086.536) * (-1087.387) (-1085.946) (-1085.782) [-1085.106] -- 0:00:46
269000 -- (-1084.724) (-1085.414) (-1089.076) [-1083.598] * (-1087.710) (-1084.179) [-1084.067] (-1084.382) -- 0:00:46
269500 -- [-1084.560] (-1085.039) (-1088.883) (-1085.175) * (-1085.939) (-1083.083) (-1087.363) [-1084.737] -- 0:00:46
270000 -- (-1086.075) (-1083.697) [-1085.925] (-1084.041) * (-1085.293) (-1086.817) (-1086.017) [-1085.140] -- 0:00:45
Average standard deviation of split frequencies: 0.012704
270500 -- (-1085.468) (-1085.898) (-1085.880) [-1085.385] * (-1085.210) (-1086.023) (-1084.311) [-1083.412] -- 0:00:45
271000 -- (-1085.078) (-1084.361) [-1086.379] (-1084.159) * (-1085.807) (-1085.503) [-1086.540] (-1083.395) -- 0:00:45
271500 -- (-1085.103) (-1084.033) [-1085.386] (-1083.864) * (-1086.216) (-1084.853) [-1088.298] (-1083.395) -- 0:00:45
272000 -- (-1086.091) (-1085.078) [-1086.099] (-1086.515) * [-1087.211] (-1085.080) (-1088.213) (-1085.328) -- 0:00:45
272500 -- (-1084.979) (-1086.750) [-1084.492] (-1083.604) * (-1086.613) (-1083.986) (-1084.798) [-1083.896] -- 0:00:45
273000 -- (-1083.300) (-1089.017) [-1085.396] (-1084.758) * (-1087.034) [-1083.298] (-1084.174) (-1086.296) -- 0:00:45
273500 -- [-1085.660] (-1089.853) (-1084.207) (-1085.204) * (-1085.903) [-1083.301] (-1084.052) (-1086.321) -- 0:00:45
274000 -- [-1085.454] (-1087.667) (-1085.017) (-1086.472) * (-1086.351) (-1083.989) (-1084.289) [-1085.190] -- 0:00:45
274500 -- (-1086.824) (-1086.146) [-1085.683] (-1086.319) * (-1087.977) (-1083.752) (-1085.275) [-1086.968] -- 0:00:44
275000 -- (-1086.064) [-1085.205] (-1087.049) (-1085.788) * [-1085.480] (-1086.460) (-1086.316) (-1086.412) -- 0:00:44
Average standard deviation of split frequencies: 0.011855
275500 -- [-1086.910] (-1087.689) (-1086.711) (-1084.883) * [-1083.298] (-1084.353) (-1086.135) (-1085.357) -- 0:00:44
276000 -- [-1084.154] (-1084.124) (-1087.145) (-1085.059) * (-1083.554) (-1086.025) [-1085.554] (-1085.821) -- 0:00:44
276500 -- [-1085.799] (-1084.538) (-1086.774) (-1090.906) * (-1084.613) [-1086.946] (-1084.829) (-1084.896) -- 0:00:44
277000 -- (-1085.457) (-1086.156) [-1085.228] (-1087.834) * [-1084.150] (-1086.269) (-1085.185) (-1083.913) -- 0:00:46
277500 -- (-1085.533) [-1085.869] (-1087.999) (-1084.550) * [-1085.768] (-1085.602) (-1086.870) (-1087.703) -- 0:00:46
278000 -- [-1085.774] (-1087.558) (-1083.806) (-1083.573) * (-1086.714) (-1084.325) [-1083.963] (-1086.227) -- 0:00:46
278500 -- (-1087.514) [-1087.050] (-1086.590) (-1084.112) * (-1087.012) [-1084.325] (-1084.403) (-1087.339) -- 0:00:46
279000 -- (-1084.894) (-1084.536) [-1086.403] (-1085.599) * (-1085.554) (-1084.295) [-1083.427] (-1086.484) -- 0:00:46
279500 -- (-1085.043) (-1083.884) (-1085.513) [-1083.398] * (-1086.423) (-1085.310) (-1084.542) [-1086.431] -- 0:00:46
280000 -- (-1085.548) (-1084.033) [-1086.951] (-1086.854) * (-1084.160) (-1085.310) [-1084.172] (-1087.605) -- 0:00:46
Average standard deviation of split frequencies: 0.010812
280500 -- [-1087.282] (-1086.414) (-1086.935) (-1086.349) * [-1087.253] (-1085.393) (-1086.486) (-1085.919) -- 0:00:46
281000 -- (-1084.689) (-1083.967) [-1083.910] (-1085.316) * (-1087.948) (-1088.233) (-1085.077) [-1084.704] -- 0:00:46
281500 -- (-1083.752) (-1083.970) [-1084.734] (-1085.449) * (-1089.172) [-1084.384] (-1087.446) (-1085.032) -- 0:00:45
282000 -- (-1084.861) (-1084.193) [-1085.939] (-1086.615) * (-1087.053) (-1090.147) [-1087.162] (-1085.801) -- 0:00:45
282500 -- (-1085.701) (-1086.698) (-1085.518) [-1086.796] * (-1086.056) [-1084.707] (-1086.133) (-1085.236) -- 0:00:45
283000 -- (-1088.272) [-1087.681] (-1084.785) (-1086.100) * (-1086.000) (-1085.130) [-1084.782] (-1086.085) -- 0:00:45
283500 -- (-1088.427) [-1083.301] (-1083.371) (-1089.106) * (-1085.660) [-1085.349] (-1083.752) (-1087.611) -- 0:00:45
284000 -- [-1086.719] (-1087.218) (-1084.661) (-1087.897) * (-1084.268) (-1085.179) (-1093.157) [-1087.864] -- 0:00:45
284500 -- (-1085.316) [-1086.060] (-1085.231) (-1085.716) * (-1085.168) (-1086.301) [-1085.593] (-1088.241) -- 0:00:45
285000 -- (-1088.402) (-1085.033) [-1083.694] (-1084.219) * [-1084.092] (-1085.851) (-1087.098) (-1087.557) -- 0:00:45
Average standard deviation of split frequencies: 0.011538
285500 -- [-1085.962] (-1083.606) (-1084.181) (-1085.023) * (-1084.553) [-1086.291] (-1086.549) (-1086.495) -- 0:00:45
286000 -- (-1084.311) (-1085.018) [-1084.287] (-1088.517) * (-1083.435) [-1084.587] (-1086.634) (-1084.179) -- 0:00:44
286500 -- (-1084.878) [-1084.778] (-1084.720) (-1086.330) * (-1085.504) (-1085.644) (-1086.528) [-1083.949] -- 0:00:44
287000 -- [-1083.217] (-1085.223) (-1087.081) (-1085.968) * (-1086.495) (-1086.321) (-1086.531) [-1084.285] -- 0:00:44
287500 -- (-1083.913) (-1090.609) (-1084.788) [-1084.733] * [-1085.201] (-1084.521) (-1084.956) (-1085.177) -- 0:00:44
288000 -- (-1083.915) [-1085.520] (-1084.846) (-1085.950) * (-1083.732) (-1089.488) (-1084.399) [-1086.601] -- 0:00:44
288500 -- (-1084.715) (-1087.481) [-1085.365] (-1084.864) * (-1082.992) (-1084.020) [-1086.664] (-1087.794) -- 0:00:44
289000 -- (-1084.347) (-1083.572) [-1086.149] (-1091.183) * (-1084.678) [-1084.565] (-1087.043) (-1088.517) -- 0:00:44
289500 -- (-1086.364) (-1086.694) (-1088.248) [-1085.530] * [-1083.301] (-1084.587) (-1084.818) (-1087.077) -- 0:00:44
290000 -- (-1085.440) (-1086.807) (-1086.352) [-1084.537] * (-1084.450) (-1085.877) [-1085.331] (-1084.521) -- 0:00:44
Average standard deviation of split frequencies: 0.012164
290500 -- (-1084.060) [-1084.146] (-1084.833) (-1084.934) * [-1087.635] (-1087.809) (-1084.593) (-1087.512) -- 0:00:43
291000 -- (-1084.705) (-1084.394) (-1087.522) [-1083.769] * (-1084.947) (-1084.365) (-1084.503) [-1088.300] -- 0:00:43
291500 -- (-1087.991) (-1089.222) [-1084.313] (-1084.161) * [-1086.180] (-1085.569) (-1084.664) (-1087.512) -- 0:00:43
292000 -- [-1086.932] (-1084.861) (-1084.558) (-1083.955) * (-1085.998) (-1085.739) (-1084.105) [-1083.359] -- 0:00:43
292500 -- [-1087.344] (-1086.894) (-1083.953) (-1087.318) * (-1085.996) (-1087.725) [-1084.860] (-1087.498) -- 0:00:43
293000 -- (-1089.264) (-1084.593) [-1085.662] (-1084.776) * [-1085.596] (-1090.600) (-1084.466) (-1085.156) -- 0:00:45
293500 -- (-1084.514) (-1088.456) [-1088.095] (-1085.233) * (-1084.141) (-1085.336) [-1085.293] (-1085.361) -- 0:00:45
294000 -- (-1084.074) (-1086.948) (-1087.163) [-1085.214] * (-1084.881) [-1087.102] (-1084.454) (-1087.197) -- 0:00:45
294500 -- [-1084.992] (-1085.502) (-1085.382) (-1086.172) * (-1086.479) (-1087.243) [-1083.910] (-1084.885) -- 0:00:45
295000 -- (-1086.059) (-1087.510) (-1085.689) [-1085.515] * (-1086.077) (-1086.060) (-1083.823) [-1083.860] -- 0:00:45
Average standard deviation of split frequencies: 0.011347
295500 -- (-1086.769) (-1085.393) (-1085.084) [-1083.694] * (-1085.836) (-1085.046) (-1084.708) [-1084.510] -- 0:00:45
296000 -- (-1086.425) (-1083.455) (-1084.816) [-1083.859] * (-1085.207) (-1084.456) (-1088.768) [-1084.315] -- 0:00:45
296500 -- (-1085.569) [-1084.160] (-1085.394) (-1083.625) * (-1084.287) [-1084.381] (-1087.413) (-1084.292) -- 0:00:45
297000 -- (-1084.365) (-1085.207) (-1083.758) [-1084.109] * (-1086.003) (-1084.862) (-1087.506) [-1085.573] -- 0:00:44
297500 -- (-1083.799) (-1087.692) (-1083.841) [-1082.908] * (-1085.196) [-1087.688] (-1094.191) (-1084.972) -- 0:00:44
298000 -- (-1087.808) (-1085.573) [-1085.195] (-1084.801) * [-1083.292] (-1084.758) (-1087.078) (-1085.283) -- 0:00:44
298500 -- [-1083.606] (-1085.040) (-1087.536) (-1086.186) * (-1084.317) (-1086.163) [-1087.071] (-1085.301) -- 0:00:44
299000 -- [-1084.219] (-1085.039) (-1087.321) (-1093.560) * [-1084.029] (-1085.721) (-1086.958) (-1085.580) -- 0:00:44
299500 -- [-1087.224] (-1085.264) (-1083.705) (-1088.055) * (-1083.845) [-1084.356] (-1086.151) (-1085.562) -- 0:00:44
300000 -- [-1085.280] (-1085.654) (-1084.404) (-1086.889) * (-1084.924) [-1084.022] (-1086.819) (-1089.189) -- 0:00:44
Average standard deviation of split frequencies: 0.011465
300500 -- [-1086.483] (-1083.329) (-1083.648) (-1085.963) * (-1087.356) (-1086.960) [-1086.034] (-1089.891) -- 0:00:44
301000 -- (-1087.919) [-1084.753] (-1083.658) (-1086.204) * (-1090.518) (-1085.994) [-1087.826] (-1084.439) -- 0:00:44
301500 -- (-1087.326) [-1085.297] (-1083.051) (-1084.249) * [-1085.810] (-1087.192) (-1088.703) (-1084.186) -- 0:00:44
302000 -- (-1085.845) [-1084.715] (-1082.981) (-1083.839) * (-1085.134) (-1091.409) (-1087.163) [-1084.441] -- 0:00:43
302500 -- (-1089.469) (-1086.148) [-1085.193] (-1084.277) * (-1083.894) (-1084.452) [-1083.889] (-1083.434) -- 0:00:43
303000 -- (-1087.742) (-1087.300) [-1084.497] (-1083.623) * (-1086.901) [-1084.302] (-1083.897) (-1083.459) -- 0:00:43
303500 -- [-1088.008] (-1089.570) (-1083.271) (-1083.436) * (-1087.085) [-1084.511] (-1084.546) (-1084.537) -- 0:00:43
304000 -- (-1087.585) (-1085.495) [-1083.935] (-1085.744) * (-1087.893) [-1085.215] (-1084.918) (-1084.076) -- 0:00:43
304500 -- (-1087.960) (-1086.270) (-1084.629) [-1084.035] * [-1086.666] (-1083.689) (-1084.667) (-1083.450) -- 0:00:43
305000 -- (-1089.806) [-1087.419] (-1084.545) (-1083.933) * (-1085.792) [-1084.534] (-1085.701) (-1083.660) -- 0:00:43
Average standard deviation of split frequencies: 0.010976
305500 -- (-1085.186) (-1086.776) (-1085.010) [-1083.947] * (-1085.451) (-1084.680) (-1084.454) [-1086.509] -- 0:00:43
306000 -- (-1084.903) [-1086.171] (-1086.646) (-1085.015) * (-1085.489) (-1085.843) [-1085.349] (-1092.727) -- 0:00:43
306500 -- (-1085.315) (-1085.888) [-1084.357] (-1083.925) * (-1085.660) [-1085.624] (-1084.369) (-1091.294) -- 0:00:42
307000 -- (-1085.300) (-1086.201) [-1083.086] (-1088.079) * (-1086.062) (-1085.244) (-1084.042) [-1085.860] -- 0:00:42
307500 -- [-1085.830] (-1087.683) (-1084.510) (-1088.291) * (-1089.831) (-1086.764) (-1084.768) [-1084.417] -- 0:00:42
308000 -- (-1088.672) [-1084.141] (-1084.207) (-1087.579) * [-1083.946] (-1086.431) (-1088.946) (-1086.597) -- 0:00:42
308500 -- (-1085.364) [-1086.586] (-1087.680) (-1089.402) * [-1085.496] (-1087.217) (-1088.442) (-1085.150) -- 0:00:42
309000 -- (-1084.998) [-1085.136] (-1084.301) (-1085.331) * [-1087.417] (-1087.454) (-1087.081) (-1085.370) -- 0:00:44
309500 -- (-1088.784) [-1086.566] (-1084.766) (-1087.083) * (-1086.737) (-1085.202) [-1084.812] (-1085.689) -- 0:00:44
310000 -- (-1088.136) (-1087.212) [-1083.324] (-1085.953) * [-1088.687] (-1086.074) (-1084.813) (-1084.158) -- 0:00:44
Average standard deviation of split frequencies: 0.010053
310500 -- (-1085.551) (-1086.828) (-1084.586) [-1085.583] * [-1084.772] (-1085.394) (-1087.483) (-1088.237) -- 0:00:44
311000 -- (-1089.735) (-1085.237) (-1084.048) [-1084.240] * (-1085.323) (-1090.620) [-1084.228] (-1087.225) -- 0:00:44
311500 -- (-1087.901) [-1084.493] (-1084.456) (-1086.163) * (-1087.018) (-1091.343) (-1084.383) [-1084.927] -- 0:00:44
312000 -- (-1090.768) (-1084.471) [-1089.114] (-1086.974) * (-1083.503) (-1086.212) [-1086.834] (-1086.392) -- 0:00:44
312500 -- [-1086.372] (-1088.916) (-1084.609) (-1091.874) * (-1083.510) [-1083.833] (-1089.336) (-1086.428) -- 0:00:44
313000 -- (-1086.806) (-1084.770) (-1083.765) [-1087.163] * [-1083.460] (-1087.857) (-1090.775) (-1089.614) -- 0:00:43
313500 -- (-1085.787) (-1090.285) (-1083.703) [-1084.122] * (-1084.329) (-1084.668) (-1090.983) [-1086.052] -- 0:00:43
314000 -- (-1086.810) (-1085.960) (-1084.993) [-1086.006] * (-1085.531) (-1084.949) (-1085.489) [-1083.717] -- 0:00:43
314500 -- (-1087.952) (-1086.727) (-1084.953) [-1086.301] * [-1085.355] (-1085.279) (-1084.832) (-1084.637) -- 0:00:43
315000 -- (-1086.855) (-1085.031) (-1088.481) [-1083.371] * (-1084.376) (-1090.093) [-1083.890] (-1090.135) -- 0:00:43
Average standard deviation of split frequencies: 0.010256
315500 -- (-1087.015) (-1085.848) [-1087.626] (-1086.309) * [-1084.373] (-1085.515) (-1086.682) (-1087.270) -- 0:00:43
316000 -- (-1086.668) (-1085.813) [-1086.185] (-1087.894) * (-1086.877) (-1086.574) [-1084.198] (-1085.848) -- 0:00:43
316500 -- (-1088.122) [-1085.597] (-1084.098) (-1088.987) * [-1086.632] (-1084.836) (-1084.035) (-1085.260) -- 0:00:43
317000 -- (-1088.243) [-1084.885] (-1083.396) (-1086.959) * (-1084.163) (-1084.610) [-1083.463] (-1084.544) -- 0:00:43
317500 -- (-1088.407) [-1084.302] (-1085.349) (-1086.352) * [-1085.063] (-1089.580) (-1084.321) (-1084.391) -- 0:00:42
318000 -- (-1085.874) [-1086.213] (-1086.789) (-1087.822) * (-1085.599) (-1090.040) [-1085.738] (-1083.585) -- 0:00:42
318500 -- (-1083.656) [-1084.703] (-1086.185) (-1086.428) * (-1088.035) (-1089.817) [-1084.487] (-1084.004) -- 0:00:42
319000 -- (-1085.789) (-1084.706) [-1084.782] (-1086.654) * [-1085.494] (-1091.473) (-1085.402) (-1085.546) -- 0:00:42
319500 -- (-1087.557) [-1084.201] (-1083.289) (-1085.208) * (-1085.736) (-1086.126) (-1086.096) [-1085.828] -- 0:00:42
320000 -- (-1084.687) (-1086.224) [-1083.337] (-1085.907) * (-1093.441) (-1086.455) [-1084.299] (-1085.998) -- 0:00:42
Average standard deviation of split frequencies: 0.010382
320500 -- (-1085.457) (-1087.724) (-1083.758) [-1083.390] * (-1086.501) (-1090.523) [-1083.498] (-1086.167) -- 0:00:42
321000 -- [-1087.586] (-1086.533) (-1085.048) (-1083.360) * [-1086.304] (-1083.644) (-1084.156) (-1085.396) -- 0:00:42
321500 -- (-1085.484) (-1087.759) (-1085.770) [-1084.109] * [-1085.658] (-1085.002) (-1086.105) (-1084.684) -- 0:00:42
322000 -- (-1083.405) (-1086.638) (-1085.171) [-1085.552] * (-1088.311) (-1087.041) (-1086.589) [-1084.422] -- 0:00:42
322500 -- (-1085.350) (-1084.712) (-1085.552) [-1087.378] * [-1084.975] (-1083.678) (-1085.488) (-1085.744) -- 0:00:42
323000 -- (-1084.798) (-1085.857) [-1084.684] (-1085.253) * (-1084.328) (-1084.982) [-1086.056] (-1088.076) -- 0:00:41
323500 -- (-1085.769) [-1087.284] (-1085.200) (-1086.649) * (-1087.218) [-1085.317] (-1084.044) (-1091.061) -- 0:00:41
324000 -- (-1089.082) (-1084.245) [-1086.130] (-1084.909) * (-1088.534) (-1084.456) (-1084.215) [-1086.424] -- 0:00:41
324500 -- [-1083.856] (-1083.324) (-1084.706) (-1084.944) * [-1084.378] (-1084.191) (-1085.068) (-1087.258) -- 0:00:41
325000 -- (-1088.973) [-1085.762] (-1087.684) (-1084.800) * (-1087.893) [-1084.242] (-1085.202) (-1087.027) -- 0:00:41
Average standard deviation of split frequencies: 0.009782
325500 -- (-1084.363) (-1084.881) [-1086.125] (-1093.652) * (-1086.874) (-1085.097) (-1084.988) [-1090.593] -- 0:00:43
326000 -- [-1083.447] (-1085.123) (-1084.953) (-1088.337) * (-1090.985) (-1085.091) (-1085.515) [-1087.508] -- 0:00:43
326500 -- (-1083.956) [-1086.045] (-1086.160) (-1090.676) * (-1086.953) [-1085.168] (-1084.507) (-1087.686) -- 0:00:43
327000 -- [-1083.553] (-1085.791) (-1083.645) (-1086.747) * (-1085.326) [-1083.810] (-1084.834) (-1084.358) -- 0:00:43
327500 -- [-1085.813] (-1085.171) (-1084.835) (-1083.718) * (-1085.479) (-1085.668) (-1086.657) [-1084.136] -- 0:00:43
328000 -- (-1089.850) (-1084.699) [-1083.871] (-1085.750) * (-1086.475) (-1085.074) (-1088.682) [-1086.081] -- 0:00:43
328500 -- (-1084.630) (-1086.518) [-1083.044] (-1084.328) * (-1085.798) (-1085.475) (-1087.546) [-1084.943] -- 0:00:42
329000 -- (-1085.704) (-1088.314) [-1087.700] (-1085.274) * (-1090.632) [-1083.974] (-1085.533) (-1090.227) -- 0:00:42
329500 -- (-1084.280) (-1085.488) [-1087.421] (-1084.221) * (-1089.349) (-1085.322) (-1085.712) [-1090.877] -- 0:00:42
330000 -- [-1086.462] (-1085.013) (-1087.452) (-1085.782) * (-1084.962) [-1084.977] (-1084.992) (-1089.453) -- 0:00:42
Average standard deviation of split frequencies: 0.009583
330500 -- [-1087.435] (-1087.958) (-1087.560) (-1084.025) * [-1085.662] (-1087.929) (-1083.751) (-1088.767) -- 0:00:42
331000 -- (-1087.637) (-1090.829) (-1085.896) [-1084.834] * [-1086.897] (-1089.457) (-1084.357) (-1085.733) -- 0:00:42
331500 -- (-1087.167) (-1087.397) [-1086.880] (-1085.195) * (-1086.397) (-1090.190) (-1085.148) [-1087.900] -- 0:00:42
332000 -- (-1084.801) (-1085.732) [-1085.274] (-1085.325) * [-1087.363] (-1083.564) (-1084.428) (-1084.131) -- 0:00:42
332500 -- (-1085.152) [-1089.686] (-1084.771) (-1088.434) * (-1084.498) (-1085.210) (-1085.730) [-1085.598] -- 0:00:42
333000 -- (-1085.339) [-1087.547] (-1086.700) (-1084.667) * (-1092.876) [-1084.234] (-1084.955) (-1084.838) -- 0:00:42
333500 -- (-1084.441) (-1086.543) [-1087.877] (-1085.167) * (-1085.391) (-1084.758) [-1084.176] (-1089.066) -- 0:00:41
334000 -- (-1086.411) (-1083.400) [-1085.001] (-1085.816) * (-1083.724) [-1084.677] (-1085.258) (-1089.717) -- 0:00:41
334500 -- (-1090.386) (-1085.386) [-1086.628] (-1084.667) * (-1084.417) [-1084.400] (-1084.309) (-1087.103) -- 0:00:41
335000 -- (-1087.901) (-1086.349) [-1083.900] (-1084.888) * (-1084.845) [-1083.756] (-1084.567) (-1084.139) -- 0:00:41
Average standard deviation of split frequencies: 0.008944
335500 -- [-1086.425] (-1084.548) (-1086.037) (-1083.845) * (-1085.134) (-1083.674) (-1086.074) [-1084.256] -- 0:00:41
336000 -- (-1084.662) [-1085.089] (-1086.294) (-1087.433) * (-1088.497) (-1083.684) [-1085.981] (-1083.652) -- 0:00:41
336500 -- (-1088.409) (-1088.393) (-1085.961) [-1087.046] * (-1086.039) (-1085.064) (-1084.853) [-1083.063] -- 0:00:41
337000 -- (-1088.788) (-1086.836) [-1087.092] (-1086.422) * (-1086.636) (-1085.454) (-1086.857) [-1088.356] -- 0:00:41
337500 -- (-1083.537) (-1086.163) (-1086.584) [-1084.475] * [-1087.416] (-1086.796) (-1089.518) (-1084.899) -- 0:00:41
338000 -- (-1084.008) (-1088.064) [-1083.835] (-1084.556) * (-1085.648) (-1087.142) (-1089.101) [-1085.420] -- 0:00:41
338500 -- (-1085.510) (-1087.357) [-1085.680] (-1084.263) * (-1087.436) [-1085.319] (-1087.241) (-1085.195) -- 0:00:41
339000 -- [-1084.380] (-1085.485) (-1083.639) (-1084.653) * (-1086.299) [-1083.632] (-1086.264) (-1086.850) -- 0:00:40
339500 -- [-1083.442] (-1083.901) (-1083.845) (-1084.764) * (-1085.010) (-1084.860) [-1087.252] (-1090.947) -- 0:00:40
340000 -- (-1083.364) (-1084.558) [-1083.259] (-1085.957) * (-1086.601) (-1084.516) (-1085.707) [-1087.004] -- 0:00:40
Average standard deviation of split frequencies: 0.008476
340500 -- (-1084.158) (-1083.638) (-1085.807) [-1084.493] * (-1089.841) (-1087.590) [-1086.540] (-1084.759) -- 0:00:40
341000 -- (-1083.984) [-1086.507] (-1084.280) (-1089.837) * (-1087.259) (-1085.655) (-1084.957) [-1084.082] -- 0:00:40
341500 -- (-1087.028) (-1088.517) [-1083.615] (-1084.146) * (-1085.364) (-1084.961) [-1084.061] (-1084.620) -- 0:00:42
342000 -- (-1086.022) (-1085.801) (-1083.267) [-1084.673] * (-1084.089) (-1085.875) (-1084.084) [-1088.295] -- 0:00:42
342500 -- (-1089.651) (-1087.957) (-1084.459) [-1085.653] * (-1084.253) (-1083.707) [-1088.150] (-1087.402) -- 0:00:42
343000 -- (-1085.028) (-1084.771) [-1084.458] (-1086.292) * (-1083.553) (-1086.022) (-1087.847) [-1083.976] -- 0:00:42
343500 -- [-1084.555] (-1086.369) (-1086.620) (-1084.060) * (-1085.567) (-1085.236) [-1092.315] (-1084.101) -- 0:00:42
344000 -- (-1084.399) (-1088.813) [-1085.436] (-1083.951) * (-1087.094) [-1084.158] (-1084.550) (-1090.777) -- 0:00:41
344500 -- [-1084.819] (-1087.728) (-1083.912) (-1084.481) * (-1085.525) [-1085.377] (-1083.567) (-1086.725) -- 0:00:41
345000 -- (-1083.850) (-1084.741) [-1083.742] (-1085.524) * (-1086.327) (-1085.212) (-1083.664) [-1085.834] -- 0:00:41
Average standard deviation of split frequencies: 0.008014
345500 -- (-1087.416) (-1083.776) (-1085.292) [-1086.205] * (-1085.193) [-1084.787] (-1083.235) (-1087.197) -- 0:00:41
346000 -- [-1089.811] (-1085.359) (-1085.291) (-1085.648) * (-1089.065) (-1084.787) (-1085.711) [-1088.673] -- 0:00:41
346500 -- [-1087.681] (-1085.610) (-1085.137) (-1085.398) * (-1088.512) [-1087.871] (-1083.614) (-1086.486) -- 0:00:41
347000 -- (-1085.613) (-1086.549) [-1087.619] (-1084.730) * (-1085.743) [-1086.120] (-1084.900) (-1083.043) -- 0:00:41
347500 -- (-1085.819) (-1085.351) [-1085.156] (-1084.856) * (-1086.322) (-1090.365) [-1085.172] (-1083.854) -- 0:00:41
348000 -- [-1084.720] (-1084.502) (-1085.542) (-1086.257) * (-1086.696) (-1086.341) [-1084.697] (-1089.881) -- 0:00:41
348500 -- [-1084.851] (-1087.362) (-1086.155) (-1088.421) * (-1085.926) (-1087.694) (-1085.012) [-1084.920] -- 0:00:41
349000 -- (-1086.765) [-1083.927] (-1088.491) (-1086.309) * [-1090.586] (-1085.105) (-1085.623) (-1084.898) -- 0:00:41
349500 -- (-1084.382) (-1084.768) (-1087.152) [-1085.876] * [-1084.466] (-1084.637) (-1083.703) (-1083.274) -- 0:00:40
350000 -- [-1085.449] (-1083.688) (-1085.877) (-1084.387) * (-1085.457) (-1084.057) [-1084.235] (-1084.698) -- 0:00:40
Average standard deviation of split frequencies: 0.008150
350500 -- (-1087.604) (-1086.084) [-1083.677] (-1084.387) * [-1085.003] (-1085.418) (-1085.670) (-1086.330) -- 0:00:40
351000 -- (-1085.138) (-1085.337) (-1083.520) [-1083.647] * (-1086.021) (-1086.977) (-1085.582) [-1085.682] -- 0:00:40
351500 -- (-1083.818) (-1090.077) (-1085.148) [-1084.229] * [-1083.564] (-1085.087) (-1084.389) (-1086.885) -- 0:00:40
352000 -- (-1084.035) [-1087.225] (-1084.230) (-1084.982) * [-1084.997] (-1087.202) (-1086.083) (-1085.811) -- 0:00:40
352500 -- (-1083.085) (-1084.783) [-1085.018] (-1083.365) * (-1085.406) [-1085.886] (-1085.756) (-1085.804) -- 0:00:40
353000 -- (-1085.899) (-1083.787) (-1085.020) [-1084.340] * (-1084.664) (-1084.801) (-1088.304) [-1087.218] -- 0:00:40
353500 -- (-1085.908) (-1084.386) [-1084.987] (-1084.717) * (-1085.264) (-1087.020) [-1088.282] (-1084.312) -- 0:00:40
354000 -- [-1090.408] (-1083.942) (-1086.189) (-1084.409) * (-1085.181) [-1084.620] (-1087.051) (-1085.322) -- 0:00:40
354500 -- (-1086.527) [-1084.057] (-1085.882) (-1084.085) * (-1083.468) [-1085.149] (-1088.682) (-1085.233) -- 0:00:40
355000 -- [-1086.950] (-1083.460) (-1084.632) (-1085.644) * (-1084.963) (-1085.841) [-1090.769] (-1085.324) -- 0:00:39
Average standard deviation of split frequencies: 0.008359
355500 -- (-1084.798) (-1084.123) (-1083.999) [-1085.790] * [-1085.560] (-1087.167) (-1088.721) (-1084.474) -- 0:00:39
356000 -- (-1084.604) (-1084.952) [-1083.650] (-1085.807) * (-1086.333) (-1084.210) (-1086.403) [-1084.511] -- 0:00:39
356500 -- (-1084.154) [-1086.075] (-1084.772) (-1086.212) * (-1086.658) (-1085.021) (-1084.116) [-1083.584] -- 0:00:39
357000 -- (-1084.397) (-1084.868) (-1088.484) [-1083.391] * (-1085.996) (-1085.735) (-1084.938) [-1084.124] -- 0:00:39
357500 -- (-1087.275) (-1084.427) [-1089.342] (-1084.115) * (-1083.362) [-1085.464] (-1084.003) (-1089.213) -- 0:00:39
358000 -- [-1084.720] (-1084.479) (-1087.102) (-1088.048) * (-1084.357) (-1083.534) [-1085.313] (-1085.710) -- 0:00:41
358500 -- (-1087.472) (-1084.194) (-1087.542) [-1084.886] * (-1084.355) (-1085.723) [-1086.471] (-1084.139) -- 0:00:41
359000 -- [-1085.850] (-1085.344) (-1084.355) (-1086.062) * (-1085.171) (-1086.231) (-1085.903) [-1083.136] -- 0:00:41
359500 -- (-1086.991) [-1084.271] (-1084.504) (-1086.792) * (-1089.473) (-1086.260) [-1086.840] (-1087.478) -- 0:00:40
360000 -- [-1084.384] (-1084.784) (-1084.379) (-1085.274) * (-1088.886) [-1086.201] (-1086.976) (-1084.012) -- 0:00:40
Average standard deviation of split frequencies: 0.007232
360500 -- (-1084.382) (-1090.128) [-1085.042] (-1093.966) * (-1088.155) (-1086.612) [-1086.636] (-1085.956) -- 0:00:40
361000 -- [-1084.288] (-1086.325) (-1084.456) (-1085.863) * (-1086.288) (-1086.521) [-1084.527] (-1088.033) -- 0:00:40
361500 -- [-1084.807] (-1086.069) (-1086.579) (-1084.448) * [-1084.173] (-1089.036) (-1090.271) (-1084.953) -- 0:00:40
362000 -- [-1087.172] (-1086.394) (-1086.244) (-1084.198) * (-1088.029) (-1087.565) (-1088.000) [-1084.214] -- 0:00:40
362500 -- (-1087.376) (-1087.108) (-1087.284) [-1085.353] * (-1084.865) [-1089.265] (-1085.533) (-1083.883) -- 0:00:40
363000 -- (-1084.183) (-1086.268) (-1084.554) [-1083.327] * (-1085.993) (-1084.634) [-1085.065] (-1085.132) -- 0:00:40
363500 -- (-1084.079) (-1083.785) (-1093.260) [-1085.048] * (-1086.611) (-1084.176) [-1083.229] (-1085.664) -- 0:00:40
364000 -- (-1083.815) [-1084.051] (-1086.989) (-1085.433) * [-1085.447] (-1083.917) (-1086.323) (-1088.363) -- 0:00:40
364500 -- [-1085.266] (-1083.704) (-1085.172) (-1085.542) * (-1084.822) (-1088.413) [-1083.977] (-1084.680) -- 0:00:40
365000 -- [-1085.450] (-1084.014) (-1083.430) (-1084.277) * (-1085.069) (-1086.084) [-1085.806] (-1085.697) -- 0:00:40
Average standard deviation of split frequencies: 0.006440
365500 -- (-1083.349) (-1083.899) (-1083.409) [-1086.044] * (-1084.557) (-1085.683) [-1085.335] (-1088.181) -- 0:00:39
366000 -- (-1083.666) [-1083.630] (-1085.204) (-1084.817) * (-1085.904) (-1088.497) (-1085.866) [-1087.610] -- 0:00:39
366500 -- (-1083.604) (-1085.702) (-1085.305) [-1086.882] * (-1085.057) (-1086.553) (-1086.081) [-1084.192] -- 0:00:39
367000 -- (-1083.516) [-1084.690] (-1087.128) (-1091.083) * (-1085.048) [-1084.934] (-1084.057) (-1086.723) -- 0:00:39
367500 -- (-1088.068) (-1083.612) (-1084.027) [-1083.577] * [-1086.370] (-1084.098) (-1084.967) (-1090.744) -- 0:00:39
368000 -- (-1094.218) [-1086.161] (-1083.781) (-1085.000) * (-1083.952) [-1085.970] (-1086.975) (-1087.635) -- 0:00:39
368500 -- (-1083.877) [-1087.291] (-1086.289) (-1084.743) * (-1084.657) (-1089.167) (-1085.529) [-1083.781] -- 0:00:39
369000 -- (-1084.259) (-1087.289) [-1086.023] (-1087.922) * (-1085.546) (-1084.374) [-1083.814] (-1085.009) -- 0:00:39
369500 -- [-1085.991] (-1087.369) (-1088.138) (-1085.012) * (-1086.454) [-1087.925] (-1085.384) (-1088.224) -- 0:00:39
370000 -- (-1087.238) (-1085.080) (-1084.925) [-1085.310] * (-1084.652) (-1085.590) [-1086.477] (-1084.531) -- 0:00:39
Average standard deviation of split frequencies: 0.007800
370500 -- (-1085.117) (-1084.450) [-1087.195] (-1083.450) * (-1085.215) (-1087.597) [-1087.172] (-1086.043) -- 0:00:39
371000 -- (-1084.954) [-1083.569] (-1084.351) (-1083.363) * (-1084.224) (-1085.731) [-1085.003] (-1087.501) -- 0:00:38
371500 -- (-1085.155) (-1083.188) [-1084.488] (-1086.102) * (-1085.554) (-1087.906) [-1084.356] (-1086.115) -- 0:00:38
372000 -- [-1085.200] (-1084.065) (-1087.418) (-1084.919) * (-1087.069) (-1085.351) (-1086.318) [-1086.922] -- 0:00:38
372500 -- (-1085.901) [-1084.914] (-1085.065) (-1083.116) * (-1088.572) [-1087.835] (-1085.895) (-1084.511) -- 0:00:38
373000 -- (-1086.653) (-1087.435) [-1083.002] (-1083.597) * [-1088.560] (-1089.390) (-1084.274) (-1085.702) -- 0:00:38
373500 -- [-1085.854] (-1085.724) (-1083.428) (-1087.377) * (-1087.698) (-1086.881) [-1085.329] (-1084.757) -- 0:00:38
374000 -- (-1086.422) (-1083.528) [-1086.109] (-1086.264) * [-1084.861] (-1085.375) (-1087.074) (-1084.217) -- 0:00:40
374500 -- (-1084.781) [-1083.685] (-1085.561) (-1086.671) * (-1083.337) (-1085.518) (-1087.087) [-1083.886] -- 0:00:40
375000 -- (-1083.791) (-1085.211) [-1085.559] (-1084.516) * [-1086.154] (-1085.344) (-1084.593) (-1083.870) -- 0:00:40
Average standard deviation of split frequencies: 0.008860
375500 -- (-1086.830) (-1088.023) [-1086.619] (-1086.346) * (-1086.535) [-1085.089] (-1087.309) (-1085.377) -- 0:00:39
376000 -- (-1084.537) (-1084.418) [-1085.979] (-1088.196) * (-1087.050) [-1084.269] (-1086.790) (-1085.600) -- 0:00:39
376500 -- (-1084.695) [-1084.632] (-1084.777) (-1083.751) * (-1084.646) (-1083.391) (-1084.922) [-1085.190] -- 0:00:39
377000 -- (-1086.387) (-1085.952) (-1084.827) [-1086.485] * [-1083.672] (-1083.395) (-1089.410) (-1091.576) -- 0:00:39
377500 -- (-1083.947) (-1087.649) [-1084.093] (-1083.532) * (-1083.419) (-1090.642) [-1085.171] (-1086.153) -- 0:00:39
378000 -- (-1088.923) (-1085.702) (-1084.277) [-1090.762] * (-1084.501) (-1084.353) (-1084.663) [-1085.517] -- 0:00:39
378500 -- (-1089.057) (-1083.613) (-1084.856) [-1086.130] * (-1084.890) [-1084.907] (-1087.312) (-1087.660) -- 0:00:39
379000 -- [-1084.661] (-1086.576) (-1089.750) (-1084.407) * (-1084.302) [-1085.906] (-1086.099) (-1088.234) -- 0:00:39
379500 -- (-1085.406) (-1086.827) (-1085.701) [-1084.461] * (-1084.602) (-1084.280) [-1083.902] (-1086.122) -- 0:00:39
380000 -- (-1085.023) [-1086.350] (-1087.664) (-1086.572) * (-1086.369) (-1083.986) (-1086.857) [-1084.397] -- 0:00:39
Average standard deviation of split frequencies: 0.008421
380500 -- (-1085.782) (-1088.737) (-1088.692) [-1085.159] * (-1090.300) (-1084.898) [-1087.460] (-1084.209) -- 0:00:39
381000 -- [-1084.713] (-1088.398) (-1085.321) (-1085.059) * (-1090.176) [-1084.288] (-1088.164) (-1084.327) -- 0:00:38
381500 -- [-1087.580] (-1085.697) (-1083.928) (-1089.090) * [-1084.176] (-1084.590) (-1086.241) (-1083.697) -- 0:00:38
382000 -- (-1084.846) (-1083.685) [-1086.311] (-1084.122) * [-1083.804] (-1084.977) (-1084.277) (-1084.145) -- 0:00:38
382500 -- (-1085.381) (-1084.244) [-1084.645] (-1085.061) * (-1083.713) (-1084.184) (-1085.078) [-1083.932] -- 0:00:38
383000 -- (-1086.006) [-1084.054] (-1085.000) (-1087.621) * (-1083.421) (-1087.811) [-1084.841] (-1085.062) -- 0:00:38
383500 -- (-1085.645) [-1083.399] (-1084.019) (-1084.560) * (-1084.229) (-1085.760) [-1084.755] (-1083.978) -- 0:00:38
384000 -- (-1088.257) (-1083.931) [-1083.953] (-1084.004) * [-1087.019] (-1086.758) (-1083.557) (-1084.671) -- 0:00:38
384500 -- (-1088.520) (-1088.572) [-1084.701] (-1087.952) * (-1087.897) (-1083.952) (-1083.873) [-1086.087] -- 0:00:38
385000 -- (-1087.731) (-1085.530) [-1084.687] (-1086.647) * [-1086.618] (-1085.666) (-1083.855) (-1084.148) -- 0:00:38
Average standard deviation of split frequencies: 0.007979
385500 -- (-1089.196) (-1086.922) (-1083.629) [-1085.455] * (-1088.000) [-1090.340] (-1083.455) (-1087.265) -- 0:00:38
386000 -- (-1086.973) (-1088.527) [-1084.785] (-1086.307) * (-1087.505) (-1084.384) [-1089.329] (-1087.521) -- 0:00:38
386500 -- (-1086.491) (-1085.457) [-1084.441] (-1084.241) * [-1084.097] (-1084.316) (-1090.254) (-1088.498) -- 0:00:38
387000 -- (-1084.869) (-1083.411) [-1083.950] (-1086.874) * [-1083.817] (-1086.938) (-1088.799) (-1091.687) -- 0:00:38
387500 -- (-1085.698) (-1083.527) [-1084.012] (-1086.291) * (-1084.918) [-1085.292] (-1085.957) (-1085.946) -- 0:00:37
388000 -- (-1086.090) [-1083.956] (-1087.141) (-1085.490) * [-1084.384] (-1086.515) (-1084.566) (-1087.145) -- 0:00:37
388500 -- [-1086.400] (-1084.108) (-1087.153) (-1083.520) * (-1084.939) [-1084.494] (-1084.608) (-1085.781) -- 0:00:37
389000 -- [-1088.951] (-1084.376) (-1087.875) (-1089.786) * (-1086.442) (-1084.544) (-1085.789) [-1083.720] -- 0:00:37
389500 -- (-1089.821) (-1086.543) (-1084.813) [-1089.269] * (-1086.547) (-1085.362) [-1086.077] (-1087.116) -- 0:00:37
390000 -- (-1086.081) [-1086.399] (-1086.073) (-1094.256) * (-1084.177) (-1085.312) [-1087.001] (-1091.218) -- 0:00:37
Average standard deviation of split frequencies: 0.007964
390500 -- (-1086.529) [-1084.980] (-1083.458) (-1086.843) * (-1088.184) (-1083.863) [-1083.869] (-1085.187) -- 0:00:39
391000 -- [-1084.448] (-1086.790) (-1084.088) (-1086.827) * (-1087.740) (-1086.936) (-1085.823) [-1084.320] -- 0:00:38
391500 -- (-1088.338) (-1083.907) [-1088.710] (-1085.204) * [-1085.212] (-1084.397) (-1086.540) (-1090.828) -- 0:00:38
392000 -- [-1085.331] (-1085.955) (-1089.268) (-1085.091) * (-1085.419) [-1087.674] (-1085.415) (-1084.598) -- 0:00:38
392500 -- (-1083.736) (-1086.843) [-1086.246] (-1088.747) * (-1088.849) [-1086.900] (-1085.303) (-1085.756) -- 0:00:38
393000 -- (-1084.937) (-1084.324) [-1083.558] (-1088.721) * (-1086.852) [-1084.510] (-1085.356) (-1086.076) -- 0:00:38
393500 -- (-1086.408) (-1086.212) [-1082.937] (-1085.744) * (-1086.988) (-1086.069) [-1085.280] (-1085.844) -- 0:00:38
394000 -- (-1084.581) (-1086.730) (-1084.299) [-1091.142] * (-1083.611) (-1085.164) (-1086.510) [-1086.382] -- 0:00:38
394500 -- [-1084.841] (-1086.315) (-1086.875) (-1083.198) * [-1084.142] (-1084.848) (-1086.435) (-1086.794) -- 0:00:38
395000 -- (-1085.230) (-1086.915) (-1085.970) [-1083.696] * (-1085.625) (-1083.641) [-1086.049] (-1085.403) -- 0:00:38
Average standard deviation of split frequencies: 0.009047
395500 -- (-1084.324) (-1089.794) [-1085.119] (-1083.426) * [-1084.845] (-1083.643) (-1085.616) (-1087.466) -- 0:00:38
396000 -- [-1087.901] (-1085.046) (-1088.948) (-1083.714) * (-1083.722) (-1086.527) (-1085.537) [-1086.431] -- 0:00:38
396500 -- (-1091.077) (-1082.986) (-1089.818) [-1085.835] * (-1083.718) (-1086.627) (-1085.405) [-1086.064] -- 0:00:38
397000 -- (-1088.244) (-1084.968) [-1084.082] (-1087.165) * (-1085.727) (-1085.593) [-1084.905] (-1089.767) -- 0:00:37
397500 -- (-1087.488) (-1085.585) (-1083.942) [-1084.074] * (-1086.613) (-1084.559) (-1085.343) [-1087.095] -- 0:00:37
398000 -- (-1084.436) (-1083.432) [-1083.818] (-1085.713) * (-1084.676) [-1084.499] (-1086.459) (-1085.887) -- 0:00:37
398500 -- (-1083.663) (-1087.264) [-1085.606] (-1085.823) * (-1084.550) [-1084.547] (-1088.525) (-1090.866) -- 0:00:37
399000 -- (-1084.725) [-1084.707] (-1088.248) (-1086.178) * (-1083.906) (-1084.307) [-1084.742] (-1085.593) -- 0:00:37
399500 -- (-1083.784) (-1086.983) (-1085.773) [-1083.676] * (-1085.374) [-1086.298] (-1085.184) (-1085.963) -- 0:00:37
400000 -- (-1083.766) (-1085.821) (-1085.108) [-1084.332] * (-1086.666) [-1084.589] (-1086.375) (-1084.261) -- 0:00:37
Average standard deviation of split frequencies: 0.009177
400500 -- [-1083.625] (-1085.482) (-1083.417) (-1084.089) * (-1086.782) (-1086.108) [-1086.000] (-1084.842) -- 0:00:37
401000 -- (-1083.608) (-1085.893) [-1083.371] (-1084.388) * (-1093.446) (-1089.011) (-1084.494) [-1084.281] -- 0:00:37
401500 -- (-1085.014) (-1085.970) (-1083.663) [-1084.725] * (-1084.639) (-1085.454) (-1084.201) [-1084.104] -- 0:00:37
402000 -- (-1084.670) (-1086.736) (-1083.580) [-1087.405] * [-1085.742] (-1084.852) (-1086.973) (-1084.749) -- 0:00:37
402500 -- (-1085.141) (-1085.683) (-1083.337) [-1086.161] * (-1089.288) (-1085.830) (-1086.653) [-1084.909] -- 0:00:37
403000 -- (-1084.893) [-1088.412] (-1084.580) (-1084.388) * (-1089.369) [-1087.049] (-1084.757) (-1083.407) -- 0:00:37
403500 -- [-1084.403] (-1083.443) (-1087.291) (-1087.255) * (-1087.759) (-1091.342) [-1083.873] (-1086.205) -- 0:00:36
404000 -- [-1086.191] (-1084.714) (-1084.505) (-1085.029) * [-1083.393] (-1086.850) (-1086.413) (-1085.903) -- 0:00:36
404500 -- (-1087.610) (-1084.854) [-1084.453] (-1085.792) * (-1086.963) (-1086.971) (-1086.505) [-1084.224] -- 0:00:36
405000 -- [-1086.869] (-1084.554) (-1087.262) (-1087.335) * (-1085.650) (-1083.799) (-1083.520) [-1083.562] -- 0:00:36
Average standard deviation of split frequencies: 0.008998
405500 -- (-1092.144) (-1087.108) (-1087.373) [-1083.883] * (-1085.012) [-1083.919] (-1085.884) (-1085.476) -- 0:00:36
406000 -- (-1091.557) [-1086.092] (-1090.661) (-1084.684) * (-1083.757) [-1084.890] (-1086.475) (-1084.606) -- 0:00:36
406500 -- (-1084.713) (-1084.585) (-1085.225) [-1084.910] * (-1083.326) [-1084.019] (-1088.366) (-1083.387) -- 0:00:37
407000 -- (-1088.056) (-1087.716) [-1083.609] (-1084.677) * (-1083.937) (-1086.500) (-1086.191) [-1083.955] -- 0:00:37
407500 -- (-1086.838) (-1085.326) (-1083.623) [-1083.566] * (-1088.174) (-1086.358) [-1085.455] (-1084.912) -- 0:00:37
408000 -- (-1085.896) [-1083.867] (-1085.640) (-1085.503) * (-1085.795) (-1087.034) (-1085.844) [-1084.259] -- 0:00:37
408500 -- [-1085.734] (-1087.050) (-1085.273) (-1084.872) * (-1083.992) (-1084.609) (-1084.259) [-1083.701] -- 0:00:37
409000 -- (-1085.447) [-1085.517] (-1088.286) (-1085.215) * (-1085.384) (-1085.414) (-1086.110) [-1085.714] -- 0:00:37
409500 -- (-1083.763) (-1083.497) (-1085.682) [-1087.711] * (-1085.480) (-1084.267) [-1084.652] (-1083.917) -- 0:00:37
410000 -- (-1083.370) [-1085.560] (-1087.473) (-1085.697) * [-1086.621] (-1084.222) (-1084.796) (-1087.401) -- 0:00:37
Average standard deviation of split frequencies: 0.009872
410500 -- (-1090.228) [-1084.262] (-1088.516) (-1085.408) * (-1088.569) (-1083.653) (-1089.180) [-1085.772] -- 0:00:37
411000 -- (-1088.065) (-1090.463) (-1085.449) [-1084.540] * (-1086.578) (-1087.068) (-1086.331) [-1085.586] -- 0:00:37
411500 -- (-1084.938) (-1083.238) [-1084.759] (-1084.206) * (-1085.179) (-1086.213) [-1087.371] (-1086.130) -- 0:00:37
412000 -- (-1084.062) [-1086.713] (-1083.141) (-1085.272) * (-1083.648) (-1084.520) [-1086.499] (-1084.981) -- 0:00:37
412500 -- (-1084.386) [-1085.719] (-1083.901) (-1084.423) * (-1087.751) (-1088.168) [-1084.143] (-1085.757) -- 0:00:37
413000 -- (-1085.419) [-1091.457] (-1084.742) (-1086.019) * (-1086.138) (-1088.155) (-1084.132) [-1083.595] -- 0:00:36
413500 -- [-1084.017] (-1084.863) (-1084.887) (-1086.520) * (-1085.282) (-1086.649) [-1084.943] (-1086.864) -- 0:00:36
414000 -- [-1083.710] (-1085.531) (-1085.147) (-1084.506) * (-1084.023) (-1087.032) (-1084.191) [-1087.536] -- 0:00:36
414500 -- (-1084.825) (-1086.494) [-1085.080] (-1084.473) * (-1083.555) (-1085.779) (-1084.008) [-1086.134] -- 0:00:36
415000 -- (-1088.405) [-1087.525] (-1084.834) (-1084.852) * (-1087.310) (-1085.098) [-1083.878] (-1084.172) -- 0:00:36
Average standard deviation of split frequencies: 0.008763
415500 -- (-1084.755) (-1086.940) [-1084.230] (-1087.752) * (-1084.266) [-1085.743] (-1085.217) (-1084.729) -- 0:00:36
416000 -- (-1085.230) (-1085.731) [-1083.899] (-1085.589) * [-1084.418] (-1086.462) (-1090.109) (-1087.396) -- 0:00:36
416500 -- (-1086.369) (-1085.822) (-1086.384) [-1084.703] * (-1084.848) (-1084.599) [-1087.411] (-1086.682) -- 0:00:36
417000 -- (-1087.413) (-1087.412) (-1086.565) [-1086.824] * (-1084.168) [-1085.782] (-1085.595) (-1087.695) -- 0:00:36
417500 -- (-1087.480) (-1088.499) (-1084.508) [-1087.156] * [-1083.556] (-1086.428) (-1085.305) (-1085.556) -- 0:00:36
418000 -- (-1086.290) (-1086.422) (-1087.152) [-1083.271] * (-1084.653) (-1085.187) (-1083.971) [-1087.960] -- 0:00:36
418500 -- (-1085.192) (-1089.320) (-1083.832) [-1084.756] * [-1083.551] (-1084.322) (-1087.776) (-1084.276) -- 0:00:36
419000 -- (-1087.536) (-1084.236) [-1085.008] (-1084.619) * (-1083.445) [-1084.530] (-1089.002) (-1084.330) -- 0:00:36
419500 -- (-1084.019) (-1090.124) (-1086.052) [-1085.043] * [-1084.645] (-1084.178) (-1085.428) (-1084.337) -- 0:00:35
420000 -- [-1084.001] (-1086.024) (-1084.742) (-1088.176) * (-1084.869) (-1087.367) (-1084.518) [-1084.811] -- 0:00:35
Average standard deviation of split frequencies: 0.009805
420500 -- (-1084.957) (-1085.420) (-1083.815) [-1083.994] * [-1083.637] (-1086.766) (-1086.941) (-1087.464) -- 0:00:35
421000 -- (-1087.170) [-1083.570] (-1088.416) (-1090.088) * (-1083.759) [-1086.746] (-1086.048) (-1092.477) -- 0:00:35
421500 -- [-1083.957] (-1085.307) (-1087.922) (-1083.824) * (-1084.517) [-1083.831] (-1086.566) (-1085.809) -- 0:00:35
422000 -- (-1084.652) (-1085.460) (-1086.799) [-1085.635] * [-1084.598] (-1083.673) (-1085.301) (-1088.687) -- 0:00:35
422500 -- (-1085.162) [-1084.797] (-1086.664) (-1083.251) * (-1084.273) (-1090.918) [-1084.292] (-1084.822) -- 0:00:36
423000 -- [-1085.244] (-1087.167) (-1084.867) (-1087.511) * (-1083.360) (-1083.586) [-1086.404] (-1084.199) -- 0:00:36
423500 -- (-1085.689) [-1087.059] (-1088.403) (-1086.566) * [-1086.078] (-1084.131) (-1085.461) (-1084.797) -- 0:00:36
424000 -- [-1084.271] (-1087.434) (-1084.360) (-1087.565) * (-1084.020) (-1085.273) [-1085.311] (-1084.927) -- 0:00:36
424500 -- (-1085.839) (-1088.088) (-1084.584) [-1086.130] * (-1086.848) (-1084.329) (-1084.092) [-1084.145] -- 0:00:36
425000 -- [-1084.800] (-1086.196) (-1086.432) (-1085.997) * (-1086.801) (-1084.883) [-1086.190] (-1084.205) -- 0:00:36
Average standard deviation of split frequencies: 0.008991
425500 -- (-1085.160) (-1088.787) (-1087.238) [-1085.004] * (-1086.941) (-1083.117) (-1085.250) [-1085.088] -- 0:00:36
426000 -- (-1089.686) (-1085.315) [-1084.795] (-1083.412) * (-1091.190) (-1083.086) [-1084.662] (-1087.401) -- 0:00:36
426500 -- (-1084.545) (-1085.504) [-1086.246] (-1084.025) * [-1091.345] (-1085.663) (-1085.031) (-1085.870) -- 0:00:36
427000 -- [-1085.686] (-1086.658) (-1086.385) (-1084.765) * [-1083.734] (-1086.544) (-1086.313) (-1085.117) -- 0:00:36
427500 -- (-1084.140) (-1086.062) [-1084.207] (-1086.263) * [-1086.765] (-1085.329) (-1083.486) (-1095.047) -- 0:00:36
428000 -- (-1084.530) [-1084.239] (-1084.647) (-1085.142) * (-1086.659) [-1083.787] (-1083.311) (-1088.534) -- 0:00:36
428500 -- (-1084.999) (-1085.259) [-1084.026] (-1088.027) * (-1085.999) [-1088.502] (-1083.994) (-1088.831) -- 0:00:36
429000 -- (-1084.907) (-1086.067) (-1086.214) [-1085.415] * (-1087.051) (-1087.149) (-1084.226) [-1088.069] -- 0:00:35
429500 -- (-1085.401) (-1085.917) [-1083.498] (-1084.435) * (-1085.579) [-1085.649] (-1088.383) (-1087.225) -- 0:00:35
430000 -- (-1090.200) (-1086.849) [-1084.619] (-1092.848) * (-1087.406) (-1085.082) [-1086.593] (-1085.036) -- 0:00:35
Average standard deviation of split frequencies: 0.008611
430500 -- (-1088.676) (-1089.142) [-1084.244] (-1089.401) * (-1085.211) (-1084.114) [-1084.965] (-1086.609) -- 0:00:35
431000 -- (-1086.385) [-1084.987] (-1083.612) (-1087.470) * (-1083.566) [-1085.300] (-1084.123) (-1086.751) -- 0:00:35
431500 -- [-1084.431] (-1084.443) (-1085.903) (-1088.278) * (-1084.625) [-1084.722] (-1084.409) (-1083.884) -- 0:00:35
432000 -- (-1092.919) (-1083.872) [-1085.312] (-1086.989) * (-1085.190) (-1086.921) (-1084.601) [-1086.978] -- 0:00:35
432500 -- (-1092.951) (-1085.953) (-1085.927) [-1084.982] * (-1085.839) (-1087.891) [-1084.360] (-1088.776) -- 0:00:35
433000 -- (-1085.888) [-1083.974] (-1087.178) (-1084.009) * [-1084.650] (-1085.053) (-1084.307) (-1088.342) -- 0:00:35
433500 -- (-1084.001) (-1084.279) [-1085.758] (-1084.383) * (-1084.993) (-1084.698) [-1085.231] (-1084.517) -- 0:00:35
434000 -- (-1083.819) (-1086.507) [-1084.479] (-1088.040) * [-1084.145] (-1084.662) (-1086.567) (-1085.121) -- 0:00:35
434500 -- (-1084.273) (-1084.393) [-1088.190] (-1086.709) * (-1083.131) (-1087.885) (-1083.908) [-1085.557] -- 0:00:35
435000 -- (-1085.352) [-1089.037] (-1086.198) (-1084.140) * (-1086.126) (-1090.693) (-1085.466) [-1086.370] -- 0:00:35
Average standard deviation of split frequencies: 0.008722
435500 -- (-1087.863) (-1084.985) [-1086.389] (-1084.492) * (-1083.414) [-1086.249] (-1084.586) (-1087.201) -- 0:00:34
436000 -- (-1084.298) (-1086.144) [-1084.979] (-1085.593) * (-1084.264) (-1088.164) [-1083.540] (-1085.647) -- 0:00:34
436500 -- (-1083.351) [-1085.439] (-1084.835) (-1089.504) * [-1084.295] (-1088.992) (-1085.626) (-1086.482) -- 0:00:34
437000 -- (-1083.880) [-1084.416] (-1086.434) (-1098.482) * (-1084.629) (-1093.327) (-1083.485) [-1084.022] -- 0:00:34
437500 -- [-1084.620] (-1084.484) (-1086.097) (-1088.257) * (-1084.378) [-1090.642] (-1084.446) (-1084.429) -- 0:00:34
438000 -- (-1083.643) (-1084.231) [-1085.048] (-1083.222) * [-1086.305] (-1090.543) (-1085.116) (-1086.696) -- 0:00:34
438500 -- (-1085.534) (-1084.656) [-1085.179] (-1085.936) * (-1086.009) (-1085.386) (-1085.598) [-1086.380] -- 0:00:34
439000 -- (-1084.271) (-1083.086) (-1084.579) [-1085.222] * (-1089.244) (-1085.240) [-1085.695] (-1088.476) -- 0:00:35
439500 -- [-1084.127] (-1085.073) (-1087.042) (-1087.082) * (-1087.220) [-1086.608] (-1086.925) (-1085.074) -- 0:00:35
440000 -- [-1084.114] (-1087.158) (-1086.314) (-1083.976) * (-1087.471) [-1085.329] (-1085.643) (-1085.279) -- 0:00:35
Average standard deviation of split frequencies: 0.008772
440500 -- [-1087.963] (-1086.211) (-1085.493) (-1086.385) * (-1085.041) (-1092.672) [-1091.415] (-1084.866) -- 0:00:35
441000 -- [-1083.482] (-1084.577) (-1085.280) (-1086.594) * (-1085.511) (-1085.458) (-1086.395) [-1086.043] -- 0:00:35
441500 -- (-1083.626) (-1084.766) [-1087.529] (-1088.532) * (-1088.150) [-1084.257] (-1086.785) (-1085.571) -- 0:00:35
442000 -- (-1084.576) [-1084.540] (-1088.681) (-1089.220) * (-1085.686) [-1083.344] (-1085.847) (-1089.052) -- 0:00:35
442500 -- (-1088.009) (-1084.362) (-1085.919) [-1083.321] * [-1086.658] (-1085.941) (-1084.892) (-1088.791) -- 0:00:35
443000 -- [-1083.740] (-1084.718) (-1089.014) (-1084.676) * (-1084.047) [-1084.060] (-1086.854) (-1094.125) -- 0:00:35
443500 -- (-1083.974) (-1084.051) (-1090.292) [-1084.715] * [-1087.526] (-1085.261) (-1086.772) (-1087.482) -- 0:00:35
444000 -- (-1087.819) (-1084.967) (-1084.499) [-1084.870] * (-1083.378) (-1085.721) [-1085.038] (-1087.070) -- 0:00:35
444500 -- (-1085.158) (-1084.191) (-1084.857) [-1084.674] * (-1085.550) (-1087.523) [-1083.821] (-1087.340) -- 0:00:34
445000 -- (-1086.398) (-1086.395) (-1085.714) [-1083.888] * [-1084.319] (-1088.520) (-1084.709) (-1090.222) -- 0:00:34
Average standard deviation of split frequencies: 0.008456
445500 -- (-1085.143) [-1084.781] (-1085.016) (-1085.941) * (-1084.172) (-1084.609) [-1089.422] (-1089.127) -- 0:00:34
446000 -- (-1089.344) [-1083.876] (-1087.842) (-1084.638) * (-1083.491) (-1083.888) (-1087.044) [-1085.537] -- 0:00:34
446500 -- [-1084.491] (-1085.934) (-1084.609) (-1087.343) * (-1084.993) [-1083.504] (-1086.216) (-1083.246) -- 0:00:34
447000 -- (-1085.059) (-1083.510) (-1088.194) [-1085.790] * (-1086.740) [-1083.558] (-1084.044) (-1085.185) -- 0:00:34
447500 -- (-1085.696) [-1083.658] (-1087.436) (-1085.533) * (-1084.795) (-1083.408) [-1087.876] (-1086.007) -- 0:00:34
448000 -- [-1084.852] (-1085.379) (-1083.908) (-1084.791) * [-1083.846] (-1088.656) (-1084.441) (-1085.215) -- 0:00:34
448500 -- (-1085.927) (-1088.098) [-1087.212] (-1086.547) * [-1084.238] (-1086.375) (-1084.856) (-1085.191) -- 0:00:34
449000 -- (-1084.766) (-1087.017) (-1085.721) [-1084.245] * (-1084.690) (-1087.481) (-1086.169) [-1085.658] -- 0:00:34
449500 -- [-1084.288] (-1084.948) (-1086.255) (-1083.418) * (-1084.989) [-1087.228] (-1083.681) (-1085.681) -- 0:00:34
450000 -- (-1084.426) (-1085.504) [-1083.300] (-1083.150) * (-1085.113) [-1086.065] (-1083.677) (-1083.629) -- 0:00:34
Average standard deviation of split frequencies: 0.007601
450500 -- (-1085.859) (-1088.663) (-1085.150) [-1083.959] * (-1085.583) (-1085.086) [-1083.578] (-1084.014) -- 0:00:34
451000 -- (-1088.034) (-1087.815) (-1083.890) [-1087.134] * (-1089.106) (-1084.408) (-1084.754) [-1084.718] -- 0:00:34
451500 -- (-1086.399) (-1087.058) [-1086.870] (-1084.514) * (-1088.493) (-1084.578) [-1084.868] (-1083.830) -- 0:00:34
452000 -- [-1084.219] (-1084.368) (-1084.541) (-1084.784) * (-1092.941) [-1083.484] (-1083.476) (-1084.351) -- 0:00:33
452500 -- (-1086.579) (-1087.783) (-1086.348) [-1084.498] * (-1086.159) (-1083.538) (-1084.276) [-1085.803] -- 0:00:33
453000 -- (-1086.380) [-1086.638] (-1088.072) (-1083.663) * [-1084.837] (-1083.837) (-1086.408) (-1089.856) -- 0:00:33
453500 -- (-1086.019) [-1085.006] (-1083.762) (-1083.708) * [-1084.150] (-1086.462) (-1083.538) (-1086.546) -- 0:00:33
454000 -- (-1083.727) [-1084.835] (-1084.475) (-1086.726) * (-1084.143) (-1085.836) (-1085.746) [-1085.947] -- 0:00:33
454500 -- (-1083.956) (-1084.991) [-1084.025] (-1084.122) * (-1084.275) (-1085.319) [-1087.956] (-1090.532) -- 0:00:33
455000 -- (-1084.271) [-1086.389] (-1084.195) (-1086.676) * (-1083.552) (-1084.185) (-1087.743) [-1087.660] -- 0:00:33
Average standard deviation of split frequencies: 0.006892
455500 -- (-1083.727) [-1085.711] (-1085.077) (-1085.089) * (-1083.915) [-1084.858] (-1085.221) (-1086.839) -- 0:00:34
456000 -- (-1086.649) [-1084.323] (-1085.208) (-1085.950) * (-1085.546) [-1087.846] (-1085.824) (-1085.431) -- 0:00:34
456500 -- (-1087.371) [-1084.259] (-1084.253) (-1086.758) * [-1085.041] (-1087.989) (-1085.195) (-1084.766) -- 0:00:34
457000 -- (-1087.246) (-1085.741) (-1084.088) [-1085.880] * (-1085.164) (-1087.809) [-1084.483] (-1085.499) -- 0:00:34
457500 -- (-1089.949) (-1083.447) [-1084.609] (-1086.028) * (-1085.353) (-1090.411) [-1084.483] (-1089.560) -- 0:00:34
458000 -- (-1088.837) (-1083.302) [-1085.617] (-1088.296) * (-1086.278) [-1084.212] (-1084.257) (-1086.595) -- 0:00:34
458500 -- (-1088.025) (-1084.255) (-1084.909) [-1084.145] * (-1087.865) (-1084.263) [-1084.831] (-1086.098) -- 0:00:34
459000 -- (-1086.278) (-1084.255) [-1084.447] (-1083.501) * (-1084.493) [-1083.744] (-1084.049) (-1085.600) -- 0:00:34
459500 -- [-1083.587] (-1084.898) (-1086.562) (-1084.170) * [-1085.295] (-1084.190) (-1089.016) (-1087.064) -- 0:00:34
460000 -- [-1088.233] (-1085.389) (-1083.749) (-1086.874) * (-1084.768) [-1084.054] (-1083.903) (-1084.167) -- 0:00:34
Average standard deviation of split frequencies: 0.006822
460500 -- [-1084.196] (-1085.270) (-1085.957) (-1086.349) * (-1083.299) (-1085.849) [-1083.593] (-1084.101) -- 0:00:33
461000 -- [-1084.164] (-1083.782) (-1083.461) (-1087.522) * (-1083.738) [-1084.093] (-1084.513) (-1086.792) -- 0:00:33
461500 -- (-1084.577) (-1088.217) (-1083.299) [-1088.855] * (-1085.066) (-1086.084) [-1085.525] (-1087.820) -- 0:00:33
462000 -- (-1088.226) (-1091.077) [-1086.190] (-1086.021) * (-1086.085) [-1085.032] (-1087.258) (-1091.332) -- 0:00:33
462500 -- (-1085.718) (-1087.939) (-1093.567) [-1085.188] * (-1086.391) (-1087.113) [-1085.138] (-1085.120) -- 0:00:33
463000 -- (-1084.827) (-1087.767) (-1083.569) [-1084.491] * (-1087.698) (-1086.078) [-1085.442] (-1084.661) -- 0:00:33
463500 -- (-1083.829) (-1085.006) [-1088.575] (-1088.035) * [-1087.730] (-1086.327) (-1085.518) (-1085.218) -- 0:00:33
464000 -- [-1085.691] (-1086.519) (-1085.444) (-1090.078) * [-1087.122] (-1085.512) (-1083.548) (-1083.889) -- 0:00:33
464500 -- (-1083.722) (-1085.072) [-1085.412] (-1085.916) * [-1086.683] (-1083.649) (-1085.499) (-1084.887) -- 0:00:33
465000 -- (-1089.511) (-1088.531) [-1084.748] (-1083.483) * (-1088.198) (-1083.651) (-1090.904) [-1083.787] -- 0:00:33
Average standard deviation of split frequencies: 0.006512
465500 -- [-1085.259] (-1085.152) (-1085.356) (-1085.715) * [-1086.061] (-1084.187) (-1085.957) (-1085.258) -- 0:00:33
466000 -- [-1083.617] (-1086.997) (-1083.526) (-1086.103) * (-1086.351) [-1085.528] (-1087.089) (-1085.941) -- 0:00:33
466500 -- (-1085.294) (-1084.674) [-1084.218] (-1083.939) * (-1085.201) [-1085.911] (-1084.106) (-1084.383) -- 0:00:33
467000 -- [-1084.282] (-1085.914) (-1083.558) (-1083.549) * [-1083.571] (-1087.538) (-1083.549) (-1087.914) -- 0:00:33
467500 -- (-1088.643) [-1085.089] (-1085.084) (-1083.526) * (-1084.145) (-1091.679) [-1083.589] (-1086.942) -- 0:00:33
468000 -- [-1084.143] (-1087.026) (-1093.808) (-1085.478) * (-1084.425) (-1085.704) [-1089.556] (-1085.414) -- 0:00:32
468500 -- [-1083.753] (-1088.973) (-1091.827) (-1089.777) * (-1084.787) [-1085.971] (-1084.690) (-1085.528) -- 0:00:32
469000 -- [-1083.653] (-1087.634) (-1091.680) (-1087.436) * (-1084.449) [-1085.144] (-1085.469) (-1085.328) -- 0:00:32
469500 -- [-1084.573] (-1085.095) (-1088.244) (-1090.657) * [-1083.238] (-1084.016) (-1087.466) (-1084.174) -- 0:00:32
470000 -- (-1085.855) (-1084.287) [-1084.205] (-1084.754) * [-1085.244] (-1084.455) (-1088.258) (-1084.903) -- 0:00:32
Average standard deviation of split frequencies: 0.006410
470500 -- (-1086.379) [-1084.677] (-1087.002) (-1085.733) * [-1085.303] (-1090.785) (-1084.638) (-1085.512) -- 0:00:32
471000 -- (-1085.587) [-1084.849] (-1083.986) (-1083.337) * [-1083.919] (-1087.378) (-1085.513) (-1085.058) -- 0:00:32
471500 -- [-1084.779] (-1084.361) (-1085.694) (-1085.857) * (-1084.446) (-1088.082) (-1084.307) [-1085.685] -- 0:00:33
472000 -- (-1094.670) [-1083.871] (-1083.601) (-1085.162) * (-1085.230) [-1083.568] (-1083.299) (-1084.881) -- 0:00:33
472500 -- (-1083.688) (-1085.419) [-1085.593] (-1085.100) * (-1086.831) [-1087.026] (-1086.968) (-1083.665) -- 0:00:33
473000 -- (-1085.272) (-1085.144) (-1084.427) [-1085.414] * (-1086.840) (-1084.789) [-1086.817] (-1087.393) -- 0:00:33
473500 -- (-1085.372) [-1084.792] (-1083.460) (-1088.929) * (-1089.324) [-1086.342] (-1086.659) (-1086.951) -- 0:00:33
474000 -- (-1083.715) (-1086.745) [-1085.142] (-1087.039) * [-1085.789] (-1091.439) (-1083.486) (-1085.528) -- 0:00:33
474500 -- (-1088.443) (-1085.630) [-1086.662] (-1085.474) * (-1084.713) [-1084.419] (-1084.205) (-1085.322) -- 0:00:33
475000 -- (-1088.438) (-1085.394) (-1084.223) [-1089.545] * (-1085.540) [-1084.320] (-1083.356) (-1087.753) -- 0:00:33
Average standard deviation of split frequencies: 0.006470
475500 -- (-1087.718) (-1086.512) (-1084.904) [-1085.180] * (-1083.844) (-1084.233) (-1087.048) [-1086.213] -- 0:00:33
476000 -- [-1087.416] (-1084.991) (-1087.362) (-1084.089) * (-1083.666) (-1083.485) [-1084.891] (-1087.940) -- 0:00:33
476500 -- (-1084.043) [-1085.185] (-1084.477) (-1084.801) * (-1083.448) (-1083.485) [-1085.415] (-1088.543) -- 0:00:32
477000 -- (-1084.809) (-1085.043) (-1086.767) [-1086.734] * [-1083.942] (-1083.980) (-1086.276) (-1086.958) -- 0:00:32
477500 -- (-1085.636) (-1083.409) [-1084.439] (-1088.974) * (-1084.218) (-1086.216) [-1087.942] (-1087.075) -- 0:00:32
478000 -- [-1085.375] (-1083.403) (-1085.471) (-1088.075) * (-1085.129) (-1084.768) (-1085.795) [-1084.983] -- 0:00:32
478500 -- (-1086.001) [-1085.422] (-1088.379) (-1086.007) * (-1085.059) (-1084.869) [-1085.879] (-1083.470) -- 0:00:32
479000 -- (-1084.471) [-1085.814] (-1089.204) (-1090.260) * (-1085.819) [-1084.982] (-1087.789) (-1085.257) -- 0:00:32
479500 -- [-1083.863] (-1085.659) (-1087.470) (-1085.704) * (-1084.171) (-1085.444) (-1090.538) [-1087.093] -- 0:00:32
480000 -- [-1084.453] (-1084.170) (-1084.272) (-1087.618) * [-1084.460] (-1084.791) (-1085.497) (-1084.256) -- 0:00:32
Average standard deviation of split frequencies: 0.006800
480500 -- (-1086.659) [-1084.900] (-1085.932) (-1092.081) * (-1085.676) (-1084.364) [-1084.993] (-1084.983) -- 0:00:32
481000 -- [-1083.889] (-1086.002) (-1087.170) (-1085.000) * [-1085.018] (-1085.283) (-1085.059) (-1086.070) -- 0:00:32
481500 -- (-1084.918) (-1084.955) [-1085.982] (-1087.756) * (-1084.259) (-1087.118) (-1086.377) [-1087.728] -- 0:00:32
482000 -- [-1085.645] (-1090.106) (-1085.072) (-1087.831) * (-1087.395) (-1090.081) (-1086.734) [-1087.469] -- 0:00:32
482500 -- (-1085.333) (-1085.257) [-1088.463] (-1086.822) * (-1086.875) (-1084.295) (-1088.497) [-1086.619] -- 0:00:32
483000 -- (-1087.564) [-1085.246] (-1085.068) (-1086.163) * [-1086.834] (-1084.209) (-1085.116) (-1086.013) -- 0:00:32
483500 -- (-1083.875) (-1085.250) (-1084.538) [-1087.987] * (-1087.121) (-1084.220) (-1083.727) [-1084.171] -- 0:00:32
484000 -- (-1083.875) (-1087.913) [-1084.670] (-1086.065) * (-1085.026) [-1085.684] (-1085.923) (-1088.174) -- 0:00:31
484500 -- (-1087.068) (-1089.100) [-1085.262] (-1084.343) * (-1085.121) (-1085.822) [-1086.545] (-1083.799) -- 0:00:31
485000 -- (-1084.308) (-1083.571) (-1084.808) [-1084.388] * (-1085.096) [-1084.604] (-1083.473) (-1086.153) -- 0:00:31
Average standard deviation of split frequencies: 0.006972
485500 -- [-1084.259] (-1083.662) (-1087.976) (-1084.716) * (-1086.942) (-1083.303) (-1083.455) [-1084.391] -- 0:00:31
486000 -- (-1085.169) (-1085.844) [-1083.506] (-1095.892) * [-1086.205] (-1085.298) (-1083.378) (-1087.540) -- 0:00:31
486500 -- [-1084.466] (-1087.656) (-1084.484) (-1084.772) * (-1085.883) [-1084.701] (-1083.461) (-1087.501) -- 0:00:32
487000 -- (-1085.540) (-1085.983) (-1084.185) [-1084.145] * [-1084.238] (-1084.155) (-1083.836) (-1086.576) -- 0:00:32
487500 -- (-1088.263) (-1086.209) (-1088.770) [-1083.606] * (-1083.889) (-1083.688) (-1083.332) [-1085.260] -- 0:00:32
488000 -- (-1084.616) (-1084.276) [-1086.413] (-1087.006) * (-1084.617) [-1084.932] (-1083.464) (-1083.999) -- 0:00:32
488500 -- (-1085.117) (-1084.690) [-1085.374] (-1088.316) * [-1084.734] (-1086.073) (-1083.949) (-1084.047) -- 0:00:32
489000 -- (-1084.119) [-1084.351] (-1084.983) (-1089.195) * [-1086.579] (-1086.424) (-1085.036) (-1083.279) -- 0:00:32
489500 -- [-1084.844] (-1084.170) (-1088.322) (-1085.305) * (-1087.883) (-1086.857) [-1087.251] (-1085.711) -- 0:00:32
490000 -- (-1085.098) [-1085.074] (-1090.002) (-1084.689) * [-1085.136] (-1086.326) (-1085.380) (-1086.013) -- 0:00:32
Average standard deviation of split frequencies: 0.007326
490500 -- (-1089.625) [-1084.173] (-1083.561) (-1088.440) * (-1084.818) [-1085.884] (-1086.844) (-1086.278) -- 0:00:32
491000 -- (-1085.671) (-1084.128) (-1085.666) [-1083.674] * [-1086.696] (-1084.234) (-1085.361) (-1086.302) -- 0:00:32
491500 -- [-1090.609] (-1085.901) (-1090.211) (-1085.268) * (-1086.174) [-1087.307] (-1085.031) (-1084.837) -- 0:00:32
492000 -- (-1084.874) (-1084.850) (-1084.588) [-1083.499] * (-1085.662) (-1086.575) (-1085.786) [-1086.193] -- 0:00:32
492500 -- (-1085.857) [-1087.210] (-1087.194) (-1086.355) * (-1085.355) (-1084.660) [-1083.807] (-1084.996) -- 0:00:31
493000 -- (-1085.757) [-1086.021] (-1085.566) (-1085.727) * (-1087.083) (-1086.235) (-1088.335) [-1085.027] -- 0:00:31
493500 -- (-1084.615) (-1083.749) [-1083.632] (-1087.663) * (-1084.250) (-1087.212) [-1087.002] (-1086.629) -- 0:00:31
494000 -- (-1085.862) (-1086.244) [-1083.788] (-1083.378) * (-1087.700) [-1083.314] (-1086.641) (-1086.547) -- 0:00:31
494500 -- (-1085.136) [-1084.986] (-1084.789) (-1086.123) * (-1087.205) [-1084.671] (-1087.432) (-1087.061) -- 0:00:31
495000 -- (-1085.131) (-1087.168) (-1084.700) [-1083.877] * [-1084.121] (-1084.814) (-1090.016) (-1086.068) -- 0:00:31
Average standard deviation of split frequencies: 0.006772
495500 -- (-1084.778) [-1085.761] (-1087.669) (-1083.361) * [-1087.058] (-1083.740) (-1085.374) (-1083.965) -- 0:00:31
496000 -- (-1087.875) (-1088.435) [-1086.443] (-1083.205) * (-1087.438) (-1086.031) [-1086.236] (-1083.295) -- 0:00:31
496500 -- (-1088.592) (-1086.609) [-1083.035] (-1087.515) * (-1084.446) [-1087.433] (-1085.619) (-1085.278) -- 0:00:31
497000 -- (-1083.382) (-1090.164) [-1083.031] (-1083.918) * (-1084.469) [-1084.801] (-1088.447) (-1083.678) -- 0:00:31
497500 -- (-1088.322) (-1088.413) [-1083.563] (-1086.763) * [-1084.374] (-1086.676) (-1087.304) (-1083.703) -- 0:00:31
498000 -- (-1090.137) (-1084.510) (-1083.690) [-1088.820] * (-1086.906) [-1084.260] (-1084.569) (-1083.544) -- 0:00:31
498500 -- (-1088.959) (-1085.529) (-1083.687) [-1087.360] * (-1086.435) [-1088.249] (-1083.846) (-1083.544) -- 0:00:31
499000 -- (-1088.435) (-1086.340) (-1085.190) [-1085.278] * (-1085.886) [-1083.122] (-1083.604) (-1083.905) -- 0:00:31
499500 -- (-1085.368) (-1084.908) (-1091.437) [-1085.029] * [-1084.545] (-1083.301) (-1084.327) (-1086.848) -- 0:00:31
500000 -- (-1084.264) [-1084.255] (-1088.265) (-1086.789) * (-1083.298) [-1084.202] (-1086.416) (-1084.893) -- 0:00:31
Average standard deviation of split frequencies: 0.007650
500500 -- [-1085.845] (-1085.406) (-1084.958) (-1086.522) * [-1083.523] (-1084.840) (-1087.262) (-1084.626) -- 0:00:30
501000 -- [-1085.014] (-1085.213) (-1086.477) (-1087.276) * [-1085.313] (-1084.372) (-1086.441) (-1084.412) -- 0:00:30
501500 -- (-1085.024) (-1092.166) (-1089.388) [-1085.456] * (-1086.375) (-1085.457) (-1084.109) [-1085.448] -- 0:00:30
502000 -- (-1086.955) (-1084.152) (-1084.465) [-1083.353] * (-1085.980) [-1085.171] (-1088.632) (-1087.251) -- 0:00:30
502500 -- (-1084.778) [-1083.377] (-1084.722) (-1088.712) * (-1085.297) [-1083.599] (-1084.372) (-1083.865) -- 0:00:31
503000 -- (-1087.575) [-1084.106] (-1084.777) (-1083.800) * (-1084.756) [-1084.869] (-1086.682) (-1086.817) -- 0:00:31
503500 -- (-1085.566) (-1086.370) (-1085.299) [-1084.391] * (-1087.174) (-1086.451) [-1084.752] (-1086.515) -- 0:00:31
504000 -- (-1084.881) [-1084.121] (-1089.182) (-1086.553) * (-1088.286) (-1084.527) [-1083.821] (-1084.317) -- 0:00:31
504500 -- (-1085.284) (-1087.333) [-1084.723] (-1085.569) * (-1084.676) [-1085.660] (-1085.121) (-1085.326) -- 0:00:31
505000 -- [-1083.245] (-1087.660) (-1084.738) (-1089.657) * (-1084.707) (-1086.228) (-1084.810) [-1085.847] -- 0:00:31
Average standard deviation of split frequencies: 0.007453
505500 -- (-1083.895) [-1086.270] (-1086.252) (-1085.123) * (-1085.385) (-1088.983) [-1083.974] (-1086.389) -- 0:00:31
506000 -- [-1084.011] (-1086.809) (-1083.502) (-1085.544) * (-1086.016) (-1087.684) [-1085.990] (-1087.473) -- 0:00:31
506500 -- (-1085.223) [-1083.489] (-1083.738) (-1085.250) * (-1086.380) (-1085.309) [-1084.741] (-1091.854) -- 0:00:31
507000 -- (-1087.584) (-1086.021) (-1085.603) [-1084.990] * [-1084.323] (-1087.352) (-1085.963) (-1085.006) -- 0:00:31
507500 -- (-1086.989) (-1084.708) [-1083.432] (-1084.101) * (-1084.129) (-1086.596) [-1084.642] (-1086.297) -- 0:00:31
508000 -- (-1083.694) (-1086.138) [-1086.585] (-1087.355) * [-1086.308] (-1085.928) (-1084.712) (-1084.106) -- 0:00:30
508500 -- (-1084.451) (-1087.906) (-1086.132) [-1084.203] * [-1086.744] (-1086.816) (-1086.538) (-1083.258) -- 0:00:30
509000 -- [-1090.726] (-1085.600) (-1085.073) (-1084.058) * (-1087.029) (-1083.902) [-1086.404] (-1083.247) -- 0:00:30
509500 -- (-1086.172) (-1084.828) [-1083.875] (-1089.038) * (-1086.474) (-1086.576) (-1085.419) [-1086.377] -- 0:00:30
510000 -- (-1084.442) (-1093.871) [-1084.628] (-1089.087) * (-1085.706) (-1085.614) (-1084.208) [-1085.773] -- 0:00:30
Average standard deviation of split frequencies: 0.007154
510500 -- [-1086.907] (-1092.055) (-1083.631) (-1084.542) * [-1089.698] (-1085.540) (-1083.995) (-1088.140) -- 0:00:30
511000 -- (-1086.438) [-1092.568] (-1085.026) (-1088.227) * (-1088.907) (-1089.387) (-1086.929) [-1086.653] -- 0:00:30
511500 -- (-1086.744) (-1085.381) [-1084.357] (-1084.296) * (-1085.490) (-1084.612) [-1085.097] (-1085.928) -- 0:00:30
512000 -- (-1087.647) (-1084.838) (-1084.747) [-1084.833] * (-1085.721) (-1083.983) [-1087.472] (-1084.014) -- 0:00:30
512500 -- (-1087.168) (-1088.322) (-1086.571) [-1085.571] * (-1084.075) [-1086.323] (-1087.763) (-1088.988) -- 0:00:30
513000 -- [-1084.225] (-1088.992) (-1086.568) (-1085.285) * (-1085.963) (-1083.887) [-1083.209] (-1085.726) -- 0:00:30
513500 -- (-1083.890) [-1083.223] (-1084.162) (-1084.737) * (-1085.287) (-1083.789) [-1083.908] (-1089.684) -- 0:00:30
514000 -- (-1089.263) [-1083.010] (-1083.716) (-1085.393) * [-1086.734] (-1087.720) (-1085.322) (-1086.464) -- 0:00:30
514500 -- (-1088.733) (-1084.714) (-1085.360) [-1086.716] * (-1089.450) (-1084.234) [-1083.427] (-1087.018) -- 0:00:30
515000 -- (-1090.046) (-1084.147) (-1084.702) [-1084.034] * [-1086.775] (-1085.269) (-1084.488) (-1083.845) -- 0:00:30
Average standard deviation of split frequencies: 0.007537
515500 -- (-1085.286) [-1085.550] (-1085.927) (-1085.763) * (-1084.689) (-1086.763) [-1084.620] (-1083.890) -- 0:00:30
516000 -- (-1085.331) (-1083.922) (-1084.921) [-1088.495] * (-1083.103) (-1083.076) (-1084.137) [-1086.551] -- 0:00:30
516500 -- (-1086.649) [-1085.319] (-1083.381) (-1083.264) * (-1088.128) (-1083.038) (-1084.142) [-1083.389] -- 0:00:29
517000 -- (-1083.787) [-1086.892] (-1087.293) (-1084.769) * (-1086.848) (-1084.426) [-1083.432] (-1086.601) -- 0:00:29
517500 -- [-1085.343] (-1084.210) (-1086.103) (-1085.329) * (-1084.738) [-1084.714] (-1087.930) (-1085.680) -- 0:00:29
518000 -- (-1085.368) [-1088.578] (-1085.094) (-1084.149) * (-1083.983) [-1084.192] (-1088.705) (-1087.203) -- 0:00:29
518500 -- (-1087.268) (-1084.254) (-1086.885) [-1083.409] * [-1083.774] (-1085.684) (-1086.265) (-1084.926) -- 0:00:29
519000 -- (-1084.484) [-1086.282] (-1088.836) (-1084.992) * (-1085.964) [-1084.643] (-1085.091) (-1084.459) -- 0:00:30
519500 -- [-1083.912] (-1090.679) (-1090.912) (-1086.638) * (-1086.660) (-1087.781) [-1085.517] (-1084.285) -- 0:00:30
520000 -- (-1084.891) (-1087.008) (-1086.168) [-1085.247] * (-1089.082) (-1085.201) (-1085.542) [-1086.253] -- 0:00:30
Average standard deviation of split frequencies: 0.007130
520500 -- (-1086.298) [-1083.195] (-1088.187) (-1087.932) * (-1084.810) (-1086.805) (-1084.441) [-1085.150] -- 0:00:30
521000 -- (-1085.472) (-1087.415) [-1088.213] (-1085.621) * (-1090.662) (-1084.897) (-1085.263) [-1087.283] -- 0:00:30
521500 -- (-1084.290) (-1085.022) (-1087.521) [-1086.032] * (-1083.395) (-1087.355) (-1084.018) [-1084.916] -- 0:00:30
522000 -- (-1085.090) [-1084.139] (-1086.710) (-1083.575) * (-1090.487) (-1087.078) [-1084.664] (-1085.946) -- 0:00:30
522500 -- (-1087.540) (-1084.445) [-1084.704] (-1083.478) * (-1084.629) [-1087.889] (-1083.812) (-1088.187) -- 0:00:30
523000 -- (-1084.904) [-1085.917] (-1086.761) (-1084.514) * (-1086.603) [-1083.761] (-1084.339) (-1088.944) -- 0:00:30
523500 -- [-1083.174] (-1085.377) (-1087.223) (-1084.838) * (-1086.348) (-1083.276) [-1084.204] (-1087.344) -- 0:00:30
524000 -- (-1087.037) (-1084.501) [-1086.684] (-1083.630) * (-1084.453) (-1083.322) (-1086.066) [-1085.658] -- 0:00:29
524500 -- (-1085.042) [-1085.014] (-1088.745) (-1083.871) * (-1083.619) [-1085.915] (-1085.238) (-1083.913) -- 0:00:29
525000 -- [-1084.613] (-1085.273) (-1090.436) (-1085.522) * (-1088.022) [-1087.392] (-1085.222) (-1084.296) -- 0:00:29
Average standard deviation of split frequencies: 0.007338
525500 -- [-1089.410] (-1083.444) (-1085.609) (-1086.550) * (-1086.716) [-1085.953] (-1085.163) (-1086.235) -- 0:00:29
526000 -- (-1088.801) (-1087.493) (-1089.457) [-1084.284] * (-1086.137) [-1087.352] (-1083.195) (-1084.586) -- 0:00:29
526500 -- (-1088.557) (-1085.256) (-1083.659) [-1086.487] * (-1084.013) (-1085.483) [-1085.172] (-1085.745) -- 0:00:29
527000 -- (-1085.338) (-1084.711) (-1083.621) [-1085.116] * (-1087.616) (-1086.495) [-1084.958] (-1083.414) -- 0:00:29
527500 -- (-1085.371) [-1085.258] (-1084.350) (-1083.533) * (-1085.848) [-1086.570] (-1085.040) (-1087.552) -- 0:00:29
528000 -- (-1087.216) (-1084.213) [-1083.532] (-1088.776) * (-1084.540) [-1085.028] (-1087.900) (-1084.575) -- 0:00:29
528500 -- (-1084.799) [-1083.690] (-1083.733) (-1088.094) * (-1084.823) (-1085.041) [-1086.034] (-1084.235) -- 0:00:29
529000 -- [-1086.812] (-1085.295) (-1084.650) (-1090.412) * (-1086.667) [-1083.742] (-1084.642) (-1085.604) -- 0:00:29
529500 -- [-1084.699] (-1085.434) (-1084.208) (-1088.990) * [-1085.001] (-1083.099) (-1089.604) (-1087.636) -- 0:00:29
530000 -- (-1084.399) (-1084.997) (-1084.971) [-1083.456] * (-1086.563) [-1084.755] (-1083.896) (-1085.282) -- 0:00:29
Average standard deviation of split frequencies: 0.007384
530500 -- (-1088.866) [-1084.568] (-1085.259) (-1084.443) * [-1083.218] (-1085.701) (-1084.267) (-1086.479) -- 0:00:29
531000 -- (-1087.465) (-1083.422) (-1086.506) [-1083.585] * (-1083.680) [-1086.172] (-1087.151) (-1084.400) -- 0:00:29
531500 -- (-1087.222) (-1086.707) (-1087.658) [-1085.602] * (-1083.969) (-1085.360) [-1087.143] (-1083.244) -- 0:00:29
532000 -- (-1086.039) [-1083.321] (-1088.081) (-1086.561) * (-1084.636) (-1084.469) [-1084.738] (-1084.550) -- 0:00:29
532500 -- (-1085.140) [-1083.572] (-1084.210) (-1087.147) * (-1083.930) (-1087.429) (-1087.476) [-1088.564] -- 0:00:28
533000 -- (-1086.415) (-1084.406) [-1083.569] (-1083.914) * (-1084.094) [-1086.069] (-1085.924) (-1088.764) -- 0:00:28
533500 -- (-1087.585) (-1083.636) [-1084.060] (-1083.949) * (-1088.807) (-1091.060) (-1089.876) [-1084.998] -- 0:00:28
534000 -- (-1087.809) (-1086.232) (-1084.059) [-1084.312] * (-1085.466) [-1085.133] (-1090.931) (-1086.984) -- 0:00:28
534500 -- [-1084.176] (-1084.099) (-1084.429) (-1084.890) * (-1086.246) (-1086.434) [-1087.718] (-1086.035) -- 0:00:28
535000 -- [-1084.938] (-1084.022) (-1085.982) (-1085.954) * [-1084.329] (-1086.856) (-1087.046) (-1085.425) -- 0:00:28
Average standard deviation of split frequencies: 0.007146
535500 -- [-1084.897] (-1084.901) (-1091.008) (-1085.453) * (-1084.950) [-1083.459] (-1083.987) (-1086.662) -- 0:00:29
536000 -- (-1083.924) (-1085.802) [-1085.041] (-1085.591) * (-1084.096) (-1085.365) (-1084.444) [-1085.129] -- 0:00:29
536500 -- [-1083.682] (-1084.266) (-1083.988) (-1083.487) * [-1083.561] (-1087.572) (-1084.292) (-1083.491) -- 0:00:29
537000 -- (-1085.468) (-1085.002) [-1089.309] (-1085.333) * (-1086.003) (-1086.315) [-1083.943] (-1086.057) -- 0:00:29
537500 -- (-1085.234) (-1083.269) (-1087.221) [-1084.801] * (-1087.496) (-1086.175) [-1083.526] (-1087.883) -- 0:00:29
538000 -- (-1087.430) (-1084.926) (-1084.204) [-1085.620] * [-1086.833] (-1084.779) (-1084.263) (-1089.621) -- 0:00:29
538500 -- (-1085.099) (-1084.154) (-1089.787) [-1085.143] * (-1087.034) (-1084.108) (-1087.410) [-1086.971] -- 0:00:29
539000 -- (-1087.396) (-1084.756) (-1087.586) [-1084.065] * [-1087.161] (-1084.321) (-1084.349) (-1087.915) -- 0:00:29
539500 -- (-1086.905) [-1083.826] (-1086.475) (-1083.995) * (-1087.933) [-1086.860] (-1086.563) (-1086.116) -- 0:00:29
540000 -- [-1087.183] (-1083.692) (-1084.644) (-1084.125) * (-1085.975) [-1086.244] (-1084.255) (-1083.994) -- 0:00:28
Average standard deviation of split frequencies: 0.007193
540500 -- [-1086.432] (-1084.866) (-1083.610) (-1084.841) * (-1083.963) [-1083.312] (-1089.617) (-1083.506) -- 0:00:28
541000 -- (-1086.121) (-1084.589) [-1085.284] (-1085.138) * (-1089.811) (-1083.259) [-1091.588] (-1083.371) -- 0:00:28
541500 -- [-1086.984] (-1087.425) (-1086.442) (-1086.992) * (-1084.660) [-1084.724] (-1087.602) (-1086.139) -- 0:00:28
542000 -- [-1083.984] (-1085.668) (-1085.192) (-1084.216) * (-1083.937) (-1085.169) [-1087.126] (-1083.484) -- 0:00:28
542500 -- (-1088.140) (-1086.268) (-1084.487) [-1084.048] * (-1085.299) (-1086.870) (-1085.958) [-1087.000] -- 0:00:28
543000 -- (-1086.196) (-1088.036) (-1088.492) [-1084.978] * (-1083.224) (-1086.171) [-1086.118] (-1086.140) -- 0:00:28
543500 -- (-1085.563) (-1086.522) (-1086.379) [-1086.830] * (-1085.281) (-1085.366) [-1083.924] (-1089.676) -- 0:00:28
544000 -- [-1086.065] (-1083.432) (-1086.210) (-1084.373) * (-1086.360) [-1084.828] (-1084.265) (-1085.089) -- 0:00:28
544500 -- (-1084.395) [-1084.310] (-1088.324) (-1087.342) * (-1084.861) [-1084.832] (-1087.673) (-1084.646) -- 0:00:28
545000 -- (-1085.194) [-1083.424] (-1086.076) (-1086.822) * [-1083.411] (-1086.896) (-1086.540) (-1083.299) -- 0:00:28
Average standard deviation of split frequencies: 0.006853
545500 -- (-1084.210) (-1084.623) [-1084.197] (-1087.860) * (-1085.009) (-1084.712) [-1086.873] (-1083.760) -- 0:00:28
546000 -- (-1086.898) (-1088.033) [-1086.196] (-1084.876) * (-1083.095) (-1086.822) (-1084.760) [-1085.021] -- 0:00:28
546500 -- [-1087.020] (-1085.985) (-1083.758) (-1084.804) * (-1083.115) (-1084.201) (-1088.158) [-1085.693] -- 0:00:28
547000 -- [-1088.381] (-1086.408) (-1084.286) (-1084.435) * (-1083.338) (-1083.821) [-1083.577] (-1084.638) -- 0:00:28
547500 -- (-1087.130) [-1086.125] (-1084.268) (-1085.237) * [-1083.483] (-1085.138) (-1084.163) (-1085.762) -- 0:00:28
548000 -- (-1090.048) [-1085.887] (-1084.276) (-1083.793) * (-1086.937) (-1083.182) [-1084.217] (-1084.186) -- 0:00:28
548500 -- (-1085.334) [-1086.140] (-1085.245) (-1083.727) * (-1083.707) (-1087.550) [-1086.943] (-1085.086) -- 0:00:27
549000 -- (-1087.986) (-1086.092) [-1083.160] (-1088.209) * (-1087.188) (-1085.823) [-1083.770] (-1085.714) -- 0:00:27
549500 -- [-1085.173] (-1087.700) (-1086.904) (-1083.554) * [-1085.309] (-1088.336) (-1083.724) (-1089.476) -- 0:00:27
550000 -- (-1088.219) (-1087.265) [-1085.912] (-1084.765) * (-1084.572) (-1085.370) [-1084.049] (-1086.908) -- 0:00:27
Average standard deviation of split frequencies: 0.006634
550500 -- (-1089.190) (-1088.149) [-1086.123] (-1087.328) * (-1084.209) [-1085.695] (-1085.936) (-1086.472) -- 0:00:27
551000 -- (-1088.034) (-1087.781) [-1085.295] (-1083.756) * [-1083.809] (-1087.618) (-1089.151) (-1083.859) -- 0:00:27
551500 -- (-1084.182) (-1084.863) [-1083.163] (-1085.552) * (-1085.265) [-1086.809] (-1084.067) (-1085.965) -- 0:00:27
552000 -- (-1087.583) [-1087.301] (-1084.432) (-1085.515) * [-1083.551] (-1084.457) (-1085.042) (-1087.593) -- 0:00:28
552500 -- (-1084.668) [-1084.566] (-1085.795) (-1085.214) * (-1083.939) [-1088.118] (-1085.368) (-1086.322) -- 0:00:28
553000 -- (-1084.590) (-1083.536) [-1083.018] (-1086.515) * (-1083.950) (-1092.753) [-1084.288] (-1086.444) -- 0:00:28
553500 -- (-1084.401) [-1084.767] (-1083.438) (-1086.119) * [-1086.425] (-1086.650) (-1085.082) (-1087.291) -- 0:00:28
554000 -- (-1084.680) (-1086.555) [-1084.770] (-1084.162) * (-1083.462) (-1086.210) [-1085.594] (-1086.230) -- 0:00:28
554500 -- (-1085.164) (-1084.595) [-1085.619] (-1090.881) * (-1085.046) (-1085.538) (-1086.904) [-1085.170] -- 0:00:28
555000 -- (-1086.853) [-1083.634] (-1085.145) (-1086.357) * (-1090.865) (-1085.192) (-1088.743) [-1084.192] -- 0:00:28
Average standard deviation of split frequencies: 0.006624
555500 -- (-1087.779) (-1085.131) [-1087.245] (-1089.391) * [-1085.215] (-1083.061) (-1089.570) (-1083.606) -- 0:00:28
556000 -- [-1086.263] (-1084.396) (-1086.094) (-1085.874) * [-1084.864] (-1085.460) (-1089.499) (-1085.403) -- 0:00:27
556500 -- (-1085.269) [-1084.877] (-1085.564) (-1085.350) * (-1084.406) [-1087.147] (-1086.085) (-1084.664) -- 0:00:27
557000 -- (-1083.735) (-1085.234) [-1083.400] (-1085.595) * (-1085.215) [-1088.109] (-1085.238) (-1083.023) -- 0:00:27
557500 -- (-1085.357) [-1083.645] (-1085.016) (-1087.251) * (-1084.919) [-1085.579] (-1086.581) (-1087.436) -- 0:00:27
558000 -- (-1086.418) [-1083.617] (-1086.804) (-1087.354) * [-1085.009] (-1084.877) (-1086.806) (-1086.367) -- 0:00:27
558500 -- (-1085.376) (-1085.170) (-1084.830) [-1083.576] * (-1084.641) [-1085.057] (-1083.729) (-1084.259) -- 0:00:27
559000 -- (-1085.286) (-1085.166) [-1085.061] (-1083.188) * (-1085.182) (-1086.041) (-1084.967) [-1083.272] -- 0:00:27
559500 -- (-1084.762) [-1086.952] (-1084.373) (-1090.553) * (-1088.043) (-1085.921) [-1084.446] (-1086.587) -- 0:00:27
560000 -- (-1088.101) (-1083.792) [-1083.883] (-1083.748) * (-1088.352) (-1086.222) [-1085.892] (-1084.685) -- 0:00:27
Average standard deviation of split frequencies: 0.006779
560500 -- (-1089.396) [-1084.453] (-1084.478) (-1086.366) * [-1085.618] (-1087.432) (-1088.633) (-1084.863) -- 0:00:27
561000 -- (-1084.028) (-1085.602) [-1086.596] (-1085.084) * [-1084.470] (-1090.488) (-1091.572) (-1085.308) -- 0:00:27
561500 -- (-1084.531) (-1090.026) (-1084.919) [-1086.428] * (-1084.947) (-1084.991) [-1084.486] (-1085.747) -- 0:00:27
562000 -- (-1084.385) (-1085.170) [-1086.750] (-1088.830) * (-1086.152) (-1085.861) [-1086.617] (-1088.692) -- 0:00:27
562500 -- (-1086.228) (-1084.097) (-1090.211) [-1084.306] * [-1084.239] (-1083.082) (-1084.399) (-1085.228) -- 0:00:27
563000 -- (-1085.609) (-1084.788) (-1084.670) [-1083.796] * (-1087.126) [-1083.436] (-1086.472) (-1086.452) -- 0:00:27
563500 -- (-1088.618) (-1086.212) (-1087.873) [-1084.940] * (-1086.353) (-1084.932) [-1083.900] (-1083.710) -- 0:00:27
564000 -- (-1086.112) (-1086.587) [-1083.445] (-1084.864) * (-1084.777) (-1084.742) [-1083.449] (-1083.916) -- 0:00:27
564500 -- [-1083.741] (-1087.226) (-1083.848) (-1085.198) * (-1085.120) (-1085.698) [-1086.028] (-1085.424) -- 0:00:27
565000 -- (-1086.896) [-1085.926] (-1085.068) (-1086.596) * (-1084.463) (-1086.009) (-1084.495) [-1085.991] -- 0:00:26
Average standard deviation of split frequencies: 0.006351
565500 -- (-1083.231) (-1086.391) [-1083.801] (-1090.172) * (-1088.333) (-1085.633) (-1088.021) [-1086.408] -- 0:00:26
566000 -- (-1085.433) (-1087.858) [-1087.033] (-1086.261) * [-1083.626] (-1084.804) (-1088.430) (-1086.003) -- 0:00:26
566500 -- (-1084.637) [-1085.844] (-1084.674) (-1085.319) * (-1083.813) [-1083.187] (-1088.062) (-1088.805) -- 0:00:26
567000 -- (-1085.882) (-1086.039) [-1085.895] (-1086.919) * (-1083.817) (-1086.928) [-1087.764] (-1090.992) -- 0:00:26
567500 -- (-1084.660) (-1084.361) [-1087.821] (-1086.564) * [-1083.199] (-1087.272) (-1083.996) (-1084.273) -- 0:00:26
568000 -- (-1086.473) (-1084.375) (-1084.466) [-1083.862] * (-1086.566) (-1086.196) [-1086.572] (-1084.479) -- 0:00:27
568500 -- (-1085.557) (-1088.361) [-1084.307] (-1085.643) * (-1086.161) (-1084.619) [-1085.011] (-1084.279) -- 0:00:27
569000 -- (-1084.525) (-1084.303) [-1083.190] (-1088.596) * (-1084.904) (-1084.295) [-1087.854] (-1088.036) -- 0:00:27
569500 -- (-1086.515) (-1088.932) (-1084.832) [-1084.812] * (-1085.319) (-1084.715) (-1085.805) [-1085.017] -- 0:00:27
570000 -- (-1084.394) (-1087.856) (-1083.605) [-1085.435] * (-1086.141) (-1086.814) (-1084.282) [-1084.605] -- 0:00:27
Average standard deviation of split frequencies: 0.006719
570500 -- [-1085.716] (-1085.833) (-1088.411) (-1083.639) * (-1087.449) (-1086.799) (-1084.813) [-1084.802] -- 0:00:27
571000 -- (-1084.265) (-1089.949) [-1084.640] (-1085.013) * (-1091.924) (-1086.996) [-1083.425] (-1087.977) -- 0:00:27
571500 -- (-1084.632) (-1083.532) [-1085.487] (-1086.130) * (-1086.002) (-1086.803) (-1086.311) [-1086.961] -- 0:00:26
572000 -- (-1086.611) (-1084.958) (-1087.681) [-1085.938] * (-1084.356) (-1086.015) (-1088.110) [-1086.177] -- 0:00:26
572500 -- (-1085.047) (-1085.341) (-1085.863) [-1085.382] * (-1085.111) [-1086.904] (-1085.801) (-1087.755) -- 0:00:26
573000 -- [-1084.146] (-1084.416) (-1085.295) (-1085.365) * [-1084.422] (-1085.160) (-1085.520) (-1085.308) -- 0:00:26
573500 -- [-1083.225] (-1084.359) (-1083.870) (-1085.739) * (-1085.897) [-1083.897] (-1091.811) (-1083.319) -- 0:00:26
574000 -- (-1083.779) [-1087.277] (-1083.716) (-1084.290) * (-1088.330) (-1084.512) (-1083.756) [-1083.289] -- 0:00:26
574500 -- [-1084.917] (-1087.296) (-1086.548) (-1085.822) * (-1093.742) (-1084.205) [-1086.774] (-1085.135) -- 0:00:26
575000 -- (-1087.364) (-1088.741) [-1083.790] (-1089.454) * (-1087.145) (-1086.482) (-1085.219) [-1086.901] -- 0:00:26
Average standard deviation of split frequencies: 0.006711
575500 -- (-1092.582) [-1086.323] (-1084.223) (-1085.039) * [-1085.429] (-1086.660) (-1084.123) (-1085.199) -- 0:00:26
576000 -- (-1084.868) (-1083.640) [-1083.769] (-1083.561) * [-1085.084] (-1084.793) (-1084.330) (-1087.564) -- 0:00:26
576500 -- (-1083.672) (-1083.646) (-1087.444) [-1086.284] * (-1089.816) [-1085.355] (-1083.170) (-1085.632) -- 0:00:26
577000 -- (-1086.314) [-1084.943] (-1085.385) (-1086.317) * (-1084.425) (-1086.523) [-1083.714] (-1084.279) -- 0:00:26
577500 -- (-1085.146) [-1085.451] (-1084.566) (-1085.701) * (-1086.846) (-1085.009) [-1086.405] (-1086.591) -- 0:00:26
578000 -- (-1084.803) (-1085.642) [-1083.467] (-1086.223) * (-1090.735) (-1085.880) [-1083.919] (-1085.277) -- 0:00:26
578500 -- (-1085.520) (-1084.286) [-1084.827] (-1090.164) * (-1086.115) (-1083.722) [-1085.487] (-1083.315) -- 0:00:26
579000 -- (-1086.114) (-1087.850) (-1084.024) [-1086.573] * (-1085.094) (-1086.752) [-1089.051] (-1083.315) -- 0:00:26
579500 -- (-1083.646) (-1083.805) (-1084.160) [-1085.660] * (-1085.547) (-1084.509) [-1083.674] (-1085.503) -- 0:00:26
580000 -- [-1083.746] (-1085.250) (-1084.934) (-1085.228) * (-1085.409) (-1083.366) [-1085.900] (-1085.476) -- 0:00:26
Average standard deviation of split frequencies: 0.006765
580500 -- (-1084.125) (-1084.815) [-1084.088] (-1084.302) * [-1086.165] (-1086.719) (-1083.992) (-1085.021) -- 0:00:26
581000 -- [-1085.309] (-1087.664) (-1084.086) (-1085.121) * [-1083.507] (-1087.122) (-1086.090) (-1086.272) -- 0:00:25
581500 -- [-1085.593] (-1091.241) (-1083.770) (-1084.040) * (-1083.794) (-1085.039) (-1088.610) [-1086.081] -- 0:00:25
582000 -- (-1088.546) [-1084.563] (-1084.673) (-1083.443) * [-1082.969] (-1084.024) (-1084.939) (-1086.759) -- 0:00:25
582500 -- (-1088.064) (-1090.093) (-1083.994) [-1083.445] * (-1084.995) [-1085.892] (-1086.781) (-1085.643) -- 0:00:25
583000 -- (-1085.425) [-1084.456] (-1086.324) (-1084.005) * [-1083.658] (-1084.347) (-1090.868) (-1086.132) -- 0:00:25
583500 -- (-1086.321) (-1083.990) (-1085.023) [-1083.026] * [-1084.545] (-1083.684) (-1089.310) (-1083.753) -- 0:00:25
584000 -- (-1086.225) [-1083.854] (-1083.625) (-1085.312) * (-1086.643) (-1083.816) [-1083.820] (-1083.709) -- 0:00:25
584500 -- (-1085.597) [-1087.238] (-1085.874) (-1085.362) * (-1085.533) [-1084.848] (-1083.528) (-1084.256) -- 0:00:26
585000 -- [-1084.578] (-1085.811) (-1085.373) (-1084.874) * (-1085.469) [-1088.960] (-1084.025) (-1083.612) -- 0:00:26
Average standard deviation of split frequencies: 0.006436
585500 -- [-1084.155] (-1084.525) (-1084.250) (-1084.951) * (-1089.235) [-1083.795] (-1084.635) (-1083.868) -- 0:00:26
586000 -- (-1084.936) (-1085.366) (-1085.296) [-1083.270] * (-1089.042) (-1085.100) (-1084.227) [-1086.079] -- 0:00:26
586500 -- (-1084.434) (-1085.637) (-1085.503) [-1083.922] * (-1088.780) [-1088.266] (-1085.069) (-1085.512) -- 0:00:26
587000 -- (-1083.528) (-1086.343) (-1085.963) [-1084.499] * (-1085.526) (-1086.630) [-1085.882] (-1087.815) -- 0:00:26
587500 -- [-1086.249] (-1083.257) (-1084.990) (-1084.014) * (-1084.621) (-1083.403) (-1088.481) [-1084.735] -- 0:00:25
588000 -- (-1086.823) [-1083.628] (-1086.482) (-1086.301) * (-1084.857) [-1083.541] (-1087.380) (-1084.363) -- 0:00:25
588500 -- [-1085.832] (-1087.859) (-1084.455) (-1086.607) * (-1087.099) (-1087.810) [-1085.607] (-1086.280) -- 0:00:25
589000 -- (-1084.170) (-1085.378) (-1084.979) [-1083.824] * (-1089.230) (-1090.044) (-1087.323) [-1086.244] -- 0:00:25
589500 -- [-1085.614] (-1083.301) (-1083.949) (-1084.542) * (-1085.355) (-1085.421) (-1085.229) [-1084.058] -- 0:00:25
590000 -- (-1086.260) (-1084.916) (-1086.184) [-1085.250] * (-1085.047) (-1084.492) [-1085.678] (-1084.522) -- 0:00:25
Average standard deviation of split frequencies: 0.006278
590500 -- [-1085.830] (-1084.813) (-1086.006) (-1084.069) * (-1083.718) (-1083.835) [-1087.014] (-1084.599) -- 0:00:25
591000 -- (-1083.957) [-1083.609] (-1086.928) (-1084.876) * [-1083.702] (-1085.639) (-1086.431) (-1090.025) -- 0:00:25
591500 -- (-1084.846) [-1087.110] (-1084.501) (-1083.940) * (-1085.133) (-1084.979) [-1084.672] (-1083.631) -- 0:00:25
592000 -- (-1087.856) [-1083.478] (-1084.966) (-1086.806) * [-1084.152] (-1084.099) (-1084.260) (-1088.733) -- 0:00:25
592500 -- (-1083.796) (-1084.084) (-1088.152) [-1083.957] * (-1087.837) (-1085.453) [-1083.676] (-1084.110) -- 0:00:25
593000 -- (-1083.781) [-1083.792] (-1088.493) (-1083.842) * (-1085.261) (-1088.813) [-1086.559] (-1083.640) -- 0:00:25
593500 -- (-1083.455) (-1085.112) [-1084.779] (-1084.778) * (-1084.700) [-1087.210] (-1089.983) (-1085.126) -- 0:00:25
594000 -- (-1085.372) [-1084.612] (-1088.739) (-1086.242) * (-1083.429) [-1083.536] (-1083.834) (-1085.846) -- 0:00:25
594500 -- (-1086.401) [-1083.992] (-1086.212) (-1089.664) * (-1083.707) (-1083.360) [-1084.425] (-1083.020) -- 0:00:25
595000 -- [-1084.960] (-1084.596) (-1086.706) (-1086.246) * (-1084.108) (-1084.740) (-1084.520) [-1086.361] -- 0:00:25
Average standard deviation of split frequencies: 0.006222
595500 -- [-1085.605] (-1085.618) (-1088.828) (-1085.364) * (-1085.675) (-1090.699) (-1084.401) [-1085.917] -- 0:00:25
596000 -- [-1086.227] (-1091.631) (-1086.695) (-1083.501) * (-1088.871) (-1089.109) (-1084.573) [-1083.536] -- 0:00:25
596500 -- (-1087.038) [-1088.003] (-1086.570) (-1088.646) * (-1086.044) [-1085.581] (-1084.491) (-1084.758) -- 0:00:25
597000 -- (-1085.847) [-1083.038] (-1085.498) (-1083.899) * (-1085.347) [-1086.087] (-1089.346) (-1085.538) -- 0:00:24
597500 -- [-1086.364] (-1085.714) (-1087.007) (-1085.979) * (-1084.285) [-1083.598] (-1091.835) (-1087.216) -- 0:00:24
598000 -- (-1086.479) (-1087.706) (-1085.269) [-1085.060] * (-1085.327) (-1083.246) [-1087.956] (-1084.492) -- 0:00:24
598500 -- (-1084.877) (-1086.660) [-1083.843] (-1084.657) * (-1087.179) (-1085.424) (-1087.726) [-1086.306] -- 0:00:24
599000 -- [-1084.403] (-1086.281) (-1084.376) (-1087.363) * [-1085.113] (-1084.461) (-1086.183) (-1083.663) -- 0:00:24
599500 -- [-1084.914] (-1086.559) (-1086.240) (-1089.537) * (-1087.577) [-1083.673] (-1086.183) (-1084.721) -- 0:00:24
600000 -- (-1087.578) (-1085.841) [-1083.826] (-1086.901) * (-1086.351) (-1084.731) [-1087.343] (-1085.439) -- 0:00:24
Average standard deviation of split frequencies: 0.006278
600500 -- (-1087.795) [-1085.319] (-1085.189) (-1088.435) * (-1087.528) [-1086.201] (-1093.253) (-1085.520) -- 0:00:25
601000 -- (-1084.041) (-1088.592) [-1084.586] (-1086.318) * (-1088.789) (-1085.884) [-1090.716] (-1086.425) -- 0:00:25
601500 -- (-1084.884) (-1087.373) [-1090.094] (-1083.402) * [-1086.503] (-1086.368) (-1089.246) (-1083.801) -- 0:00:25
602000 -- [-1084.952] (-1083.864) (-1084.610) (-1083.502) * (-1085.383) (-1084.006) (-1086.144) [-1086.716] -- 0:00:25
602500 -- [-1085.271] (-1086.342) (-1087.922) (-1084.874) * (-1085.676) (-1087.087) (-1085.163) [-1086.053] -- 0:00:25
603000 -- (-1085.286) (-1087.699) (-1083.502) [-1083.326] * [-1083.532] (-1086.997) (-1084.997) (-1084.431) -- 0:00:25
603500 -- (-1084.282) (-1088.057) [-1086.215] (-1083.062) * (-1086.669) [-1083.618] (-1087.719) (-1085.799) -- 0:00:24
604000 -- (-1086.462) (-1087.443) (-1084.941) [-1085.778] * (-1082.959) [-1084.181] (-1092.264) (-1084.429) -- 0:00:24
604500 -- (-1086.343) [-1087.746] (-1089.707) (-1087.160) * (-1085.894) (-1086.691) (-1086.235) [-1083.736] -- 0:00:24
605000 -- (-1089.450) (-1084.541) (-1084.064) [-1085.655] * (-1088.429) (-1085.774) (-1088.381) [-1084.073] -- 0:00:24
Average standard deviation of split frequencies: 0.006690
605500 -- (-1087.285) (-1085.940) (-1083.164) [-1087.090] * [-1088.690] (-1084.046) (-1086.261) (-1083.907) -- 0:00:24
606000 -- (-1086.155) (-1083.952) (-1086.516) [-1084.217] * (-1084.586) [-1083.884] (-1085.394) (-1084.762) -- 0:00:24
606500 -- [-1086.134] (-1085.200) (-1085.349) (-1084.093) * [-1084.176] (-1083.644) (-1089.944) (-1084.986) -- 0:00:24
607000 -- [-1084.104] (-1085.839) (-1085.095) (-1086.449) * (-1085.867) (-1085.511) (-1084.857) [-1085.263] -- 0:00:24
607500 -- (-1088.013) [-1089.756] (-1084.933) (-1084.513) * (-1084.995) [-1085.000] (-1084.878) (-1087.460) -- 0:00:24
608000 -- (-1088.908) [-1085.295] (-1087.656) (-1083.860) * [-1085.662] (-1086.282) (-1084.079) (-1084.648) -- 0:00:24
608500 -- (-1086.319) (-1086.626) [-1085.440] (-1087.469) * (-1083.002) (-1084.649) (-1088.435) [-1085.472] -- 0:00:24
609000 -- (-1085.863) (-1084.296) (-1083.970) [-1084.845] * [-1083.424] (-1086.603) (-1087.964) (-1086.915) -- 0:00:24
609500 -- (-1084.724) (-1086.228) [-1086.486] (-1085.345) * (-1085.562) [-1086.258] (-1088.517) (-1085.336) -- 0:00:24
610000 -- [-1087.136] (-1086.517) (-1086.099) (-1084.694) * (-1089.620) [-1088.059] (-1084.739) (-1086.484) -- 0:00:24
Average standard deviation of split frequencies: 0.006639
610500 -- (-1086.846) (-1085.564) [-1086.245] (-1085.688) * (-1091.348) (-1085.073) [-1084.349] (-1085.028) -- 0:00:24
611000 -- (-1086.779) (-1085.380) (-1089.245) [-1084.215] * [-1085.896] (-1084.916) (-1086.578) (-1085.056) -- 0:00:24
611500 -- (-1086.433) [-1085.520] (-1084.564) (-1087.720) * (-1084.087) [-1085.935] (-1086.274) (-1084.909) -- 0:00:24
612000 -- (-1090.319) (-1084.505) (-1085.781) [-1088.617] * (-1084.178) [-1083.518] (-1086.772) (-1086.731) -- 0:00:24
612500 -- (-1085.128) (-1084.607) [-1091.301] (-1085.367) * [-1085.060] (-1083.754) (-1084.268) (-1086.013) -- 0:00:24
613000 -- (-1084.780) [-1084.270] (-1084.140) (-1083.872) * (-1083.442) (-1084.619) (-1083.900) [-1085.588] -- 0:00:23
613500 -- (-1085.563) (-1087.640) [-1085.503] (-1084.856) * (-1083.439) [-1084.736] (-1084.980) (-1083.961) -- 0:00:23
614000 -- (-1084.374) [-1083.952] (-1084.210) (-1085.875) * [-1084.961] (-1084.806) (-1083.845) (-1083.517) -- 0:00:23
614500 -- (-1085.704) [-1086.247] (-1086.787) (-1085.536) * (-1083.879) (-1083.100) [-1083.781] (-1085.705) -- 0:00:23
615000 -- (-1084.742) (-1084.582) (-1090.937) [-1084.691] * (-1083.646) (-1084.515) [-1083.115] (-1084.798) -- 0:00:23
Average standard deviation of split frequencies: 0.006785
615500 -- (-1085.721) [-1084.164] (-1086.235) (-1085.277) * [-1085.700] (-1084.370) (-1085.175) (-1084.716) -- 0:00:23
616000 -- (-1087.040) (-1083.501) (-1084.691) [-1085.093] * (-1084.570) (-1083.908) (-1085.488) [-1084.709] -- 0:00:23
616500 -- (-1087.703) (-1084.526) (-1085.140) [-1084.651] * (-1089.461) [-1084.901] (-1084.006) (-1083.693) -- 0:00:23
617000 -- [-1085.189] (-1084.724) (-1083.572) (-1085.085) * (-1085.992) (-1083.902) (-1086.015) [-1084.025] -- 0:00:24
617500 -- [-1083.009] (-1085.871) (-1084.864) (-1084.137) * [-1083.345] (-1083.785) (-1087.414) (-1084.260) -- 0:00:24
618000 -- (-1088.091) (-1083.787) (-1086.767) [-1084.136] * (-1089.540) (-1083.634) (-1086.510) [-1090.650] -- 0:00:24
618500 -- (-1085.233) (-1084.866) [-1083.383] (-1085.427) * (-1086.905) (-1086.124) (-1085.404) [-1085.022] -- 0:00:24
619000 -- (-1089.046) (-1083.952) [-1085.331] (-1087.811) * (-1088.788) [-1083.864] (-1085.543) (-1087.089) -- 0:00:24
619500 -- (-1085.049) [-1084.338] (-1087.666) (-1085.971) * (-1085.877) [-1083.827] (-1086.432) (-1084.611) -- 0:00:23
620000 -- (-1084.924) [-1084.959] (-1083.899) (-1084.171) * [-1085.670] (-1083.483) (-1087.698) (-1086.477) -- 0:00:23
Average standard deviation of split frequencies: 0.006633
620500 -- (-1086.214) (-1089.131) (-1083.063) [-1084.187] * (-1085.789) (-1083.334) [-1085.034] (-1084.529) -- 0:00:23
621000 -- (-1085.026) (-1083.387) [-1083.248] (-1091.458) * [-1083.325] (-1086.415) (-1084.066) (-1084.965) -- 0:00:23
621500 -- (-1087.373) [-1084.141] (-1083.397) (-1085.555) * (-1084.173) [-1086.058] (-1085.224) (-1084.005) -- 0:00:23
622000 -- (-1088.607) (-1086.801) [-1083.425] (-1085.528) * (-1090.015) [-1086.996] (-1084.438) (-1083.891) -- 0:00:23
622500 -- (-1086.192) (-1088.185) [-1083.646] (-1085.228) * (-1086.498) [-1084.273] (-1084.443) (-1086.996) -- 0:00:23
623000 -- [-1088.294] (-1084.664) (-1083.992) (-1088.370) * [-1084.139] (-1088.163) (-1085.070) (-1083.968) -- 0:00:23
623500 -- (-1085.539) [-1085.418] (-1085.058) (-1087.199) * [-1084.716] (-1087.224) (-1086.376) (-1085.656) -- 0:00:23
624000 -- (-1085.216) [-1086.397] (-1085.493) (-1093.491) * (-1084.071) (-1085.645) (-1086.472) [-1084.990] -- 0:00:23
624500 -- (-1086.611) (-1085.913) (-1085.103) [-1086.753] * [-1083.447] (-1084.681) (-1085.887) (-1086.823) -- 0:00:23
625000 -- (-1088.698) (-1084.896) [-1085.591] (-1086.468) * (-1085.169) (-1086.588) (-1084.910) [-1083.994] -- 0:00:23
Average standard deviation of split frequencies: 0.006476
625500 -- (-1087.993) [-1085.401] (-1086.397) (-1084.394) * (-1083.593) (-1087.452) [-1086.880] (-1083.236) -- 0:00:23
626000 -- (-1085.065) [-1083.696] (-1089.460) (-1085.314) * (-1086.308) (-1093.742) [-1085.776] (-1085.605) -- 0:00:23
626500 -- (-1083.896) (-1083.918) [-1089.136] (-1085.291) * (-1087.953) [-1086.459] (-1089.225) (-1088.933) -- 0:00:23
627000 -- (-1085.662) [-1085.217] (-1089.289) (-1084.616) * [-1087.102] (-1087.446) (-1085.153) (-1083.275) -- 0:00:23
627500 -- (-1086.964) (-1085.714) (-1088.098) [-1084.970] * (-1084.217) (-1086.286) (-1092.458) [-1084.187] -- 0:00:23
628000 -- (-1086.130) (-1085.490) [-1086.672] (-1085.317) * [-1085.305] (-1085.877) (-1086.985) (-1083.531) -- 0:00:23
628500 -- (-1084.289) (-1084.796) (-1084.776) [-1085.965] * (-1087.318) [-1083.358] (-1087.071) (-1084.927) -- 0:00:23
629000 -- (-1084.660) (-1084.011) [-1085.512] (-1084.478) * [-1084.806] (-1084.147) (-1086.201) (-1086.074) -- 0:00:23
629500 -- (-1087.711) [-1085.349] (-1086.796) (-1087.073) * (-1087.854) (-1084.373) (-1087.749) [-1084.800] -- 0:00:22
630000 -- (-1084.288) [-1084.559] (-1087.296) (-1084.706) * (-1084.286) [-1084.003] (-1086.801) (-1084.804) -- 0:00:22
Average standard deviation of split frequencies: 0.005980
630500 -- (-1083.695) (-1086.288) (-1089.290) [-1084.755] * (-1085.670) (-1084.066) (-1087.580) [-1086.323] -- 0:00:22
631000 -- (-1085.105) (-1083.211) (-1086.463) [-1083.359] * (-1089.066) (-1083.513) (-1083.799) [-1086.029] -- 0:00:22
631500 -- [-1088.385] (-1091.634) (-1088.113) (-1084.655) * (-1085.377) (-1083.386) [-1084.904] (-1084.989) -- 0:00:22
632000 -- [-1086.444] (-1087.652) (-1087.999) (-1090.360) * [-1086.747] (-1083.873) (-1085.407) (-1090.158) -- 0:00:22
632500 -- [-1084.125] (-1084.694) (-1086.065) (-1095.228) * (-1086.032) [-1083.577] (-1084.931) (-1085.249) -- 0:00:22
633000 -- (-1085.189) (-1084.323) [-1084.589] (-1088.110) * (-1085.959) (-1084.979) [-1083.902] (-1083.339) -- 0:00:23
633500 -- (-1083.997) [-1084.049] (-1083.936) (-1087.458) * (-1085.834) (-1084.544) (-1089.827) [-1083.492] -- 0:00:23
634000 -- [-1084.045] (-1086.082) (-1083.971) (-1088.861) * (-1087.809) (-1084.784) (-1085.813) [-1084.988] -- 0:00:23
634500 -- [-1083.646] (-1084.965) (-1083.590) (-1085.123) * (-1083.776) (-1084.959) [-1084.916] (-1083.382) -- 0:00:23
635000 -- (-1085.014) [-1084.917] (-1087.286) (-1084.476) * (-1085.855) (-1084.219) [-1086.426] (-1086.755) -- 0:00:22
Average standard deviation of split frequencies: 0.006276
635500 -- (-1083.864) (-1084.452) [-1084.657] (-1084.146) * [-1086.323] (-1083.314) (-1083.828) (-1089.307) -- 0:00:22
636000 -- (-1083.844) (-1087.583) (-1085.926) [-1087.157] * (-1088.268) [-1083.536] (-1083.788) (-1087.070) -- 0:00:22
636500 -- [-1084.988] (-1086.113) (-1088.099) (-1083.886) * (-1084.873) (-1085.146) [-1086.799] (-1087.013) -- 0:00:22
637000 -- (-1084.753) [-1083.563] (-1085.495) (-1088.059) * (-1084.891) [-1086.000] (-1085.446) (-1087.034) -- 0:00:22
637500 -- (-1085.864) (-1084.202) (-1084.612) [-1086.774] * (-1088.542) [-1084.669] (-1087.783) (-1083.269) -- 0:00:22
638000 -- (-1088.350) (-1086.421) (-1087.530) [-1084.472] * (-1086.637) [-1084.107] (-1086.253) (-1083.752) -- 0:00:22
638500 -- [-1086.897] (-1087.763) (-1085.789) (-1086.480) * (-1083.818) [-1085.198] (-1084.738) (-1086.662) -- 0:00:22
639000 -- (-1085.196) [-1086.126] (-1086.713) (-1087.974) * (-1090.631) (-1087.839) (-1089.002) [-1085.302] -- 0:00:22
639500 -- [-1085.412] (-1087.057) (-1086.251) (-1088.009) * (-1090.229) (-1086.248) [-1085.081] (-1084.204) -- 0:00:22
640000 -- (-1090.126) (-1084.483) (-1085.603) [-1083.765] * (-1087.616) [-1085.309] (-1088.235) (-1085.199) -- 0:00:22
Average standard deviation of split frequencies: 0.005935
640500 -- (-1093.366) (-1084.384) [-1086.654] (-1085.357) * (-1086.007) (-1086.872) [-1084.979] (-1084.097) -- 0:00:22
641000 -- [-1086.101] (-1086.873) (-1084.954) (-1085.109) * (-1087.607) (-1085.146) (-1085.189) [-1085.179] -- 0:00:22
641500 -- [-1083.836] (-1084.864) (-1086.963) (-1087.076) * (-1087.089) (-1085.860) [-1088.458] (-1087.182) -- 0:00:22
642000 -- (-1086.012) (-1084.217) [-1085.759] (-1084.642) * (-1084.280) [-1084.488] (-1090.646) (-1086.014) -- 0:00:22
642500 -- (-1085.112) (-1086.566) [-1088.558] (-1083.368) * (-1087.881) [-1083.312] (-1085.724) (-1084.741) -- 0:00:22
643000 -- [-1087.114] (-1084.946) (-1086.296) (-1083.433) * [-1083.952] (-1089.210) (-1086.824) (-1085.152) -- 0:00:22
643500 -- (-1086.349) [-1088.045] (-1084.182) (-1085.424) * [-1084.478] (-1083.268) (-1088.954) (-1087.814) -- 0:00:22
644000 -- (-1086.107) (-1090.847) (-1085.989) [-1085.737] * (-1084.529) (-1085.610) [-1084.477] (-1083.756) -- 0:00:22
644500 -- (-1084.420) (-1092.721) (-1084.814) [-1088.427] * (-1083.988) [-1083.033] (-1083.539) (-1085.934) -- 0:00:22
645000 -- [-1085.048] (-1086.906) (-1084.211) (-1083.768) * (-1086.481) (-1083.296) [-1085.511] (-1087.218) -- 0:00:22
Average standard deviation of split frequencies: 0.006665
645500 -- (-1091.794) (-1086.238) [-1084.017] (-1084.460) * (-1085.521) [-1083.436] (-1084.211) (-1085.075) -- 0:00:21
646000 -- (-1084.199) (-1084.940) [-1084.330] (-1086.981) * (-1085.538) (-1085.106) (-1083.654) [-1086.985] -- 0:00:21
646500 -- (-1084.770) (-1084.352) (-1085.616) [-1084.758] * (-1088.546) [-1085.888] (-1083.856) (-1091.375) -- 0:00:21
647000 -- (-1085.038) [-1084.443] (-1084.744) (-1087.060) * [-1085.825] (-1083.547) (-1083.561) (-1084.618) -- 0:00:21
647500 -- (-1087.220) (-1085.426) (-1085.549) [-1086.388] * (-1086.081) [-1083.524] (-1094.989) (-1085.176) -- 0:00:21
648000 -- (-1083.646) (-1084.393) (-1090.099) [-1084.824] * (-1089.962) (-1084.216) [-1083.706] (-1083.669) -- 0:00:21
648500 -- (-1084.153) (-1087.788) [-1086.666] (-1084.806) * (-1090.115) (-1084.771) (-1083.273) [-1086.679] -- 0:00:21
649000 -- [-1085.619] (-1090.739) (-1089.057) (-1084.023) * (-1091.199) (-1086.004) [-1084.044] (-1087.400) -- 0:00:21
649500 -- [-1084.328] (-1089.678) (-1087.462) (-1085.292) * (-1084.773) (-1083.911) [-1084.026] (-1086.849) -- 0:00:22
650000 -- (-1084.267) (-1088.952) (-1085.481) [-1083.506] * (-1096.218) [-1084.814] (-1086.835) (-1085.689) -- 0:00:22
Average standard deviation of split frequencies: 0.007052
650500 -- (-1088.712) (-1085.321) (-1084.379) [-1083.381] * (-1090.346) (-1084.891) (-1083.960) [-1084.370] -- 0:00:22
651000 -- (-1085.774) [-1084.816] (-1084.085) (-1084.839) * (-1090.582) (-1083.707) [-1084.202] (-1084.736) -- 0:00:21
651500 -- (-1084.006) (-1085.054) [-1084.546] (-1086.644) * (-1084.405) [-1085.557] (-1083.953) (-1083.767) -- 0:00:21
652000 -- (-1083.765) [-1084.151] (-1086.188) (-1087.896) * (-1086.960) [-1086.511] (-1087.128) (-1086.577) -- 0:00:21
652500 -- (-1084.707) [-1084.423] (-1084.534) (-1087.796) * (-1084.641) (-1086.061) (-1086.997) [-1086.317] -- 0:00:21
653000 -- (-1084.224) [-1084.819] (-1083.720) (-1084.590) * (-1084.052) [-1084.557] (-1086.104) (-1085.615) -- 0:00:21
653500 -- [-1088.032] (-1085.159) (-1087.664) (-1083.444) * (-1085.308) (-1084.993) (-1084.486) [-1084.441] -- 0:00:21
654000 -- [-1085.157] (-1091.468) (-1086.875) (-1092.061) * (-1084.984) (-1085.138) (-1087.115) [-1084.424] -- 0:00:21
654500 -- [-1084.356] (-1084.581) (-1085.348) (-1085.713) * (-1084.034) (-1084.537) (-1084.315) [-1083.617] -- 0:00:21
655000 -- [-1084.303] (-1085.088) (-1084.137) (-1084.384) * (-1085.276) (-1087.118) (-1085.559) [-1085.257] -- 0:00:21
Average standard deviation of split frequencies: 0.006899
655500 -- [-1084.970] (-1084.867) (-1084.136) (-1084.123) * (-1087.253) (-1085.833) [-1083.465] (-1083.468) -- 0:00:21
656000 -- (-1085.010) (-1084.220) [-1083.371] (-1085.230) * (-1087.017) (-1086.467) (-1083.892) [-1084.754] -- 0:00:21
656500 -- (-1086.575) (-1084.593) (-1084.900) [-1086.564] * [-1085.139] (-1086.607) (-1083.551) (-1086.664) -- 0:00:21
657000 -- [-1083.331] (-1085.141) (-1083.936) (-1085.324) * (-1083.543) (-1085.356) [-1087.820] (-1086.771) -- 0:00:21
657500 -- [-1085.865] (-1084.259) (-1083.652) (-1088.274) * (-1084.608) (-1083.725) [-1084.722] (-1084.942) -- 0:00:21
658000 -- [-1084.318] (-1084.033) (-1084.670) (-1086.876) * (-1085.820) [-1084.982] (-1084.130) (-1085.346) -- 0:00:21
658500 -- (-1084.617) (-1085.385) [-1085.912] (-1088.753) * (-1084.233) [-1083.803] (-1084.441) (-1084.805) -- 0:00:21
659000 -- (-1088.310) [-1086.848] (-1084.117) (-1085.164) * (-1083.651) [-1087.641] (-1089.841) (-1084.919) -- 0:00:21
659500 -- (-1088.331) (-1087.091) [-1083.396] (-1087.191) * (-1084.995) (-1088.807) [-1088.638] (-1084.672) -- 0:00:21
660000 -- (-1088.250) [-1085.518] (-1084.821) (-1085.465) * (-1086.024) (-1086.568) [-1089.016] (-1084.082) -- 0:00:21
Average standard deviation of split frequencies: 0.006707
660500 -- [-1087.371] (-1084.827) (-1083.491) (-1085.660) * (-1085.332) (-1084.449) [-1086.540] (-1083.173) -- 0:00:21
661000 -- (-1085.608) (-1083.820) [-1084.381] (-1085.264) * (-1086.070) [-1084.619] (-1085.780) (-1085.032) -- 0:00:21
661500 -- (-1084.639) (-1084.435) [-1086.712] (-1086.782) * (-1085.144) (-1085.641) [-1085.104] (-1084.086) -- 0:00:20
662000 -- [-1084.279] (-1084.983) (-1085.855) (-1089.756) * (-1083.114) (-1089.375) (-1086.339) [-1086.499] -- 0:00:20
662500 -- (-1084.035) (-1083.520) (-1083.692) [-1086.005] * [-1084.627] (-1084.474) (-1084.434) (-1086.384) -- 0:00:20
663000 -- (-1086.764) [-1083.816] (-1086.272) (-1085.643) * [-1084.450] (-1083.652) (-1084.992) (-1087.874) -- 0:00:20
663500 -- (-1085.553) [-1083.250] (-1085.610) (-1086.920) * (-1086.516) (-1083.613) (-1083.873) [-1087.699] -- 0:00:20
664000 -- [-1085.776] (-1083.836) (-1085.050) (-1087.324) * (-1085.234) (-1085.261) (-1083.755) [-1084.641] -- 0:00:20
664500 -- (-1086.582) [-1085.807] (-1086.398) (-1087.529) * (-1085.935) (-1087.269) [-1085.014] (-1086.427) -- 0:00:20
665000 -- (-1083.992) (-1085.124) (-1084.465) [-1083.126] * (-1090.387) [-1088.463] (-1084.337) (-1084.658) -- 0:00:20
Average standard deviation of split frequencies: 0.006937
665500 -- (-1086.633) (-1087.067) (-1085.928) [-1085.507] * [-1086.813] (-1085.443) (-1084.519) (-1083.699) -- 0:00:20
666000 -- (-1085.387) (-1084.109) [-1086.095] (-1085.729) * (-1087.853) (-1087.107) (-1084.207) [-1083.800] -- 0:00:21
666500 -- (-1086.299) (-1084.584) [-1085.506] (-1087.694) * (-1085.058) (-1086.477) (-1084.397) [-1088.763] -- 0:00:21
667000 -- [-1085.876] (-1084.173) (-1086.970) (-1084.574) * [-1083.636] (-1085.374) (-1086.500) (-1086.620) -- 0:00:20
667500 -- (-1086.321) (-1083.842) [-1084.301] (-1085.851) * (-1086.876) [-1085.359] (-1084.869) (-1086.486) -- 0:00:20
668000 -- (-1092.312) (-1084.931) [-1083.974] (-1083.891) * (-1085.706) [-1086.819] (-1085.005) (-1087.499) -- 0:00:20
668500 -- [-1085.127] (-1089.520) (-1083.666) (-1084.863) * (-1084.215) (-1084.329) [-1085.699] (-1088.798) -- 0:00:20
669000 -- (-1085.591) [-1084.196] (-1085.269) (-1084.830) * (-1086.545) [-1086.646] (-1086.468) (-1085.902) -- 0:00:20
669500 -- (-1083.881) [-1085.459] (-1085.995) (-1084.603) * [-1083.567] (-1085.795) (-1085.918) (-1084.791) -- 0:00:20
670000 -- [-1083.841] (-1084.479) (-1085.092) (-1088.141) * (-1084.271) (-1085.758) (-1087.987) [-1083.980] -- 0:00:20
Average standard deviation of split frequencies: 0.007357
670500 -- [-1084.157] (-1083.907) (-1083.491) (-1085.122) * (-1085.161) (-1090.897) [-1086.484] (-1085.267) -- 0:00:20
671000 -- (-1089.581) (-1083.623) [-1084.777] (-1085.067) * (-1084.300) [-1084.998] (-1085.896) (-1085.562) -- 0:00:20
671500 -- (-1084.463) [-1086.249] (-1084.664) (-1087.572) * (-1084.047) (-1088.438) [-1085.422] (-1091.463) -- 0:00:20
672000 -- (-1084.988) (-1086.594) [-1083.169] (-1083.941) * (-1086.499) [-1086.975] (-1086.177) (-1085.961) -- 0:00:20
672500 -- (-1083.833) (-1087.926) (-1083.610) [-1086.162] * [-1084.253] (-1087.404) (-1085.756) (-1089.674) -- 0:00:20
673000 -- (-1084.862) (-1085.471) [-1084.027] (-1084.708) * [-1085.951] (-1085.056) (-1087.378) (-1088.667) -- 0:00:20
673500 -- (-1083.373) (-1093.374) (-1084.242) [-1084.674] * (-1088.596) [-1087.485] (-1089.782) (-1088.372) -- 0:00:20
674000 -- (-1083.496) (-1087.041) (-1086.707) [-1083.602] * (-1090.506) (-1085.173) (-1087.534) [-1086.241] -- 0:00:20
674500 -- (-1083.887) [-1085.985] (-1086.628) (-1084.398) * (-1086.031) [-1084.121] (-1084.579) (-1085.367) -- 0:00:20
675000 -- (-1085.815) [-1085.541] (-1084.329) (-1084.079) * (-1084.373) (-1085.741) [-1086.040] (-1083.537) -- 0:00:20
Average standard deviation of split frequencies: 0.007903
675500 -- (-1084.697) [-1084.850] (-1084.662) (-1084.808) * [-1085.036] (-1087.370) (-1085.100) (-1083.368) -- 0:00:20
676000 -- (-1084.588) [-1086.317] (-1083.573) (-1083.047) * [-1084.596] (-1085.933) (-1089.056) (-1084.987) -- 0:00:20
676500 -- [-1083.621] (-1084.308) (-1086.295) (-1083.052) * (-1088.315) [-1085.701] (-1086.817) (-1085.138) -- 0:00:20
677000 -- [-1084.095] (-1084.962) (-1089.056) (-1084.949) * [-1085.845] (-1086.021) (-1084.743) (-1085.137) -- 0:00:20
677500 -- (-1084.354) (-1084.001) [-1084.085] (-1085.322) * (-1085.059) [-1087.463] (-1086.850) (-1085.782) -- 0:00:19
678000 -- (-1083.678) (-1086.647) (-1084.141) [-1084.040] * (-1089.462) [-1084.733] (-1086.087) (-1085.435) -- 0:00:19
678500 -- [-1085.275] (-1089.217) (-1083.783) (-1084.615) * [-1086.451] (-1085.624) (-1091.722) (-1086.571) -- 0:00:19
679000 -- (-1083.641) (-1084.121) [-1083.513] (-1086.567) * (-1085.691) (-1083.992) (-1084.092) [-1084.538] -- 0:00:19
679500 -- (-1083.881) [-1086.094] (-1085.379) (-1084.240) * [-1083.855] (-1086.942) (-1088.876) (-1087.022) -- 0:00:19
680000 -- [-1084.338] (-1094.245) (-1091.341) (-1084.696) * (-1084.198) (-1084.699) (-1085.142) [-1088.780] -- 0:00:19
Average standard deviation of split frequencies: 0.008542
680500 -- (-1086.327) (-1085.715) (-1092.919) [-1088.115] * (-1085.457) (-1083.760) [-1084.089] (-1085.504) -- 0:00:19
681000 -- (-1085.184) (-1085.539) (-1085.712) [-1086.591] * (-1085.816) [-1083.824] (-1088.102) (-1084.866) -- 0:00:19
681500 -- (-1086.630) (-1085.390) (-1086.090) [-1086.374] * [-1083.845] (-1084.900) (-1087.890) (-1083.547) -- 0:00:19
682000 -- (-1087.755) (-1084.438) (-1087.522) [-1089.731] * (-1085.524) (-1084.471) [-1084.364] (-1085.957) -- 0:00:19
682500 -- (-1085.993) (-1085.691) [-1089.954] (-1088.131) * [-1086.566] (-1084.488) (-1084.295) (-1084.192) -- 0:00:20
683000 -- (-1087.120) (-1084.503) [-1083.514] (-1088.756) * [-1085.572] (-1085.586) (-1084.337) (-1083.797) -- 0:00:19
683500 -- (-1086.726) [-1085.383] (-1083.831) (-1087.242) * (-1085.437) [-1086.004] (-1086.794) (-1087.821) -- 0:00:19
684000 -- (-1085.953) (-1088.268) (-1089.227) [-1085.472] * (-1085.844) (-1085.052) [-1087.785] (-1087.268) -- 0:00:19
684500 -- (-1084.424) (-1087.295) (-1089.901) [-1085.868] * (-1086.832) [-1087.818] (-1091.657) (-1092.093) -- 0:00:19
685000 -- (-1087.933) (-1087.915) [-1083.922] (-1086.664) * (-1084.568) (-1084.621) [-1086.010] (-1083.894) -- 0:00:19
Average standard deviation of split frequencies: 0.008521
685500 -- (-1087.404) (-1086.059) [-1083.922] (-1085.249) * (-1083.591) (-1085.362) [-1084.359] (-1083.641) -- 0:00:19
686000 -- (-1085.870) (-1088.239) [-1086.049] (-1083.996) * (-1088.174) (-1086.708) (-1084.107) [-1086.953] -- 0:00:19
686500 -- (-1083.889) (-1087.375) [-1084.411] (-1084.586) * [-1084.446] (-1084.559) (-1083.501) (-1090.075) -- 0:00:19
687000 -- (-1083.076) (-1085.143) [-1084.744] (-1084.368) * [-1083.532] (-1083.275) (-1084.522) (-1085.683) -- 0:00:19
687500 -- [-1083.789] (-1086.313) (-1083.925) (-1084.636) * (-1083.843) (-1087.549) [-1088.226] (-1087.026) -- 0:00:19
688000 -- (-1083.831) (-1087.010) [-1083.124] (-1086.563) * (-1086.279) (-1086.492) (-1087.131) [-1085.629] -- 0:00:19
688500 -- (-1085.092) (-1085.850) (-1086.041) [-1086.428] * [-1084.139] (-1084.033) (-1085.717) (-1085.822) -- 0:00:19
689000 -- (-1084.487) [-1086.089] (-1088.211) (-1083.886) * [-1083.876] (-1087.550) (-1083.627) (-1084.106) -- 0:00:19
689500 -- (-1083.636) (-1089.042) [-1086.315] (-1083.893) * (-1085.759) [-1084.588] (-1086.417) (-1087.390) -- 0:00:19
690000 -- (-1084.695) (-1086.416) [-1084.388] (-1086.217) * [-1089.837] (-1083.719) (-1089.068) (-1087.303) -- 0:00:19
Average standard deviation of split frequencies: 0.009100
690500 -- (-1084.955) (-1085.228) [-1086.375] (-1086.491) * (-1088.634) (-1084.058) (-1084.019) [-1087.037] -- 0:00:19
691000 -- (-1086.181) (-1090.772) (-1087.631) [-1083.020] * (-1087.753) [-1084.383] (-1083.460) (-1085.929) -- 0:00:19
691500 -- [-1088.169] (-1083.213) (-1088.417) (-1083.791) * (-1085.878) (-1083.634) (-1093.447) [-1085.661] -- 0:00:19
692000 -- (-1085.180) (-1083.204) [-1086.190] (-1084.087) * (-1085.638) (-1083.619) [-1090.449] (-1087.626) -- 0:00:19
692500 -- (-1086.716) (-1085.160) [-1084.029] (-1083.860) * (-1084.914) (-1083.488) [-1088.825] (-1087.546) -- 0:00:19
693000 -- [-1086.727] (-1083.660) (-1087.673) (-1086.630) * (-1085.007) (-1085.061) (-1084.827) [-1084.795] -- 0:00:19
693500 -- (-1084.848) (-1085.386) [-1084.670] (-1087.378) * (-1085.223) (-1085.414) (-1085.728) [-1084.598] -- 0:00:19
694000 -- (-1086.101) (-1085.859) (-1084.472) [-1087.178] * [-1083.475] (-1089.255) (-1088.185) (-1084.428) -- 0:00:18
694500 -- [-1084.550] (-1083.739) (-1083.035) (-1087.788) * (-1083.627) (-1083.647) [-1087.589] (-1085.577) -- 0:00:18
695000 -- [-1083.809] (-1086.347) (-1086.997) (-1086.340) * [-1084.442] (-1088.292) (-1086.954) (-1086.255) -- 0:00:18
Average standard deviation of split frequencies: 0.008579
695500 -- [-1085.948] (-1085.272) (-1084.732) (-1085.146) * (-1084.954) (-1086.015) (-1084.208) [-1084.986] -- 0:00:18
696000 -- [-1084.194] (-1085.254) (-1088.355) (-1085.417) * (-1084.096) [-1084.994] (-1083.985) (-1084.594) -- 0:00:18
696500 -- (-1084.705) [-1087.775] (-1088.652) (-1084.224) * (-1085.646) (-1086.074) [-1086.710] (-1085.311) -- 0:00:18
697000 -- [-1085.883] (-1083.789) (-1085.071) (-1084.022) * (-1087.832) (-1086.487) [-1086.497] (-1084.342) -- 0:00:18
697500 -- (-1086.564) [-1084.978] (-1089.284) (-1084.378) * [-1087.658] (-1089.143) (-1086.954) (-1083.636) -- 0:00:18
698000 -- [-1085.379] (-1084.661) (-1085.119) (-1086.142) * (-1089.397) [-1085.301] (-1086.238) (-1083.532) -- 0:00:18
698500 -- (-1086.477) [-1085.433] (-1087.502) (-1086.495) * (-1088.999) (-1085.604) (-1087.379) [-1084.019] -- 0:00:18
699000 -- (-1085.544) (-1086.256) (-1085.156) [-1083.851] * (-1085.875) (-1084.903) [-1084.786] (-1089.151) -- 0:00:18
699500 -- [-1086.233] (-1088.653) (-1089.599) (-1086.925) * (-1088.320) (-1083.365) (-1089.114) [-1086.926] -- 0:00:18
700000 -- (-1086.835) (-1086.593) (-1086.008) [-1084.029] * [-1086.360] (-1083.268) (-1086.178) (-1083.423) -- 0:00:18
Average standard deviation of split frequencies: 0.008567
700500 -- (-1083.835) [-1084.608] (-1084.843) (-1084.482) * (-1086.387) (-1083.268) [-1084.507] (-1089.033) -- 0:00:18
701000 -- (-1084.732) (-1084.113) [-1083.607] (-1087.654) * (-1083.998) (-1083.400) [-1084.777] (-1088.073) -- 0:00:18
701500 -- (-1084.292) (-1085.029) [-1085.720] (-1083.291) * (-1085.396) [-1085.256] (-1084.756) (-1085.684) -- 0:00:18
702000 -- (-1084.020) (-1084.743) (-1085.559) [-1084.492] * (-1085.813) (-1083.719) (-1085.282) [-1085.485] -- 0:00:18
702500 -- [-1084.671] (-1083.598) (-1085.032) (-1085.084) * (-1083.103) (-1085.338) (-1084.979) [-1083.519] -- 0:00:18
703000 -- (-1084.895) (-1084.457) [-1085.973] (-1083.483) * (-1085.100) (-1084.089) [-1086.201] (-1084.568) -- 0:00:18
703500 -- (-1086.367) (-1084.099) (-1084.408) [-1084.436] * (-1088.811) [-1085.802] (-1085.196) (-1084.617) -- 0:00:18
704000 -- [-1084.378] (-1086.409) (-1084.473) (-1084.909) * (-1086.483) (-1084.924) [-1087.477] (-1087.451) -- 0:00:18
704500 -- [-1084.485] (-1085.308) (-1084.570) (-1089.631) * (-1086.955) (-1086.951) [-1087.425] (-1083.949) -- 0:00:18
705000 -- (-1085.525) (-1085.561) (-1086.550) [-1088.201] * (-1084.055) (-1086.218) [-1086.617] (-1086.043) -- 0:00:18
Average standard deviation of split frequencies: 0.008547
705500 -- (-1085.492) (-1084.822) [-1085.283] (-1087.476) * (-1083.841) (-1087.025) [-1083.756] (-1086.660) -- 0:00:18
706000 -- (-1087.688) (-1086.583) [-1087.503] (-1087.096) * (-1084.248) (-1083.902) [-1084.105] (-1087.365) -- 0:00:18
706500 -- [-1086.630] (-1083.705) (-1085.391) (-1087.139) * [-1083.617] (-1084.818) (-1085.078) (-1083.887) -- 0:00:18
707000 -- [-1086.832] (-1084.459) (-1083.947) (-1087.445) * [-1083.824] (-1087.247) (-1086.084) (-1084.974) -- 0:00:18
707500 -- (-1085.293) (-1086.155) (-1085.610) [-1085.432] * (-1083.868) [-1085.924] (-1085.771) (-1084.398) -- 0:00:18
708000 -- (-1084.261) [-1086.668] (-1087.902) (-1085.280) * (-1087.161) (-1088.833) [-1085.779] (-1085.770) -- 0:00:18
708500 -- (-1086.599) (-1085.500) (-1086.195) [-1084.924] * (-1086.706) (-1087.044) [-1089.196] (-1084.364) -- 0:00:18
709000 -- [-1085.035] (-1084.034) (-1085.430) (-1087.272) * (-1084.061) [-1085.104] (-1085.251) (-1086.046) -- 0:00:18
709500 -- (-1086.525) (-1085.021) (-1085.533) [-1089.540] * (-1085.135) [-1083.800] (-1088.759) (-1084.422) -- 0:00:18
710000 -- (-1085.798) (-1086.405) [-1087.110] (-1089.163) * (-1084.841) (-1086.424) (-1089.151) [-1086.004] -- 0:00:17
Average standard deviation of split frequencies: 0.008913
710500 -- [-1086.154] (-1084.750) (-1088.543) (-1090.588) * (-1088.087) (-1087.364) (-1084.263) [-1086.727] -- 0:00:17
711000 -- [-1086.120] (-1085.639) (-1086.237) (-1088.762) * (-1092.332) [-1086.036] (-1085.601) (-1085.500) -- 0:00:17
711500 -- [-1088.101] (-1084.046) (-1087.478) (-1085.287) * (-1087.059) [-1084.601] (-1083.238) (-1086.308) -- 0:00:17
712000 -- (-1085.066) (-1085.288) [-1083.799] (-1084.889) * [-1086.483] (-1085.679) (-1083.983) (-1084.245) -- 0:00:17
712500 -- [-1084.472] (-1085.822) (-1084.766) (-1085.748) * [-1084.467] (-1085.612) (-1088.492) (-1084.322) -- 0:00:17
713000 -- (-1087.269) (-1083.758) [-1084.213] (-1084.298) * (-1086.365) [-1086.083] (-1087.911) (-1083.608) -- 0:00:17
713500 -- (-1090.411) (-1085.151) (-1084.099) [-1085.957] * [-1086.550] (-1083.664) (-1089.485) (-1084.691) -- 0:00:17
714000 -- (-1088.011) [-1085.769] (-1084.787) (-1083.460) * (-1085.501) (-1085.173) (-1085.450) [-1084.393] -- 0:00:17
714500 -- (-1084.638) (-1089.789) (-1087.462) [-1083.416] * (-1088.235) (-1086.681) [-1084.928] (-1084.728) -- 0:00:17
715000 -- (-1083.876) (-1087.968) [-1083.838] (-1085.296) * (-1086.220) [-1085.642] (-1087.122) (-1086.518) -- 0:00:17
Average standard deviation of split frequencies: 0.008383
715500 -- (-1083.932) (-1091.996) [-1088.416] (-1084.347) * (-1089.375) [-1086.731] (-1085.966) (-1088.341) -- 0:00:17
716000 -- (-1085.044) (-1090.370) (-1083.533) [-1084.596] * (-1084.038) (-1086.573) [-1093.279] (-1094.978) -- 0:00:17
716500 -- (-1084.934) [-1085.406] (-1085.574) (-1084.753) * [-1086.104] (-1085.929) (-1087.529) (-1094.326) -- 0:00:17
717000 -- [-1087.084] (-1085.830) (-1086.695) (-1091.300) * [-1085.897] (-1088.843) (-1085.413) (-1088.149) -- 0:00:17
717500 -- (-1088.116) (-1084.936) [-1087.164] (-1087.483) * (-1085.565) (-1088.474) (-1089.910) [-1084.676] -- 0:00:17
718000 -- [-1086.133] (-1084.249) (-1084.813) (-1084.746) * [-1085.806] (-1087.584) (-1087.460) (-1084.922) -- 0:00:17
718500 -- (-1084.528) [-1084.477] (-1084.816) (-1085.860) * (-1085.842) (-1088.111) [-1089.105] (-1084.845) -- 0:00:17
719000 -- [-1086.748] (-1084.342) (-1085.340) (-1085.976) * (-1086.007) [-1086.049] (-1087.936) (-1084.768) -- 0:00:17
719500 -- (-1087.342) [-1085.160] (-1085.709) (-1087.375) * [-1084.527] (-1091.771) (-1084.264) (-1083.872) -- 0:00:17
720000 -- (-1088.474) (-1087.862) (-1087.053) [-1087.370] * (-1085.067) (-1085.208) (-1085.246) [-1084.557] -- 0:00:17
Average standard deviation of split frequencies: 0.008111
720500 -- (-1085.701) (-1083.730) [-1085.351] (-1086.197) * [-1084.400] (-1083.729) (-1085.102) (-1086.899) -- 0:00:17
721000 -- [-1085.900] (-1090.974) (-1083.448) (-1086.137) * (-1084.439) [-1085.185] (-1085.616) (-1086.090) -- 0:00:17
721500 -- (-1086.115) (-1087.225) (-1085.367) [-1083.687] * (-1085.152) (-1090.217) (-1088.554) [-1085.412] -- 0:00:17
722000 -- (-1085.145) (-1086.846) (-1087.164) [-1084.353] * (-1085.212) [-1085.205] (-1084.624) (-1083.720) -- 0:00:17
722500 -- (-1086.554) [-1085.967] (-1086.398) (-1084.863) * (-1084.976) (-1084.200) (-1085.456) [-1084.397] -- 0:00:17
723000 -- [-1086.973] (-1085.587) (-1086.180) (-1083.908) * [-1085.986] (-1084.212) (-1083.861) (-1085.690) -- 0:00:17
723500 -- (-1085.728) (-1086.238) [-1087.679] (-1084.028) * (-1084.261) (-1085.192) [-1085.689] (-1085.450) -- 0:00:17
724000 -- (-1087.642) [-1086.172] (-1087.061) (-1084.430) * (-1085.184) (-1086.388) [-1087.953] (-1085.252) -- 0:00:17
724500 -- (-1087.021) [-1084.908] (-1088.568) (-1087.349) * (-1084.822) (-1083.554) (-1084.164) [-1084.390] -- 0:00:17
725000 -- (-1085.064) (-1084.112) (-1085.693) [-1083.566] * [-1085.816] (-1084.134) (-1084.947) (-1084.174) -- 0:00:17
Average standard deviation of split frequencies: 0.008225
725500 -- [-1083.814] (-1085.880) (-1084.102) (-1088.354) * (-1087.500) (-1085.258) (-1084.128) [-1084.190] -- 0:00:17
726000 -- (-1083.914) (-1089.303) (-1085.118) [-1084.327] * [-1088.019] (-1085.715) (-1083.314) (-1084.537) -- 0:00:16
726500 -- (-1085.599) [-1086.051] (-1084.814) (-1085.430) * (-1086.212) (-1086.455) [-1084.382] (-1085.555) -- 0:00:16
727000 -- (-1085.889) (-1083.387) [-1085.020] (-1084.174) * [-1083.918] (-1086.936) (-1084.107) (-1084.956) -- 0:00:16
727500 -- (-1084.337) (-1085.982) (-1084.989) [-1083.470] * [-1085.318] (-1085.780) (-1085.245) (-1085.467) -- 0:00:16
728000 -- [-1084.070] (-1086.893) (-1083.578) (-1083.597) * (-1086.715) [-1086.218] (-1085.294) (-1089.148) -- 0:00:16
728500 -- (-1083.945) (-1087.777) (-1083.654) [-1085.640] * (-1084.889) [-1085.157] (-1085.112) (-1085.389) -- 0:00:16
729000 -- (-1083.572) (-1087.263) [-1084.133] (-1088.683) * (-1089.424) [-1084.071] (-1084.714) (-1085.025) -- 0:00:16
729500 -- [-1083.285] (-1086.988) (-1085.253) (-1083.803) * (-1083.744) (-1087.336) (-1085.358) [-1084.035] -- 0:00:16
730000 -- [-1084.102] (-1084.898) (-1085.030) (-1085.426) * [-1086.037] (-1086.199) (-1083.479) (-1083.761) -- 0:00:16
Average standard deviation of split frequencies: 0.008172
730500 -- [-1085.688] (-1087.417) (-1086.256) (-1085.381) * (-1090.388) (-1084.869) [-1083.210] (-1087.885) -- 0:00:16
731000 -- (-1086.775) (-1084.580) [-1087.274] (-1087.104) * (-1084.800) [-1084.487] (-1083.309) (-1087.063) -- 0:00:16
731500 -- (-1084.074) [-1084.601] (-1088.943) (-1085.654) * [-1084.617] (-1083.485) (-1086.116) (-1086.314) -- 0:00:16
732000 -- [-1084.520] (-1085.879) (-1086.517) (-1088.349) * [-1084.713] (-1091.807) (-1086.450) (-1088.723) -- 0:00:16
732500 -- (-1084.676) (-1085.048) [-1085.286] (-1084.586) * (-1084.112) (-1084.958) (-1085.379) [-1087.559] -- 0:00:16
733000 -- (-1089.808) [-1085.448] (-1084.503) (-1087.011) * (-1084.301) [-1084.187] (-1086.835) (-1086.482) -- 0:00:16
733500 -- (-1084.588) [-1084.442] (-1084.661) (-1085.907) * (-1083.611) (-1084.237) [-1086.035] (-1084.822) -- 0:00:16
734000 -- [-1084.776] (-1083.580) (-1085.231) (-1086.305) * (-1088.012) [-1083.761] (-1087.381) (-1083.657) -- 0:00:16
734500 -- (-1084.864) (-1083.223) [-1084.606] (-1087.418) * (-1084.309) (-1086.243) [-1086.002] (-1085.078) -- 0:00:16
735000 -- [-1084.338] (-1083.935) (-1084.700) (-1091.336) * [-1085.658] (-1084.943) (-1085.377) (-1084.601) -- 0:00:16
Average standard deviation of split frequencies: 0.008070
735500 -- (-1084.818) [-1083.391] (-1085.266) (-1084.770) * (-1085.508) (-1087.368) (-1087.579) [-1084.379] -- 0:00:16
736000 -- (-1084.948) [-1084.523] (-1084.222) (-1084.381) * [-1086.573] (-1084.235) (-1088.039) (-1086.295) -- 0:00:16
736500 -- (-1085.347) [-1084.440] (-1088.103) (-1088.252) * [-1083.441] (-1084.177) (-1085.865) (-1087.280) -- 0:00:16
737000 -- (-1083.580) [-1087.584] (-1085.864) (-1086.543) * (-1085.800) (-1085.108) [-1086.409] (-1086.224) -- 0:00:16
737500 -- (-1085.746) (-1089.395) (-1083.310) [-1085.232] * (-1087.774) [-1090.044] (-1085.481) (-1085.258) -- 0:00:16
738000 -- (-1086.405) (-1084.510) [-1083.212] (-1083.957) * [-1085.787] (-1085.429) (-1087.189) (-1086.148) -- 0:00:16
738500 -- (-1087.099) (-1084.624) (-1083.696) [-1083.558] * [-1084.433] (-1084.504) (-1086.380) (-1084.733) -- 0:00:16
739000 -- (-1088.601) (-1083.575) (-1083.809) [-1091.627] * [-1084.900] (-1085.225) (-1087.156) (-1086.012) -- 0:00:16
739500 -- (-1086.035) (-1085.853) [-1084.602] (-1088.508) * (-1084.545) (-1086.139) [-1085.767] (-1084.909) -- 0:00:16
740000 -- (-1083.477) (-1084.016) (-1083.735) [-1090.541] * [-1084.465] (-1084.460) (-1083.735) (-1085.588) -- 0:00:16
Average standard deviation of split frequencies: 0.007638
740500 -- (-1086.973) (-1086.491) [-1087.202] (-1094.599) * [-1083.844] (-1088.082) (-1083.920) (-1085.223) -- 0:00:16
741000 -- (-1084.062) (-1088.157) (-1086.831) [-1084.946] * (-1083.673) (-1084.732) (-1084.747) [-1085.676] -- 0:00:16
741500 -- (-1090.535) (-1085.502) (-1085.160) [-1084.651] * (-1083.641) [-1085.287] (-1087.690) (-1086.063) -- 0:00:16
742000 -- [-1084.517] (-1088.525) (-1084.401) (-1083.857) * (-1087.077) (-1084.007) [-1085.417] (-1086.082) -- 0:00:15
742500 -- (-1085.322) (-1084.847) (-1088.239) [-1083.978] * (-1084.956) (-1086.022) [-1086.246] (-1090.988) -- 0:00:15
743000 -- (-1086.831) [-1083.885] (-1087.547) (-1083.756) * (-1088.049) [-1085.336] (-1085.433) (-1089.560) -- 0:00:15
743500 -- (-1086.194) [-1083.544] (-1085.567) (-1086.035) * [-1086.403] (-1086.202) (-1086.731) (-1086.212) -- 0:00:15
744000 -- [-1084.114] (-1088.476) (-1090.406) (-1086.601) * [-1086.019] (-1088.732) (-1085.260) (-1088.939) -- 0:00:15
744500 -- (-1087.545) [-1089.009] (-1086.226) (-1085.997) * (-1094.687) (-1086.334) [-1088.134] (-1084.876) -- 0:00:15
745000 -- [-1084.976] (-1085.931) (-1083.678) (-1086.309) * (-1086.230) [-1085.683] (-1089.656) (-1087.712) -- 0:00:15
Average standard deviation of split frequencies: 0.007246
745500 -- (-1083.878) (-1086.291) [-1084.072] (-1088.626) * (-1085.699) [-1083.510] (-1088.077) (-1084.818) -- 0:00:15
746000 -- [-1085.106] (-1089.483) (-1086.857) (-1084.279) * (-1087.730) [-1084.783] (-1085.143) (-1084.754) -- 0:00:15
746500 -- (-1084.852) [-1085.782] (-1086.681) (-1084.986) * (-1083.508) (-1083.955) [-1083.808] (-1083.712) -- 0:00:15
747000 -- (-1085.971) (-1086.028) (-1086.182) [-1085.141] * (-1088.351) [-1084.492] (-1087.067) (-1083.987) -- 0:00:15
747500 -- (-1086.622) [-1083.853] (-1083.426) (-1083.607) * (-1087.648) (-1086.858) (-1090.627) [-1084.064] -- 0:00:15
748000 -- (-1086.424) (-1091.618) (-1083.491) [-1083.547] * [-1088.081] (-1084.364) (-1088.299) (-1088.140) -- 0:00:15
748500 -- (-1086.308) (-1084.089) (-1088.102) [-1083.824] * (-1088.333) (-1086.611) (-1085.711) [-1085.301] -- 0:00:15
749000 -- (-1085.712) (-1086.320) [-1088.187] (-1083.835) * (-1084.927) (-1084.218) [-1088.906] (-1087.141) -- 0:00:15
749500 -- (-1090.757) (-1085.501) (-1086.928) [-1084.584] * (-1086.075) (-1088.418) (-1086.503) [-1085.269] -- 0:00:15
750000 -- (-1086.282) (-1086.684) (-1085.716) [-1084.664] * (-1085.011) (-1087.252) [-1085.183] (-1088.662) -- 0:00:15
Average standard deviation of split frequencies: 0.007117
750500 -- [-1085.688] (-1084.941) (-1085.694) (-1086.645) * (-1085.789) [-1087.224] (-1086.032) (-1085.638) -- 0:00:15
751000 -- (-1088.607) (-1088.455) [-1085.694] (-1089.752) * (-1084.390) (-1085.213) (-1085.094) [-1083.596] -- 0:00:15
751500 -- [-1086.408] (-1086.622) (-1085.534) (-1086.712) * (-1083.920) (-1084.440) (-1083.997) [-1085.829] -- 0:00:15
752000 -- (-1087.501) (-1084.037) [-1086.287] (-1086.472) * (-1086.408) [-1084.152] (-1086.855) (-1086.629) -- 0:00:15
752500 -- (-1084.381) [-1083.441] (-1090.855) (-1084.283) * [-1086.476] (-1084.285) (-1085.879) (-1086.336) -- 0:00:15
753000 -- [-1084.871] (-1083.809) (-1088.467) (-1084.704) * [-1088.111] (-1083.797) (-1086.154) (-1084.788) -- 0:00:15
753500 -- (-1085.005) [-1083.646] (-1084.474) (-1083.873) * (-1089.513) [-1083.997] (-1083.361) (-1089.233) -- 0:00:15
754000 -- (-1085.320) (-1083.784) (-1085.095) [-1084.091] * (-1089.337) (-1086.208) [-1084.785] (-1084.965) -- 0:00:15
754500 -- [-1087.447] (-1084.387) (-1088.111) (-1085.049) * [-1088.524] (-1086.378) (-1085.472) (-1087.747) -- 0:00:15
755000 -- [-1084.902] (-1084.355) (-1084.894) (-1087.924) * (-1087.023) (-1085.558) (-1084.881) [-1083.983] -- 0:00:15
Average standard deviation of split frequencies: 0.007566
755500 -- (-1084.208) (-1085.097) [-1083.856] (-1085.723) * (-1093.476) (-1084.594) (-1083.254) [-1084.806] -- 0:00:15
756000 -- (-1083.789) (-1087.046) (-1083.486) [-1089.692] * (-1083.234) (-1084.298) (-1087.443) [-1084.938] -- 0:00:15
756500 -- (-1084.996) (-1083.840) [-1088.738] (-1083.663) * [-1083.725] (-1088.032) (-1087.235) (-1086.003) -- 0:00:15
757000 -- (-1085.155) [-1083.138] (-1087.358) (-1088.834) * [-1084.827] (-1084.884) (-1086.553) (-1085.135) -- 0:00:15
757500 -- (-1084.232) (-1083.138) [-1086.544] (-1087.434) * [-1083.837] (-1084.021) (-1086.302) (-1084.941) -- 0:00:15
758000 -- [-1085.390] (-1084.586) (-1085.255) (-1087.060) * (-1084.054) (-1085.366) (-1085.308) [-1084.398] -- 0:00:15
758500 -- [-1084.030] (-1084.567) (-1084.819) (-1087.343) * [-1084.103] (-1086.447) (-1086.273) (-1084.622) -- 0:00:14
759000 -- (-1083.978) (-1084.407) [-1086.854] (-1084.206) * (-1083.447) (-1085.072) (-1088.950) [-1085.682] -- 0:00:14
759500 -- (-1084.731) [-1085.031] (-1085.577) (-1088.263) * (-1084.298) (-1083.060) (-1087.627) [-1084.818] -- 0:00:14
760000 -- (-1085.597) (-1085.147) [-1084.360] (-1083.813) * (-1085.281) (-1084.229) [-1083.572] (-1084.270) -- 0:00:14
Average standard deviation of split frequencies: 0.007065
760500 -- (-1084.635) (-1085.073) (-1086.350) [-1083.105] * (-1085.094) [-1083.426] (-1085.249) (-1084.128) -- 0:00:14
761000 -- (-1084.452) (-1084.939) (-1087.951) [-1083.037] * [-1083.923] (-1086.987) (-1086.523) (-1084.212) -- 0:00:14
761500 -- (-1084.453) (-1088.489) (-1084.965) [-1086.036] * (-1084.475) [-1090.023] (-1085.889) (-1083.641) -- 0:00:14
762000 -- (-1085.417) (-1083.768) [-1085.338] (-1089.540) * (-1087.706) [-1084.451] (-1087.776) (-1084.456) -- 0:00:14
762500 -- (-1085.386) [-1085.956] (-1084.280) (-1085.143) * (-1084.711) (-1084.542) (-1087.387) [-1084.615] -- 0:00:14
763000 -- [-1087.491] (-1084.482) (-1085.051) (-1084.234) * (-1084.951) [-1084.603] (-1086.150) (-1083.147) -- 0:00:14
763500 -- (-1085.620) (-1084.098) [-1083.645] (-1085.872) * (-1083.979) (-1090.258) (-1086.107) [-1085.692] -- 0:00:14
764000 -- (-1087.222) (-1088.236) [-1084.628] (-1085.742) * (-1084.960) [-1090.480] (-1087.455) (-1085.614) -- 0:00:14
764500 -- [-1085.398] (-1085.474) (-1083.605) (-1085.977) * [-1083.765] (-1087.080) (-1086.128) (-1084.738) -- 0:00:14
765000 -- (-1083.996) (-1085.138) (-1083.833) [-1086.172] * (-1084.448) [-1087.108] (-1091.265) (-1083.849) -- 0:00:14
Average standard deviation of split frequencies: 0.007180
765500 -- (-1086.581) (-1084.054) [-1083.530] (-1086.930) * (-1088.222) (-1090.254) (-1083.416) [-1083.877] -- 0:00:14
766000 -- (-1087.765) (-1084.093) (-1083.896) [-1087.121] * (-1085.844) [-1083.648] (-1084.426) (-1083.632) -- 0:00:14
766500 -- (-1084.414) (-1087.470) (-1083.904) [-1089.461] * [-1084.729] (-1088.163) (-1084.359) (-1086.287) -- 0:00:14
767000 -- (-1084.112) [-1085.991] (-1083.568) (-1086.957) * (-1083.852) (-1085.121) (-1085.174) [-1083.694] -- 0:00:14
767500 -- (-1083.043) [-1089.772] (-1084.496) (-1086.188) * (-1083.569) (-1088.000) [-1084.479] (-1083.785) -- 0:00:14
768000 -- (-1083.491) (-1092.973) (-1083.608) [-1086.087] * (-1085.187) (-1087.687) [-1086.422] (-1087.128) -- 0:00:14
768500 -- (-1090.325) [-1086.219] (-1085.029) (-1087.159) * [-1085.088] (-1085.752) (-1089.332) (-1084.652) -- 0:00:14
769000 -- (-1089.822) (-1083.343) (-1086.744) [-1088.766] * [-1085.366] (-1084.818) (-1086.410) (-1085.810) -- 0:00:14
769500 -- [-1085.074] (-1085.209) (-1088.602) (-1084.393) * [-1084.059] (-1084.787) (-1088.165) (-1083.652) -- 0:00:14
770000 -- (-1084.644) [-1086.327] (-1086.064) (-1083.926) * (-1084.007) (-1086.225) [-1085.192] (-1086.519) -- 0:00:14
Average standard deviation of split frequencies: 0.007136
770500 -- (-1085.385) (-1083.891) (-1086.966) [-1087.260] * [-1084.409] (-1087.010) (-1085.609) (-1083.507) -- 0:00:14
771000 -- (-1088.026) (-1084.816) (-1092.156) [-1087.383] * (-1087.489) (-1086.896) [-1088.143] (-1083.037) -- 0:00:14
771500 -- [-1089.759] (-1087.823) (-1090.953) (-1088.529) * (-1087.386) (-1084.788) (-1084.763) [-1084.293] -- 0:00:14
772000 -- (-1085.967) (-1086.791) (-1084.823) [-1086.142] * (-1087.388) (-1086.540) (-1085.952) [-1085.781] -- 0:00:14
772500 -- (-1085.641) (-1084.384) [-1088.437] (-1087.315) * (-1088.342) [-1085.004] (-1087.771) (-1086.797) -- 0:00:14
773000 -- (-1086.031) (-1083.327) (-1085.946) [-1087.298] * (-1084.414) [-1085.413] (-1085.033) (-1087.224) -- 0:00:14
773500 -- [-1085.163] (-1084.218) (-1086.436) (-1086.797) * (-1086.058) [-1090.912] (-1084.772) (-1083.410) -- 0:00:14
774000 -- (-1085.067) (-1084.567) (-1087.584) [-1087.747] * (-1084.437) (-1086.546) (-1084.738) [-1083.983] -- 0:00:14
774500 -- (-1086.130) [-1083.937] (-1084.724) (-1084.644) * (-1084.587) (-1084.138) [-1084.075] (-1083.966) -- 0:00:13
775000 -- [-1084.679] (-1087.256) (-1083.611) (-1084.854) * (-1085.152) (-1085.526) [-1083.990] (-1085.124) -- 0:00:13
Average standard deviation of split frequencies: 0.007533
775500 -- (-1085.944) [-1084.313] (-1084.502) (-1087.057) * (-1084.893) (-1083.780) (-1085.158) [-1085.470] -- 0:00:13
776000 -- (-1088.055) (-1083.921) [-1086.977] (-1084.078) * (-1083.643) (-1083.976) (-1085.012) [-1085.538] -- 0:00:13
776500 -- (-1085.872) (-1086.256) (-1086.551) [-1084.132] * (-1083.689) [-1084.743] (-1084.985) (-1087.700) -- 0:00:13
777000 -- (-1084.762) (-1085.280) [-1083.769] (-1089.409) * (-1085.058) (-1083.538) (-1084.877) [-1084.173] -- 0:00:13
777500 -- [-1087.189] (-1084.632) (-1084.278) (-1087.867) * (-1084.365) [-1084.331] (-1084.015) (-1083.595) -- 0:00:13
778000 -- (-1087.694) (-1083.963) (-1085.144) [-1087.285] * [-1083.736] (-1084.831) (-1087.532) (-1084.859) -- 0:00:13
778500 -- (-1086.296) (-1083.887) [-1085.224] (-1086.486) * (-1086.028) [-1085.598] (-1087.905) (-1083.546) -- 0:00:13
779000 -- [-1083.650] (-1086.058) (-1084.302) (-1085.982) * (-1083.671) (-1086.435) (-1086.379) [-1084.130] -- 0:00:13
779500 -- (-1085.783) (-1084.295) [-1084.249] (-1085.758) * (-1084.948) [-1083.963] (-1085.790) (-1089.269) -- 0:00:13
780000 -- (-1084.872) [-1085.492] (-1085.764) (-1086.158) * [-1084.701] (-1085.291) (-1084.368) (-1087.931) -- 0:00:13
Average standard deviation of split frequencies: 0.008011
780500 -- (-1085.973) (-1086.877) [-1084.013] (-1085.135) * (-1084.519) (-1086.099) [-1084.693] (-1083.567) -- 0:00:13
781000 -- (-1086.319) (-1086.864) (-1086.279) [-1085.089] * [-1084.001] (-1084.972) (-1087.698) (-1083.726) -- 0:00:13
781500 -- (-1086.582) (-1083.850) (-1084.155) [-1083.341] * (-1085.165) (-1087.256) (-1086.211) [-1085.878] -- 0:00:13
782000 -- [-1086.425] (-1084.097) (-1088.332) (-1084.281) * [-1084.970] (-1085.736) (-1084.292) (-1087.346) -- 0:00:13
782500 -- [-1083.230] (-1085.136) (-1086.179) (-1086.162) * (-1084.793) (-1085.838) [-1083.596] (-1085.248) -- 0:00:13
783000 -- (-1088.986) (-1085.860) (-1084.836) [-1086.149] * (-1084.581) (-1086.682) (-1084.380) [-1086.402] -- 0:00:13
783500 -- [-1086.411] (-1095.338) (-1088.623) (-1085.939) * (-1084.416) (-1087.028) [-1084.273] (-1086.397) -- 0:00:13
784000 -- [-1088.825] (-1088.544) (-1086.616) (-1084.778) * (-1088.498) (-1085.323) [-1087.170] (-1085.066) -- 0:00:13
784500 -- [-1086.417] (-1086.096) (-1085.387) (-1085.030) * [-1087.881] (-1084.713) (-1089.799) (-1088.712) -- 0:00:13
785000 -- (-1087.753) [-1084.534] (-1088.076) (-1083.363) * [-1085.532] (-1088.699) (-1083.535) (-1083.983) -- 0:00:13
Average standard deviation of split frequencies: 0.007717
785500 -- (-1085.677) (-1084.939) [-1085.434] (-1083.618) * (-1084.414) (-1088.476) (-1084.985) [-1085.175] -- 0:00:13
786000 -- [-1084.581] (-1086.332) (-1085.341) (-1085.426) * (-1085.270) (-1084.607) [-1084.707] (-1086.944) -- 0:00:13
786500 -- (-1087.261) [-1085.423] (-1084.588) (-1084.869) * (-1083.755) [-1086.838] (-1084.286) (-1088.463) -- 0:00:13
787000 -- (-1084.721) (-1085.853) [-1085.528] (-1083.082) * (-1087.285) [-1087.462] (-1085.455) (-1091.498) -- 0:00:13
787500 -- (-1084.802) [-1085.731] (-1086.988) (-1083.216) * (-1084.517) [-1084.301] (-1087.041) (-1086.388) -- 0:00:13
788000 -- (-1084.473) (-1083.931) [-1085.980] (-1083.839) * (-1085.260) [-1088.479] (-1094.253) (-1084.901) -- 0:00:13
788500 -- (-1085.408) (-1085.776) (-1084.807) [-1084.131] * (-1087.268) (-1086.460) [-1086.139] (-1086.992) -- 0:00:13
789000 -- [-1089.812] (-1085.407) (-1086.560) (-1086.662) * (-1085.722) (-1084.684) [-1085.549] (-1086.171) -- 0:00:13
789500 -- (-1086.917) (-1085.132) [-1084.088] (-1085.257) * (-1085.951) (-1086.302) (-1092.699) [-1088.162] -- 0:00:13
790000 -- (-1084.680) (-1084.474) (-1083.986) [-1086.273] * [-1085.355] (-1088.805) (-1086.826) (-1086.127) -- 0:00:13
Average standard deviation of split frequencies: 0.007234
790500 -- (-1085.777) (-1085.222) (-1084.866) [-1085.797] * [-1087.061] (-1086.020) (-1084.720) (-1085.301) -- 0:00:12
791000 -- (-1083.680) [-1085.187] (-1087.285) (-1088.461) * (-1084.023) (-1088.952) (-1086.644) [-1087.727] -- 0:00:12
791500 -- [-1085.177] (-1087.558) (-1089.455) (-1085.690) * (-1087.452) (-1086.808) [-1086.327] (-1089.551) -- 0:00:12
792000 -- (-1086.021) (-1084.675) [-1086.694] (-1083.173) * [-1088.091] (-1084.998) (-1085.542) (-1088.527) -- 0:00:12
792500 -- (-1086.285) [-1086.559] (-1087.867) (-1085.847) * (-1084.101) [-1084.426] (-1083.297) (-1084.382) -- 0:00:12
793000 -- (-1084.034) (-1085.917) [-1088.806] (-1085.888) * (-1083.952) (-1085.182) (-1083.393) [-1083.986] -- 0:00:12
793500 -- (-1085.055) (-1084.282) [-1084.584] (-1087.554) * [-1083.618] (-1086.722) (-1083.419) (-1085.933) -- 0:00:12
794000 -- (-1085.530) (-1085.588) [-1086.233] (-1085.253) * (-1083.466) (-1086.102) (-1088.365) [-1084.260] -- 0:00:12
794500 -- (-1085.782) [-1085.208] (-1085.884) (-1085.093) * (-1086.186) (-1085.980) (-1083.851) [-1085.911] -- 0:00:12
795000 -- (-1086.649) [-1084.037] (-1084.422) (-1085.006) * (-1083.293) (-1084.218) [-1083.135] (-1087.293) -- 0:00:12
Average standard deviation of split frequencies: 0.006712
795500 -- (-1087.598) [-1084.670] (-1084.396) (-1083.379) * [-1084.768] (-1089.971) (-1084.314) (-1088.325) -- 0:00:12
796000 -- (-1084.918) (-1085.806) [-1083.873] (-1084.231) * (-1085.597) (-1087.272) (-1084.384) [-1090.269] -- 0:00:12
796500 -- (-1084.762) (-1083.754) [-1083.702] (-1086.014) * (-1086.669) (-1086.678) (-1085.906) [-1087.374] -- 0:00:12
797000 -- (-1086.116) (-1084.068) (-1085.147) [-1084.559] * (-1083.311) (-1089.567) (-1086.937) [-1083.655] -- 0:00:12
797500 -- (-1086.491) (-1086.820) (-1085.332) [-1085.558] * (-1084.224) (-1086.345) [-1086.371] (-1084.318) -- 0:00:12
798000 -- (-1086.233) [-1083.202] (-1085.618) (-1086.651) * (-1085.585) [-1085.398] (-1085.630) (-1084.650) -- 0:00:12
798500 -- (-1086.510) (-1084.971) [-1088.131] (-1089.804) * [-1085.716] (-1084.069) (-1085.100) (-1084.527) -- 0:00:12
799000 -- [-1083.491] (-1086.236) (-1090.367) (-1085.850) * [-1088.158] (-1085.912) (-1084.483) (-1084.569) -- 0:00:12
799500 -- [-1089.604] (-1085.834) (-1086.428) (-1086.212) * [-1085.547] (-1084.895) (-1088.009) (-1085.493) -- 0:00:12
800000 -- (-1084.852) (-1083.811) (-1084.563) [-1087.404] * (-1086.654) (-1084.448) (-1088.792) [-1086.864] -- 0:00:12
Average standard deviation of split frequencies: 0.006947
800500 -- (-1085.334) (-1085.668) (-1085.247) [-1086.055] * [-1084.683] (-1083.536) (-1083.832) (-1088.380) -- 0:00:12
801000 -- (-1085.246) (-1084.529) (-1085.480) [-1083.737] * [-1083.871] (-1084.789) (-1084.770) (-1089.428) -- 0:00:12
801500 -- (-1086.326) [-1085.225] (-1083.552) (-1083.836) * [-1083.872] (-1085.765) (-1084.908) (-1088.272) -- 0:00:12
802000 -- (-1088.022) (-1084.570) [-1083.492] (-1085.799) * (-1083.451) [-1085.971] (-1086.490) (-1084.342) -- 0:00:12
802500 -- [-1083.572] (-1085.323) (-1086.809) (-1083.894) * [-1084.524] (-1084.846) (-1086.505) (-1084.780) -- 0:00:12
803000 -- (-1084.136) (-1088.425) (-1084.431) [-1085.696] * (-1084.723) (-1086.939) [-1088.052] (-1084.456) -- 0:00:12
803500 -- [-1084.469] (-1087.867) (-1085.829) (-1084.500) * (-1086.137) (-1086.304) [-1083.970] (-1086.146) -- 0:00:12
804000 -- (-1083.589) [-1087.355] (-1083.413) (-1093.880) * (-1085.684) (-1086.246) (-1085.925) [-1083.135] -- 0:00:12
804500 -- [-1085.001] (-1086.027) (-1088.625) (-1089.578) * (-1087.418) [-1083.698] (-1084.454) (-1086.304) -- 0:00:12
805000 -- (-1083.460) [-1087.202] (-1084.444) (-1085.928) * [-1083.828] (-1084.220) (-1084.346) (-1084.720) -- 0:00:12
Average standard deviation of split frequencies: 0.007057
805500 -- (-1085.445) (-1088.513) (-1085.577) [-1083.322] * (-1090.762) (-1084.722) [-1088.083] (-1083.422) -- 0:00:12
806000 -- [-1083.910] (-1086.834) (-1090.011) (-1084.020) * (-1085.810) (-1086.911) [-1083.267] (-1083.537) -- 0:00:12
806500 -- (-1083.453) (-1085.690) (-1085.907) [-1083.521] * (-1084.538) [-1085.512] (-1084.631) (-1084.771) -- 0:00:11
807000 -- (-1085.587) (-1085.559) [-1085.214] (-1084.223) * (-1083.640) (-1085.981) (-1085.816) [-1086.878] -- 0:00:11
807500 -- (-1086.754) (-1088.551) (-1085.333) [-1084.948] * (-1085.862) (-1085.077) [-1087.270] (-1084.250) -- 0:00:11
808000 -- [-1083.283] (-1085.270) (-1089.058) (-1087.299) * (-1083.414) (-1085.642) (-1087.563) [-1083.417] -- 0:00:11
808500 -- [-1085.710] (-1087.260) (-1084.528) (-1085.267) * [-1085.449] (-1084.423) (-1085.667) (-1085.871) -- 0:00:11
809000 -- (-1090.132) [-1083.894] (-1083.643) (-1085.086) * (-1086.400) [-1085.851] (-1083.902) (-1087.300) -- 0:00:11
809500 -- (-1090.008) [-1084.037] (-1084.421) (-1086.109) * (-1084.054) (-1085.922) [-1085.247] (-1085.430) -- 0:00:11
810000 -- (-1092.569) (-1083.933) [-1084.608] (-1083.633) * (-1087.554) (-1086.302) [-1088.010] (-1086.194) -- 0:00:11
Average standard deviation of split frequencies: 0.006978
810500 -- (-1087.583) (-1086.333) (-1086.116) [-1086.020] * [-1090.422] (-1089.057) (-1085.937) (-1084.810) -- 0:00:11
811000 -- (-1089.515) (-1086.192) (-1083.952) [-1083.645] * (-1087.837) (-1086.800) [-1084.310] (-1083.826) -- 0:00:11
811500 -- (-1084.323) [-1086.374] (-1083.330) (-1089.707) * (-1085.041) (-1085.004) (-1084.302) [-1084.052] -- 0:00:11
812000 -- (-1083.235) (-1083.279) [-1083.861] (-1084.239) * [-1084.932] (-1088.317) (-1086.521) (-1084.733) -- 0:00:11
812500 -- [-1083.831] (-1083.815) (-1085.427) (-1084.569) * [-1087.053] (-1084.981) (-1085.181) (-1085.061) -- 0:00:11
813000 -- [-1084.534] (-1087.939) (-1085.764) (-1087.748) * (-1083.706) (-1083.676) (-1083.801) [-1084.588] -- 0:00:11
813500 -- (-1085.003) (-1087.098) [-1083.791] (-1085.544) * (-1083.773) (-1084.159) [-1083.857] (-1084.189) -- 0:00:11
814000 -- [-1087.334] (-1087.014) (-1087.276) (-1086.109) * (-1084.138) [-1083.716] (-1086.542) (-1085.529) -- 0:00:11
814500 -- [-1085.901] (-1086.008) (-1084.326) (-1087.633) * (-1084.258) (-1085.919) [-1084.376] (-1084.987) -- 0:00:11
815000 -- [-1085.901] (-1086.259) (-1090.529) (-1083.289) * (-1083.734) (-1087.543) (-1084.689) [-1088.830] -- 0:00:11
Average standard deviation of split frequencies: 0.006393
815500 -- (-1085.739) (-1084.459) [-1083.298] (-1083.575) * [-1084.938] (-1088.204) (-1088.115) (-1084.033) -- 0:00:11
816000 -- [-1085.963] (-1086.347) (-1090.650) (-1083.954) * (-1085.408) (-1087.702) (-1085.332) [-1084.457] -- 0:00:11
816500 -- (-1085.853) (-1085.732) (-1087.022) [-1083.664] * (-1085.984) (-1086.259) (-1084.997) [-1085.188] -- 0:00:11
817000 -- (-1087.076) (-1084.098) [-1085.656] (-1083.824) * [-1084.580] (-1084.386) (-1085.314) (-1085.100) -- 0:00:11
817500 -- (-1086.838) [-1084.618] (-1087.872) (-1084.812) * (-1087.223) [-1084.356] (-1084.385) (-1084.001) -- 0:00:11
818000 -- (-1084.648) [-1086.002] (-1085.497) (-1089.610) * [-1088.490] (-1084.701) (-1088.665) (-1083.492) -- 0:00:11
818500 -- (-1085.775) (-1088.619) [-1083.341] (-1085.047) * (-1086.016) (-1084.791) [-1089.140] (-1085.777) -- 0:00:11
819000 -- (-1086.701) [-1084.626] (-1084.433) (-1083.869) * (-1088.700) (-1085.131) (-1090.368) [-1086.389] -- 0:00:11
819500 -- (-1088.966) (-1085.092) [-1086.574] (-1083.869) * [-1087.151] (-1085.632) (-1083.775) (-1085.025) -- 0:00:11
820000 -- [-1083.286] (-1084.261) (-1084.246) (-1083.602) * (-1087.305) (-1084.042) (-1083.768) [-1084.725] -- 0:00:11
Average standard deviation of split frequencies: 0.006855
820500 -- [-1085.411] (-1084.370) (-1085.806) (-1083.878) * [-1090.167] (-1083.769) (-1084.082) (-1083.939) -- 0:00:11
821000 -- [-1085.716] (-1083.954) (-1090.433) (-1090.123) * (-1085.181) (-1086.384) [-1083.689] (-1087.241) -- 0:00:11
821500 -- (-1085.465) (-1084.111) [-1084.666] (-1084.525) * (-1084.749) (-1089.042) [-1084.116] (-1084.230) -- 0:00:11
822000 -- (-1086.526) [-1087.402] (-1084.520) (-1087.147) * [-1085.469] (-1086.067) (-1083.909) (-1085.181) -- 0:00:11
822500 -- (-1090.377) [-1087.242] (-1084.786) (-1086.477) * (-1084.563) [-1088.414] (-1086.517) (-1083.928) -- 0:00:11
823000 -- (-1088.319) (-1084.544) (-1087.051) [-1086.385] * (-1089.061) [-1085.590] (-1084.737) (-1084.130) -- 0:00:10
823500 -- (-1084.264) (-1085.337) [-1085.377] (-1085.717) * [-1087.556] (-1084.523) (-1083.924) (-1084.620) -- 0:00:10
824000 -- [-1084.244] (-1086.108) (-1083.961) (-1086.204) * (-1084.080) (-1084.535) [-1085.984] (-1085.040) -- 0:00:10
824500 -- (-1084.908) (-1090.387) (-1083.531) [-1087.128] * (-1085.237) (-1087.152) [-1085.296] (-1086.971) -- 0:00:10
825000 -- [-1084.667] (-1085.055) (-1084.653) (-1083.717) * (-1085.159) (-1087.071) (-1085.488) [-1084.361] -- 0:00:10
Average standard deviation of split frequencies: 0.007115
825500 -- [-1084.346] (-1086.447) (-1085.302) (-1091.506) * [-1084.212] (-1084.828) (-1084.541) (-1086.983) -- 0:00:10
826000 -- (-1085.162) [-1084.624] (-1084.280) (-1094.572) * [-1083.935] (-1083.948) (-1085.093) (-1085.469) -- 0:00:10
826500 -- [-1083.990] (-1086.526) (-1083.600) (-1087.335) * [-1085.314] (-1086.390) (-1084.197) (-1084.660) -- 0:00:10
827000 -- [-1088.423] (-1084.869) (-1088.449) (-1084.064) * (-1085.217) (-1086.486) [-1086.108] (-1086.177) -- 0:00:10
827500 -- (-1085.878) (-1090.109) [-1084.784] (-1086.147) * (-1085.358) (-1090.095) [-1085.789] (-1088.446) -- 0:00:10
828000 -- (-1088.701) [-1085.170] (-1083.642) (-1085.536) * (-1085.040) (-1090.587) [-1085.260] (-1092.029) -- 0:00:10
828500 -- (-1084.940) (-1085.932) (-1084.064) [-1088.477] * [-1087.612] (-1084.745) (-1090.787) (-1084.721) -- 0:00:10
829000 -- (-1086.890) (-1084.447) (-1085.675) [-1085.825] * (-1085.132) (-1084.579) [-1088.524] (-1085.033) -- 0:00:10
829500 -- (-1086.814) [-1089.165] (-1086.686) (-1085.319) * [-1084.650] (-1086.284) (-1089.180) (-1084.561) -- 0:00:10
830000 -- (-1085.501) (-1086.045) [-1085.162] (-1084.951) * (-1087.012) (-1086.186) [-1083.157] (-1083.750) -- 0:00:10
Average standard deviation of split frequencies: 0.006848
830500 -- (-1084.160) (-1089.822) (-1083.821) [-1084.957] * (-1086.701) [-1084.359] (-1083.157) (-1083.600) -- 0:00:10
831000 -- (-1089.137) (-1086.288) [-1084.546] (-1084.842) * (-1087.287) (-1084.623) [-1083.058] (-1088.158) -- 0:00:10
831500 -- (-1086.229) (-1086.599) [-1084.142] (-1086.517) * (-1085.177) (-1085.973) [-1084.035] (-1089.207) -- 0:00:10
832000 -- (-1087.504) (-1086.233) [-1083.599] (-1085.121) * (-1085.162) (-1088.459) (-1083.651) [-1086.131] -- 0:00:10
832500 -- (-1086.597) (-1085.076) (-1085.091) [-1084.814] * (-1086.125) (-1085.699) [-1085.941] (-1085.719) -- 0:00:10
833000 -- (-1089.690) (-1083.134) [-1083.364] (-1086.454) * (-1085.532) (-1089.365) (-1087.839) [-1083.812] -- 0:00:10
833500 -- (-1085.230) (-1087.269) (-1087.518) [-1086.383] * (-1083.786) [-1085.889] (-1083.674) (-1084.224) -- 0:00:10
834000 -- (-1086.035) [-1084.580] (-1086.542) (-1083.682) * (-1083.754) (-1085.754) [-1083.647] (-1085.010) -- 0:00:10
834500 -- (-1083.936) [-1087.862] (-1085.817) (-1083.985) * (-1086.709) (-1084.348) [-1083.800] (-1084.015) -- 0:00:10
835000 -- [-1084.687] (-1087.540) (-1086.595) (-1085.030) * (-1083.625) [-1083.880] (-1086.726) (-1085.055) -- 0:00:10
Average standard deviation of split frequencies: 0.006691
835500 -- [-1086.673] (-1085.102) (-1092.498) (-1085.157) * (-1084.814) [-1085.152] (-1086.957) (-1085.347) -- 0:00:10
836000 -- [-1085.506] (-1084.459) (-1088.754) (-1088.224) * (-1084.715) (-1084.315) (-1088.421) [-1084.490] -- 0:00:10
836500 -- (-1084.524) (-1087.587) (-1087.394) [-1083.949] * (-1085.616) (-1083.239) (-1086.728) [-1084.207] -- 0:00:10
837000 -- (-1091.261) (-1089.039) [-1084.536] (-1087.380) * (-1086.437) (-1085.493) (-1087.961) [-1084.385] -- 0:00:10
837500 -- (-1087.631) (-1083.737) [-1086.457] (-1089.023) * (-1087.121) [-1084.273] (-1088.463) (-1087.441) -- 0:00:10
838000 -- (-1092.244) [-1086.620] (-1086.497) (-1083.955) * [-1086.077] (-1084.215) (-1086.796) (-1086.497) -- 0:00:10
838500 -- (-1087.730) (-1086.181) [-1084.511] (-1090.218) * (-1088.295) (-1086.621) [-1086.463] (-1086.114) -- 0:00:10
839000 -- [-1085.290] (-1083.760) (-1086.092) (-1084.527) * (-1088.140) (-1084.146) (-1088.008) [-1085.758] -- 0:00:09
839500 -- (-1084.998) (-1086.681) [-1084.946] (-1088.560) * [-1087.559] (-1084.163) (-1088.453) (-1084.336) -- 0:00:09
840000 -- (-1084.594) (-1086.140) (-1084.337) [-1087.839] * (-1091.233) [-1085.280] (-1089.325) (-1084.439) -- 0:00:09
Average standard deviation of split frequencies: 0.006841
840500 -- (-1086.617) (-1085.667) [-1084.568] (-1083.424) * (-1086.535) [-1083.892] (-1088.000) (-1083.773) -- 0:00:09
841000 -- (-1086.789) (-1087.741) [-1084.698] (-1086.430) * (-1085.645) (-1085.258) [-1087.927] (-1083.620) -- 0:00:09
841500 -- (-1084.793) (-1087.296) [-1084.985] (-1085.595) * [-1084.442] (-1086.777) (-1085.694) (-1084.629) -- 0:00:09
842000 -- (-1083.644) (-1085.066) (-1084.669) [-1085.003] * [-1083.632] (-1084.234) (-1085.027) (-1087.719) -- 0:00:09
842500 -- (-1085.837) (-1087.558) [-1085.897] (-1085.958) * (-1084.700) (-1083.478) [-1085.410] (-1084.980) -- 0:00:09
843000 -- (-1086.636) [-1086.635] (-1083.881) (-1087.723) * [-1088.947] (-1086.049) (-1084.721) (-1090.163) -- 0:00:09
843500 -- [-1086.114] (-1088.102) (-1084.619) (-1085.021) * (-1085.606) (-1088.602) [-1083.654] (-1088.704) -- 0:00:09
844000 -- (-1085.162) (-1083.841) (-1085.086) [-1087.756] * (-1088.910) (-1085.023) [-1084.458] (-1087.766) -- 0:00:09
844500 -- (-1087.760) [-1083.838] (-1085.520) (-1087.328) * (-1085.701) (-1083.502) (-1086.467) [-1086.144] -- 0:00:09
845000 -- (-1084.547) (-1084.369) (-1090.510) [-1087.337] * (-1083.927) (-1084.364) (-1084.758) [-1083.408] -- 0:00:09
Average standard deviation of split frequencies: 0.006761
845500 -- (-1086.353) (-1084.662) [-1084.999] (-1083.679) * (-1083.029) (-1083.739) (-1088.761) [-1085.289] -- 0:00:09
846000 -- (-1085.512) (-1084.729) (-1084.588) [-1083.369] * (-1084.672) (-1086.507) (-1087.933) [-1085.356] -- 0:00:09
846500 -- [-1083.503] (-1086.403) (-1088.061) (-1085.833) * (-1084.523) [-1084.313] (-1085.739) (-1085.275) -- 0:00:09
847000 -- (-1087.466) [-1083.829] (-1085.331) (-1084.525) * (-1089.122) (-1089.545) [-1085.814] (-1086.846) -- 0:00:09
847500 -- (-1086.654) (-1084.362) [-1086.279] (-1086.223) * [-1084.641] (-1083.861) (-1083.625) (-1086.766) -- 0:00:09
848000 -- (-1089.364) [-1088.365] (-1085.335) (-1089.301) * (-1083.355) (-1086.025) (-1083.609) [-1088.078] -- 0:00:09
848500 -- (-1088.546) [-1086.446] (-1084.756) (-1085.583) * (-1084.122) (-1086.854) [-1084.690] (-1086.080) -- 0:00:09
849000 -- (-1083.810) [-1085.794] (-1085.770) (-1088.195) * (-1084.259) [-1083.146] (-1085.806) (-1088.788) -- 0:00:09
849500 -- [-1085.778] (-1088.781) (-1085.342) (-1091.445) * [-1085.566] (-1083.789) (-1085.282) (-1086.681) -- 0:00:09
850000 -- (-1086.557) (-1085.624) [-1087.015] (-1083.470) * [-1088.429] (-1085.379) (-1085.595) (-1088.578) -- 0:00:09
Average standard deviation of split frequencies: 0.006502
850500 -- (-1083.989) [-1085.699] (-1085.674) (-1085.824) * (-1084.629) (-1087.824) [-1085.667] (-1084.470) -- 0:00:09
851000 -- [-1086.191] (-1087.213) (-1084.408) (-1087.436) * (-1084.427) (-1085.305) [-1087.731] (-1086.353) -- 0:00:09
851500 -- [-1084.059] (-1086.964) (-1084.899) (-1084.629) * [-1084.578] (-1083.814) (-1087.832) (-1084.975) -- 0:00:09
852000 -- (-1085.512) [-1086.766] (-1085.090) (-1083.422) * [-1084.763] (-1083.353) (-1085.604) (-1087.600) -- 0:00:09
852500 -- (-1085.667) [-1087.010] (-1090.263) (-1084.015) * (-1085.779) (-1086.045) [-1087.089] (-1085.475) -- 0:00:09
853000 -- (-1085.013) (-1086.389) (-1084.202) [-1089.522] * (-1084.312) (-1085.561) [-1085.416] (-1085.733) -- 0:00:09
853500 -- (-1085.972) [-1086.959] (-1085.641) (-1088.438) * (-1087.593) [-1086.707] (-1085.260) (-1086.170) -- 0:00:09
854000 -- (-1084.932) (-1084.617) (-1083.926) [-1086.512] * (-1090.179) (-1086.404) (-1085.967) [-1086.752] -- 0:00:09
854500 -- (-1084.158) [-1085.091] (-1083.967) (-1087.258) * (-1085.033) (-1085.358) [-1084.179] (-1087.292) -- 0:00:09
855000 -- (-1084.536) [-1086.427] (-1086.601) (-1086.171) * (-1084.136) [-1085.987] (-1083.607) (-1085.031) -- 0:00:08
Average standard deviation of split frequencies: 0.006939
855500 -- (-1084.706) (-1088.937) (-1086.223) [-1086.800] * [-1085.843] (-1088.603) (-1085.320) (-1086.357) -- 0:00:08
856000 -- [-1088.778] (-1086.069) (-1085.750) (-1087.072) * (-1085.383) (-1085.959) (-1085.373) [-1084.099] -- 0:00:08
856500 -- (-1090.732) (-1085.601) [-1084.686] (-1083.386) * [-1087.241] (-1085.091) (-1083.916) (-1085.956) -- 0:00:08
857000 -- (-1085.805) (-1083.314) [-1084.445] (-1087.256) * [-1085.973] (-1085.497) (-1087.145) (-1083.333) -- 0:00:08
857500 -- [-1085.695] (-1083.707) (-1088.303) (-1086.497) * (-1087.384) (-1086.841) [-1084.844] (-1083.275) -- 0:00:08
858000 -- [-1085.940] (-1085.901) (-1086.038) (-1086.764) * (-1086.869) (-1084.665) [-1086.272] (-1088.215) -- 0:00:08
858500 -- (-1083.560) [-1086.064] (-1085.819) (-1085.561) * [-1083.481] (-1086.394) (-1089.370) (-1087.931) -- 0:00:08
859000 -- (-1086.695) (-1089.910) [-1084.162] (-1085.969) * [-1087.847] (-1084.741) (-1089.970) (-1086.634) -- 0:00:08
859500 -- (-1089.192) (-1083.094) (-1085.800) [-1085.028] * (-1086.522) [-1086.660] (-1088.215) (-1085.702) -- 0:00:08
860000 -- (-1085.646) [-1084.025] (-1086.721) (-1090.257) * (-1083.899) (-1086.839) [-1083.384] (-1089.467) -- 0:00:08
Average standard deviation of split frequencies: 0.007157
860500 -- (-1084.033) (-1085.672) [-1085.088] (-1090.872) * (-1084.095) (-1085.704) [-1083.896] (-1091.868) -- 0:00:08
861000 -- (-1085.153) [-1083.477] (-1087.656) (-1087.686) * [-1086.765] (-1086.217) (-1084.276) (-1089.381) -- 0:00:08
861500 -- (-1084.131) [-1088.754] (-1086.072) (-1088.848) * [-1086.246] (-1087.693) (-1084.270) (-1086.683) -- 0:00:08
862000 -- [-1085.058] (-1083.283) (-1084.560) (-1084.516) * (-1083.882) (-1086.814) (-1086.736) [-1087.977] -- 0:00:08
862500 -- (-1085.882) [-1083.887] (-1086.755) (-1085.400) * (-1084.205) (-1086.604) [-1084.310] (-1084.272) -- 0:00:08
863000 -- (-1084.923) (-1085.408) (-1085.439) [-1083.968] * [-1084.714] (-1086.846) (-1084.916) (-1085.776) -- 0:00:08
863500 -- [-1090.370] (-1085.549) (-1085.930) (-1084.691) * (-1083.598) (-1085.251) [-1085.002] (-1084.471) -- 0:00:08
864000 -- (-1085.117) [-1086.911] (-1091.334) (-1084.400) * (-1085.549) (-1084.894) [-1084.142] (-1085.012) -- 0:00:08
864500 -- (-1086.110) [-1083.796] (-1088.740) (-1087.342) * [-1086.173] (-1086.697) (-1083.603) (-1090.236) -- 0:00:08
865000 -- [-1085.277] (-1085.959) (-1084.002) (-1088.202) * (-1084.132) (-1085.844) (-1090.805) [-1085.603] -- 0:00:08
Average standard deviation of split frequencies: 0.007294
865500 -- (-1086.942) [-1086.266] (-1083.911) (-1086.354) * (-1084.684) [-1085.366] (-1091.983) (-1087.703) -- 0:00:08
866000 -- (-1085.229) [-1086.517] (-1084.465) (-1085.553) * (-1083.867) [-1087.056] (-1091.795) (-1085.134) -- 0:00:08
866500 -- (-1087.996) (-1087.004) (-1084.946) [-1083.423] * (-1084.967) [-1085.375] (-1084.110) (-1084.845) -- 0:00:08
867000 -- (-1084.849) (-1086.876) [-1084.964] (-1083.224) * [-1084.790] (-1086.512) (-1085.387) (-1087.927) -- 0:00:08
867500 -- (-1085.441) (-1089.477) [-1083.166] (-1083.495) * (-1083.880) (-1085.103) (-1085.142) [-1087.221] -- 0:00:08
868000 -- (-1086.200) (-1083.972) (-1089.110) [-1086.736] * (-1083.867) [-1084.544] (-1086.229) (-1084.513) -- 0:00:08
868500 -- (-1084.078) (-1084.908) (-1087.609) [-1084.761] * [-1087.714] (-1083.401) (-1086.050) (-1084.467) -- 0:00:08
869000 -- (-1084.916) [-1084.689] (-1084.108) (-1083.847) * (-1090.368) [-1084.653] (-1084.594) (-1083.220) -- 0:00:08
869500 -- (-1084.875) (-1085.795) (-1083.445) [-1083.713] * (-1088.442) (-1084.005) [-1083.414] (-1083.706) -- 0:00:08
870000 -- (-1090.218) (-1084.373) (-1086.158) [-1085.603] * (-1088.329) [-1084.174] (-1083.785) (-1083.879) -- 0:00:08
Average standard deviation of split frequencies: 0.007183
870500 -- (-1087.639) [-1086.229] (-1084.515) (-1084.310) * (-1091.605) (-1083.726) (-1084.014) [-1085.123] -- 0:00:08
871000 -- (-1089.744) (-1087.354) [-1090.639] (-1084.606) * (-1091.638) (-1086.282) [-1084.412] (-1084.164) -- 0:00:07
871500 -- (-1085.777) (-1088.912) (-1087.052) [-1083.996] * (-1086.514) (-1085.021) (-1084.992) [-1084.208] -- 0:00:07
872000 -- (-1083.059) [-1088.778] (-1084.580) (-1084.193) * (-1086.558) (-1085.867) (-1087.194) [-1086.080] -- 0:00:07
872500 -- (-1083.257) (-1091.308) (-1083.640) [-1086.691] * [-1084.751] (-1089.033) (-1086.908) (-1085.642) -- 0:00:07
873000 -- (-1084.406) (-1087.157) (-1084.509) [-1085.364] * (-1086.471) [-1084.257] (-1086.838) (-1087.323) -- 0:00:07
873500 -- (-1084.196) (-1087.470) [-1083.872] (-1086.275) * (-1084.989) [-1083.476] (-1086.749) (-1087.282) -- 0:00:07
874000 -- (-1085.551) (-1085.540) (-1084.754) [-1085.352] * [-1085.470] (-1086.350) (-1087.704) (-1085.589) -- 0:00:07
874500 -- (-1087.974) [-1085.310] (-1086.308) (-1086.439) * (-1085.870) (-1084.878) (-1086.554) [-1085.759] -- 0:00:07
875000 -- (-1085.505) [-1084.589] (-1086.274) (-1085.085) * [-1085.213] (-1087.864) (-1087.336) (-1088.577) -- 0:00:07
Average standard deviation of split frequencies: 0.007713
875500 -- (-1084.512) (-1084.556) [-1090.850] (-1087.179) * (-1085.558) (-1087.235) (-1086.632) [-1090.646] -- 0:00:07
876000 -- [-1083.561] (-1085.913) (-1086.057) (-1088.818) * (-1087.173) (-1089.054) (-1083.400) [-1084.539] -- 0:00:07
876500 -- (-1083.354) [-1085.935] (-1083.859) (-1085.496) * (-1088.589) (-1084.248) (-1086.847) [-1086.774] -- 0:00:07
877000 -- [-1083.306] (-1084.240) (-1084.560) (-1086.359) * (-1087.902) [-1084.064] (-1091.875) (-1085.203) -- 0:00:07
877500 -- (-1086.175) (-1084.134) [-1084.705] (-1094.016) * (-1086.648) (-1083.351) [-1092.624] (-1084.688) -- 0:00:07
878000 -- [-1086.127] (-1084.676) (-1084.828) (-1085.602) * (-1084.775) (-1083.606) [-1085.172] (-1087.113) -- 0:00:07
878500 -- (-1087.535) [-1085.524] (-1085.768) (-1085.290) * (-1084.784) [-1088.917] (-1086.421) (-1085.274) -- 0:00:07
879000 -- (-1083.305) (-1087.352) (-1084.395) [-1084.446] * (-1089.808) (-1085.261) (-1085.037) [-1086.646] -- 0:00:07
879500 -- [-1085.971] (-1086.706) (-1084.851) (-1083.938) * (-1084.466) (-1084.675) (-1087.872) [-1085.816] -- 0:00:07
880000 -- [-1085.355] (-1086.477) (-1088.682) (-1084.776) * (-1084.101) [-1085.628] (-1084.806) (-1084.351) -- 0:00:07
Average standard deviation of split frequencies: 0.007423
880500 -- (-1085.345) [-1083.625] (-1084.943) (-1088.414) * [-1083.224] (-1085.840) (-1084.922) (-1085.396) -- 0:00:07
881000 -- [-1087.055] (-1090.560) (-1084.213) (-1090.476) * (-1084.020) [-1085.094] (-1085.478) (-1085.945) -- 0:00:07
881500 -- (-1085.963) (-1085.209) [-1083.502] (-1084.341) * [-1085.466] (-1084.169) (-1084.320) (-1087.826) -- 0:00:07
882000 -- (-1085.689) [-1083.975] (-1083.571) (-1084.332) * (-1086.503) (-1083.698) [-1084.236] (-1085.350) -- 0:00:07
882500 -- (-1086.804) (-1084.722) (-1086.614) [-1084.795] * [-1086.478] (-1084.468) (-1083.369) (-1084.529) -- 0:00:07
883000 -- (-1088.135) (-1086.979) [-1084.400] (-1085.486) * (-1084.631) (-1086.578) (-1085.386) [-1085.266] -- 0:00:07
883500 -- (-1087.561) (-1085.438) [-1085.400] (-1083.289) * (-1087.352) (-1085.464) [-1083.202] (-1084.970) -- 0:00:07
884000 -- (-1085.862) [-1084.127] (-1088.852) (-1084.081) * (-1091.531) (-1088.455) (-1084.220) [-1085.987] -- 0:00:07
884500 -- (-1084.263) [-1086.028] (-1086.497) (-1084.304) * (-1084.788) [-1085.303] (-1088.162) (-1084.839) -- 0:00:07
885000 -- (-1084.925) [-1086.338] (-1088.468) (-1083.366) * [-1086.751] (-1087.691) (-1086.816) (-1084.839) -- 0:00:07
Average standard deviation of split frequencies: 0.007271
885500 -- (-1086.753) [-1083.402] (-1090.656) (-1086.236) * (-1085.867) (-1089.571) [-1087.044] (-1083.996) -- 0:00:07
886000 -- (-1085.641) (-1084.383) (-1092.269) [-1085.430] * (-1086.069) (-1085.660) [-1085.658] (-1087.893) -- 0:00:07
886500 -- (-1086.303) [-1086.520] (-1085.925) (-1083.336) * [-1086.018] (-1084.846) (-1085.508) (-1086.498) -- 0:00:07
887000 -- [-1083.675] (-1085.171) (-1086.380) (-1083.540) * (-1084.803) (-1084.546) (-1084.756) [-1085.268] -- 0:00:07
887500 -- (-1086.954) (-1085.679) [-1087.847] (-1083.450) * (-1087.820) (-1085.505) [-1086.432] (-1085.908) -- 0:00:06
888000 -- (-1084.327) [-1084.726] (-1088.684) (-1084.916) * (-1082.995) (-1086.047) [-1084.673] (-1084.180) -- 0:00:06
888500 -- (-1084.375) (-1084.554) (-1084.358) [-1083.315] * [-1084.300] (-1085.902) (-1088.808) (-1090.437) -- 0:00:06
889000 -- [-1085.649] (-1087.349) (-1085.381) (-1083.531) * (-1087.825) (-1085.003) [-1086.256] (-1083.375) -- 0:00:06
889500 -- (-1086.495) (-1086.435) [-1083.267] (-1084.279) * (-1085.000) [-1085.437] (-1088.063) (-1090.482) -- 0:00:06
890000 -- (-1084.977) [-1086.631] (-1084.290) (-1085.754) * [-1083.533] (-1084.522) (-1086.966) (-1083.569) -- 0:00:06
Average standard deviation of split frequencies: 0.007163
890500 -- (-1086.488) (-1085.850) (-1084.900) [-1089.326] * (-1087.358) (-1085.899) (-1089.138) [-1083.961] -- 0:00:06
891000 -- (-1086.326) (-1086.101) (-1085.073) [-1088.167] * [-1086.451] (-1083.887) (-1086.976) (-1087.498) -- 0:00:06
891500 -- (-1085.722) (-1086.058) (-1087.093) [-1085.539] * (-1084.080) [-1083.252] (-1085.521) (-1087.298) -- 0:00:06
892000 -- (-1084.526) (-1085.639) (-1087.083) [-1084.055] * (-1083.592) (-1083.759) (-1083.394) [-1084.074] -- 0:00:06
892500 -- (-1084.435) (-1086.091) [-1084.959] (-1085.417) * (-1084.576) [-1083.737] (-1085.413) (-1083.980) -- 0:00:06
893000 -- (-1085.282) [-1086.778] (-1086.987) (-1084.093) * (-1086.809) (-1083.704) [-1087.368] (-1083.594) -- 0:00:06
893500 -- (-1085.296) (-1085.284) [-1085.826] (-1084.824) * [-1083.455] (-1083.588) (-1085.912) (-1083.622) -- 0:00:06
894000 -- (-1087.643) [-1087.674] (-1084.925) (-1085.621) * (-1084.759) (-1083.246) (-1083.706) [-1083.387] -- 0:00:06
894500 -- [-1087.474] (-1084.500) (-1084.246) (-1087.744) * (-1085.313) (-1084.883) (-1084.704) [-1088.043] -- 0:00:06
895000 -- (-1086.941) [-1083.680] (-1085.714) (-1084.505) * (-1090.095) [-1084.608] (-1086.584) (-1086.322) -- 0:00:06
Average standard deviation of split frequencies: 0.006769
895500 -- [-1086.634] (-1087.993) (-1084.581) (-1090.543) * (-1086.289) [-1085.448] (-1085.949) (-1085.180) -- 0:00:06
896000 -- [-1085.120] (-1084.284) (-1085.457) (-1084.435) * (-1090.167) (-1085.846) (-1085.669) [-1085.524] -- 0:00:06
896500 -- (-1084.011) (-1086.231) [-1087.801] (-1084.146) * (-1089.312) [-1086.044] (-1084.677) (-1091.324) -- 0:00:06
897000 -- [-1088.751] (-1084.268) (-1086.840) (-1085.826) * (-1087.672) (-1086.718) [-1085.424] (-1087.766) -- 0:00:06
897500 -- (-1085.328) [-1084.338] (-1084.702) (-1089.478) * (-1083.133) [-1086.157] (-1086.296) (-1085.915) -- 0:00:06
898000 -- (-1090.612) [-1083.285] (-1083.999) (-1086.634) * (-1087.063) (-1083.556) [-1087.871] (-1083.979) -- 0:00:06
898500 -- (-1086.377) [-1083.112] (-1084.094) (-1085.830) * (-1085.040) (-1084.071) (-1088.290) [-1087.051] -- 0:00:06
899000 -- (-1088.944) (-1087.743) (-1084.349) [-1084.730] * [-1085.458] (-1086.268) (-1089.477) (-1089.849) -- 0:00:06
899500 -- (-1089.286) (-1084.338) (-1086.272) [-1088.217] * (-1084.074) [-1089.064] (-1086.976) (-1086.748) -- 0:00:06
900000 -- (-1084.773) [-1089.177] (-1086.914) (-1088.116) * [-1083.671] (-1088.719) (-1089.395) (-1086.709) -- 0:00:06
Average standard deviation of split frequencies: 0.007153
900500 -- (-1084.813) (-1090.417) (-1085.136) [-1086.407] * (-1083.671) (-1084.516) [-1087.747] (-1087.118) -- 0:00:06
901000 -- (-1084.208) (-1087.351) (-1086.444) [-1084.283] * (-1086.151) [-1086.279] (-1086.849) (-1084.738) -- 0:00:06
901500 -- [-1084.733] (-1086.699) (-1083.973) (-1084.164) * (-1083.804) [-1086.219] (-1086.977) (-1086.321) -- 0:00:06
902000 -- (-1083.794) (-1083.522) (-1084.096) [-1085.938] * (-1083.462) (-1088.033) (-1084.888) [-1083.781] -- 0:00:06
902500 -- (-1085.428) (-1083.828) (-1084.806) [-1087.483] * [-1083.518] (-1085.283) (-1087.563) (-1086.425) -- 0:00:06
903000 -- (-1085.528) (-1088.099) (-1084.105) [-1085.108] * [-1087.508] (-1085.069) (-1085.785) (-1083.409) -- 0:00:06
903500 -- (-1088.365) [-1084.286] (-1086.315) (-1087.558) * [-1085.291] (-1087.472) (-1089.861) (-1085.241) -- 0:00:05
904000 -- (-1085.038) [-1084.265] (-1083.621) (-1087.506) * (-1084.188) (-1087.054) [-1084.576] (-1084.090) -- 0:00:05
904500 -- [-1083.534] (-1084.227) (-1084.701) (-1087.786) * (-1084.783) [-1084.211] (-1085.643) (-1084.413) -- 0:00:05
905000 -- (-1087.412) (-1085.940) [-1088.029] (-1086.510) * [-1085.242] (-1085.685) (-1084.681) (-1092.946) -- 0:00:05
Average standard deviation of split frequencies: 0.006903
905500 -- (-1089.695) (-1087.327) (-1085.069) [-1084.856] * [-1085.286] (-1083.619) (-1084.569) (-1086.078) -- 0:00:05
906000 -- (-1091.997) [-1086.000] (-1088.044) (-1084.495) * [-1084.771] (-1084.101) (-1083.766) (-1083.960) -- 0:00:05
906500 -- (-1085.883) (-1083.640) [-1087.522] (-1085.912) * (-1084.639) (-1084.731) (-1085.428) [-1083.471] -- 0:00:05
907000 -- (-1084.756) (-1084.628) [-1088.904] (-1087.098) * (-1086.312) (-1084.224) (-1083.429) [-1085.025] -- 0:00:05
907500 -- (-1087.436) (-1083.476) (-1086.122) [-1086.986] * (-1088.409) [-1083.748] (-1084.031) (-1085.233) -- 0:00:05
908000 -- (-1086.305) (-1084.249) [-1085.483] (-1087.995) * (-1084.448) (-1083.888) (-1089.279) [-1086.492] -- 0:00:05
908500 -- (-1085.063) [-1084.735] (-1086.359) (-1083.989) * [-1085.746] (-1086.197) (-1088.729) (-1084.950) -- 0:00:05
909000 -- (-1085.922) [-1084.436] (-1084.977) (-1088.352) * (-1085.053) (-1086.046) (-1089.328) [-1087.077] -- 0:00:05
909500 -- (-1085.392) (-1085.548) (-1085.699) [-1086.957] * (-1086.933) (-1084.231) [-1086.348] (-1091.023) -- 0:00:05
910000 -- (-1083.283) [-1083.766] (-1085.075) (-1086.648) * (-1088.608) [-1085.080] (-1084.539) (-1087.489) -- 0:00:05
Average standard deviation of split frequencies: 0.006729
910500 -- (-1084.236) [-1084.146] (-1086.295) (-1086.379) * (-1084.518) (-1085.397) [-1086.178] (-1083.819) -- 0:00:05
911000 -- [-1085.870] (-1086.307) (-1087.611) (-1087.696) * (-1085.324) (-1087.378) (-1087.486) [-1083.527] -- 0:00:05
911500 -- [-1084.622] (-1085.105) (-1088.189) (-1088.793) * (-1084.897) (-1087.084) (-1085.691) [-1083.677] -- 0:00:05
912000 -- (-1084.638) [-1084.385] (-1085.215) (-1094.193) * (-1086.154) (-1088.045) (-1083.168) [-1083.465] -- 0:00:05
912500 -- (-1088.528) (-1085.351) [-1086.414] (-1084.613) * [-1085.448] (-1085.334) (-1083.168) (-1084.243) -- 0:00:05
913000 -- (-1083.768) [-1084.743] (-1089.803) (-1086.066) * (-1085.614) (-1083.578) (-1084.544) [-1086.314] -- 0:00:05
913500 -- (-1085.739) (-1087.131) (-1088.356) [-1087.998] * (-1085.854) [-1083.275] (-1084.254) (-1083.827) -- 0:00:05
914000 -- (-1084.971) (-1084.390) [-1084.319] (-1089.260) * (-1089.962) (-1085.344) (-1089.094) [-1084.681] -- 0:00:05
914500 -- (-1088.085) [-1085.372] (-1084.684) (-1086.830) * (-1087.875) (-1085.540) (-1087.191) [-1085.793] -- 0:00:05
915000 -- (-1084.573) [-1085.131] (-1084.963) (-1086.657) * [-1085.217] (-1086.100) (-1087.427) (-1084.621) -- 0:00:05
Average standard deviation of split frequencies: 0.006690
915500 -- (-1087.039) (-1083.921) (-1085.952) [-1088.776] * (-1085.502) (-1086.252) (-1085.393) [-1084.561] -- 0:00:05
916000 -- (-1085.138) [-1083.774] (-1087.753) (-1084.839) * (-1085.493) [-1084.507] (-1085.393) (-1086.381) -- 0:00:05
916500 -- (-1087.342) (-1083.516) (-1084.613) [-1085.144] * [-1083.553] (-1086.657) (-1085.197) (-1086.622) -- 0:00:05
917000 -- (-1087.462) (-1084.554) (-1084.479) [-1085.039] * [-1083.554] (-1083.507) (-1085.449) (-1084.961) -- 0:00:05
917500 -- (-1088.917) [-1084.623] (-1088.370) (-1087.230) * (-1083.501) [-1083.709] (-1086.031) (-1090.773) -- 0:00:05
918000 -- [-1084.670] (-1084.427) (-1086.155) (-1085.366) * [-1082.991] (-1084.599) (-1084.739) (-1088.070) -- 0:00:05
918500 -- [-1086.760] (-1084.834) (-1085.066) (-1085.083) * (-1085.291) (-1084.389) [-1084.841] (-1084.158) -- 0:00:05
919000 -- [-1083.232] (-1083.929) (-1083.393) (-1089.433) * (-1084.571) (-1083.487) [-1086.419] (-1084.207) -- 0:00:05
919500 -- (-1084.402) (-1084.723) (-1090.645) [-1084.845] * [-1086.098] (-1085.613) (-1085.899) (-1085.388) -- 0:00:04
920000 -- [-1085.662] (-1085.017) (-1084.383) (-1088.243) * (-1084.193) (-1089.104) (-1085.883) [-1083.383] -- 0:00:04
Average standard deviation of split frequencies: 0.007066
920500 -- (-1086.864) [-1086.905] (-1085.114) (-1085.691) * (-1089.846) (-1087.655) [-1083.520] (-1084.403) -- 0:00:04
921000 -- (-1087.710) (-1083.749) (-1084.728) [-1086.335] * (-1085.288) [-1085.217] (-1086.301) (-1087.506) -- 0:00:04
921500 -- (-1085.286) [-1086.876] (-1088.622) (-1086.037) * (-1089.820) (-1083.860) (-1089.350) [-1087.682] -- 0:00:04
922000 -- [-1083.571] (-1085.867) (-1085.939) (-1084.604) * [-1085.438] (-1085.186) (-1088.829) (-1083.486) -- 0:00:04
922500 -- (-1085.755) (-1087.581) (-1084.934) [-1085.380] * (-1088.250) (-1084.194) (-1087.115) [-1087.001] -- 0:00:04
923000 -- [-1084.124] (-1083.486) (-1087.292) (-1084.848) * (-1084.521) (-1084.377) (-1087.308) [-1089.434] -- 0:00:04
923500 -- (-1088.250) [-1085.900] (-1088.085) (-1084.945) * (-1085.626) (-1086.189) [-1083.230] (-1087.206) -- 0:00:04
924000 -- (-1087.745) (-1084.051) [-1083.952] (-1085.615) * (-1083.806) (-1088.037) [-1085.797] (-1088.866) -- 0:00:04
924500 -- (-1083.923) (-1084.548) (-1083.809) [-1085.562] * [-1083.789] (-1084.945) (-1085.892) (-1085.872) -- 0:00:04
925000 -- (-1083.957) [-1084.529] (-1087.098) (-1085.640) * (-1085.333) [-1085.489] (-1083.713) (-1090.276) -- 0:00:04
Average standard deviation of split frequencies: 0.006788
925500 -- (-1087.551) (-1084.794) [-1085.623] (-1085.886) * (-1084.015) (-1084.164) (-1083.690) [-1088.550] -- 0:00:04
926000 -- (-1083.315) [-1084.757] (-1087.268) (-1085.597) * (-1085.343) (-1084.897) (-1085.249) [-1084.200] -- 0:00:04
926500 -- (-1084.012) (-1085.979) [-1084.899] (-1087.102) * (-1084.465) [-1084.287] (-1083.618) (-1090.244) -- 0:00:04
927000 -- [-1084.715] (-1091.814) (-1085.294) (-1086.223) * (-1085.064) [-1083.507] (-1084.448) (-1086.613) -- 0:00:04
927500 -- [-1083.750] (-1084.719) (-1085.825) (-1086.588) * [-1085.179] (-1085.510) (-1084.834) (-1086.710) -- 0:00:04
928000 -- (-1084.327) (-1086.570) (-1084.760) [-1084.948] * [-1084.685] (-1086.385) (-1083.881) (-1084.801) -- 0:00:04
928500 -- (-1085.339) (-1087.617) (-1087.101) [-1085.117] * [-1083.489] (-1087.016) (-1084.576) (-1085.415) -- 0:00:04
929000 -- (-1084.224) (-1086.773) [-1083.311] (-1086.075) * (-1085.935) [-1085.792] (-1085.012) (-1087.573) -- 0:00:04
929500 -- (-1083.974) (-1088.335) [-1083.578] (-1087.602) * (-1085.404) [-1086.839] (-1084.845) (-1087.629) -- 0:00:04
930000 -- (-1084.285) (-1084.293) [-1083.409] (-1085.109) * (-1085.143) (-1087.244) [-1086.329] (-1091.583) -- 0:00:04
Average standard deviation of split frequencies: 0.006348
930500 -- (-1083.570) [-1087.493] (-1084.639) (-1086.218) * (-1086.755) [-1084.119] (-1086.448) (-1085.477) -- 0:00:04
931000 -- [-1086.615] (-1088.376) (-1086.749) (-1086.403) * [-1087.550] (-1083.889) (-1085.531) (-1085.307) -- 0:00:04
931500 -- (-1089.194) (-1087.248) (-1084.894) [-1085.378] * (-1085.450) (-1085.459) (-1083.752) [-1084.285] -- 0:00:04
932000 -- (-1085.448) (-1085.366) [-1087.089] (-1090.332) * (-1083.948) [-1084.795] (-1083.842) (-1083.028) -- 0:00:04
932500 -- (-1086.747) (-1085.237) (-1086.931) [-1085.405] * (-1083.531) [-1084.188] (-1083.879) (-1086.265) -- 0:00:04
933000 -- (-1086.261) (-1084.874) (-1090.248) [-1084.636] * [-1090.798] (-1088.260) (-1084.278) (-1089.097) -- 0:00:04
933500 -- (-1090.408) (-1085.526) (-1084.719) [-1088.209] * [-1084.157] (-1086.321) (-1083.904) (-1088.702) -- 0:00:04
934000 -- (-1087.611) [-1085.144] (-1083.832) (-1091.059) * [-1083.480] (-1088.123) (-1086.267) (-1089.920) -- 0:00:04
934500 -- (-1086.939) [-1090.996] (-1086.581) (-1084.196) * [-1083.674] (-1084.386) (-1085.423) (-1083.540) -- 0:00:04
935000 -- [-1084.529] (-1087.340) (-1087.276) (-1083.939) * (-1084.077) [-1084.290] (-1085.072) (-1083.792) -- 0:00:04
Average standard deviation of split frequencies: 0.006514
935500 -- (-1083.732) (-1083.726) [-1086.277] (-1085.219) * [-1084.019] (-1083.810) (-1085.493) (-1083.866) -- 0:00:03
936000 -- (-1085.078) (-1085.554) [-1083.943] (-1085.755) * (-1084.198) (-1086.752) [-1085.347] (-1085.419) -- 0:00:03
936500 -- (-1084.612) (-1087.283) (-1086.153) [-1085.640] * (-1087.363) [-1087.638] (-1089.838) (-1085.695) -- 0:00:03
937000 -- (-1085.052) (-1088.989) [-1085.462] (-1086.163) * (-1089.402) (-1084.873) [-1084.631] (-1084.212) -- 0:00:03
937500 -- (-1084.968) [-1084.879] (-1086.156) (-1083.330) * (-1084.120) [-1085.230] (-1085.747) (-1083.296) -- 0:00:03
938000 -- (-1087.209) (-1085.166) (-1083.983) [-1084.120] * [-1084.786] (-1083.578) (-1085.543) (-1086.059) -- 0:00:03
938500 -- (-1083.721) [-1084.109] (-1084.185) (-1083.718) * (-1085.551) [-1084.139] (-1085.246) (-1086.499) -- 0:00:03
939000 -- (-1084.137) (-1088.953) [-1084.766] (-1083.323) * [-1088.294] (-1091.727) (-1085.673) (-1086.468) -- 0:00:03
939500 -- (-1085.207) (-1086.581) (-1086.618) [-1083.322] * [-1085.128] (-1084.289) (-1084.855) (-1084.681) -- 0:00:03
940000 -- (-1085.687) [-1084.139] (-1084.550) (-1085.207) * (-1084.379) (-1085.166) (-1084.193) [-1085.141] -- 0:00:03
Average standard deviation of split frequencies: 0.006181
940500 -- [-1085.634] (-1083.395) (-1085.230) (-1087.148) * [-1085.224] (-1083.994) (-1083.312) (-1085.401) -- 0:00:03
941000 -- (-1084.269) [-1085.250] (-1083.831) (-1087.017) * (-1085.121) (-1083.738) (-1086.712) [-1085.401] -- 0:00:03
941500 -- (-1085.743) (-1085.869) (-1086.814) [-1085.333] * [-1084.690] (-1088.712) (-1086.228) (-1084.995) -- 0:00:03
942000 -- (-1086.995) [-1084.039] (-1085.883) (-1084.455) * (-1084.021) [-1086.893] (-1085.239) (-1086.140) -- 0:00:03
942500 -- (-1088.686) (-1086.869) (-1084.433) [-1087.587] * (-1087.422) (-1085.580) (-1084.634) [-1083.864] -- 0:00:03
943000 -- (-1084.909) [-1085.442] (-1090.197) (-1086.681) * (-1087.187) (-1085.736) (-1083.954) [-1084.253] -- 0:00:03
943500 -- (-1084.293) [-1084.309] (-1086.398) (-1084.980) * [-1084.990] (-1086.781) (-1084.727) (-1084.104) -- 0:00:03
944000 -- [-1087.118] (-1085.472) (-1083.974) (-1085.069) * (-1087.637) [-1088.025] (-1084.684) (-1083.232) -- 0:00:03
944500 -- [-1085.137] (-1085.308) (-1085.095) (-1084.721) * [-1086.007] (-1089.019) (-1088.690) (-1083.356) -- 0:00:03
945000 -- (-1083.906) (-1086.094) (-1083.826) [-1086.614] * [-1083.975] (-1086.150) (-1087.701) (-1084.158) -- 0:00:03
Average standard deviation of split frequencies: 0.006677
945500 -- (-1086.056) (-1085.669) [-1084.906] (-1084.873) * (-1087.017) (-1085.853) (-1089.191) [-1083.994] -- 0:00:03
946000 -- (-1086.894) (-1086.823) [-1085.777] (-1083.860) * [-1084.469] (-1088.535) (-1084.117) (-1083.996) -- 0:00:03
946500 -- (-1084.854) [-1085.386] (-1085.936) (-1086.224) * (-1084.068) (-1085.397) [-1084.576] (-1086.059) -- 0:00:03
947000 -- (-1089.496) (-1085.436) [-1084.466] (-1086.135) * (-1084.486) (-1087.770) [-1092.988] (-1085.829) -- 0:00:03
947500 -- [-1085.754] (-1086.006) (-1083.770) (-1086.207) * (-1084.217) (-1087.690) (-1086.908) [-1084.758] -- 0:00:03
948000 -- (-1085.121) [-1085.280] (-1086.396) (-1084.468) * (-1084.200) (-1088.272) (-1084.707) [-1083.787] -- 0:00:03
948500 -- (-1085.247) [-1083.591] (-1083.456) (-1083.276) * (-1087.218) (-1085.577) [-1087.175] (-1085.217) -- 0:00:03
949000 -- (-1084.714) (-1083.219) (-1084.060) [-1088.511] * (-1085.692) (-1084.877) (-1090.106) [-1086.418] -- 0:00:03
949500 -- (-1084.570) (-1086.502) (-1089.125) [-1084.423] * (-1085.524) (-1083.877) [-1084.586] (-1085.913) -- 0:00:03
950000 -- (-1084.481) [-1083.980] (-1083.709) (-1084.916) * (-1085.600) [-1083.556] (-1087.054) (-1086.944) -- 0:00:03
Average standard deviation of split frequencies: 0.006777
950500 -- (-1084.525) [-1084.559] (-1085.219) (-1086.516) * (-1093.413) [-1085.474] (-1086.057) (-1084.563) -- 0:00:03
951000 -- (-1084.633) (-1085.024) [-1084.664] (-1087.167) * (-1090.986) (-1086.266) [-1084.812] (-1085.525) -- 0:00:03
951500 -- [-1085.249] (-1089.091) (-1084.903) (-1088.116) * (-1085.653) (-1084.890) [-1088.015] (-1087.580) -- 0:00:03
952000 -- (-1087.963) [-1089.373] (-1084.299) (-1085.959) * (-1084.258) [-1085.558] (-1089.523) (-1089.414) -- 0:00:02
952500 -- (-1083.668) (-1086.214) (-1084.708) [-1085.474] * (-1084.388) [-1084.455] (-1085.327) (-1084.625) -- 0:00:02
953000 -- (-1086.536) [-1084.499] (-1088.519) (-1085.866) * [-1087.499] (-1085.099) (-1087.973) (-1085.765) -- 0:00:02
953500 -- (-1084.391) [-1084.901] (-1086.236) (-1085.398) * (-1087.408) [-1087.475] (-1086.357) (-1087.383) -- 0:00:02
954000 -- [-1084.531] (-1083.981) (-1085.017) (-1085.145) * [-1085.407] (-1084.373) (-1086.541) (-1085.614) -- 0:00:02
954500 -- (-1087.936) (-1085.705) (-1089.539) [-1086.090] * (-1086.655) (-1085.787) (-1088.299) [-1085.106] -- 0:00:02
955000 -- (-1085.739) (-1093.933) (-1089.097) [-1084.368] * (-1083.829) (-1084.351) [-1084.981] (-1086.625) -- 0:00:02
Average standard deviation of split frequencies: 0.006673
955500 -- [-1085.357] (-1088.322) (-1084.644) (-1084.594) * [-1084.300] (-1084.432) (-1086.488) (-1084.005) -- 0:00:02
956000 -- (-1084.165) (-1088.749) (-1085.438) [-1085.426] * [-1084.395] (-1085.149) (-1084.423) (-1086.217) -- 0:00:02
956500 -- (-1085.276) [-1086.130] (-1085.795) (-1086.786) * (-1084.841) [-1085.597] (-1084.450) (-1085.286) -- 0:00:02
957000 -- (-1086.401) (-1085.701) [-1086.161] (-1085.850) * (-1085.102) (-1088.110) (-1086.410) [-1083.831] -- 0:00:02
957500 -- (-1086.018) [-1086.758] (-1093.073) (-1084.674) * [-1087.654] (-1086.778) (-1087.521) (-1083.813) -- 0:00:02
958000 -- (-1085.617) (-1086.813) (-1090.515) [-1085.318] * (-1085.493) [-1084.492] (-1084.082) (-1084.403) -- 0:00:02
958500 -- (-1086.844) (-1088.218) [-1083.571] (-1085.431) * (-1084.619) (-1084.308) (-1083.458) [-1085.331] -- 0:00:02
959000 -- (-1085.984) (-1086.225) [-1086.055] (-1085.639) * (-1090.805) (-1084.160) (-1087.446) [-1084.550] -- 0:00:02
959500 -- (-1086.078) [-1084.425] (-1085.197) (-1086.248) * (-1085.829) (-1083.779) (-1084.459) [-1083.695] -- 0:00:02
960000 -- [-1083.423] (-1087.965) (-1083.026) (-1087.696) * (-1083.920) [-1086.861] (-1083.995) (-1084.331) -- 0:00:02
Average standard deviation of split frequencies: 0.006445
960500 -- (-1086.029) [-1086.293] (-1083.374) (-1086.798) * (-1085.525) (-1088.387) [-1083.909] (-1087.527) -- 0:00:02
961000 -- (-1084.289) (-1084.687) [-1083.859] (-1084.922) * (-1087.510) (-1088.947) [-1084.116] (-1087.270) -- 0:00:02
961500 -- (-1086.359) [-1083.557] (-1087.943) (-1087.851) * (-1087.332) (-1084.919) [-1084.730] (-1084.321) -- 0:00:02
962000 -- (-1084.701) (-1086.533) [-1083.499] (-1089.396) * (-1091.725) (-1083.720) (-1086.115) [-1086.515] -- 0:00:02
962500 -- [-1084.726] (-1083.492) (-1083.705) (-1084.436) * [-1083.575] (-1085.939) (-1084.946) (-1085.214) -- 0:00:02
963000 -- (-1086.210) (-1083.870) (-1089.502) [-1084.697] * (-1084.633) [-1084.574] (-1087.465) (-1088.163) -- 0:00:02
963500 -- (-1084.054) [-1083.467] (-1086.502) (-1084.004) * (-1085.153) (-1085.352) [-1087.184] (-1089.383) -- 0:00:02
964000 -- (-1084.364) [-1083.510] (-1084.854) (-1084.133) * (-1086.532) (-1083.613) (-1084.761) [-1085.953] -- 0:00:02
964500 -- (-1085.743) [-1086.380] (-1086.879) (-1086.762) * (-1084.800) (-1083.610) [-1085.012] (-1084.627) -- 0:00:02
965000 -- (-1085.687) (-1086.528) [-1084.575] (-1083.768) * (-1084.709) (-1086.251) (-1083.912) [-1085.466] -- 0:00:02
Average standard deviation of split frequencies: 0.006084
965500 -- [-1084.841] (-1090.707) (-1087.925) (-1084.434) * (-1086.260) (-1086.843) (-1084.210) [-1087.779] -- 0:00:02
966000 -- [-1085.509] (-1086.951) (-1085.798) (-1083.871) * (-1085.635) (-1085.468) [-1083.390] (-1085.570) -- 0:00:02
966500 -- (-1083.705) [-1083.928] (-1089.794) (-1083.718) * (-1086.583) (-1085.492) (-1086.932) [-1083.589] -- 0:00:02
967000 -- (-1084.656) (-1085.468) [-1086.874] (-1084.400) * [-1085.456] (-1088.853) (-1085.441) (-1083.974) -- 0:00:02
967500 -- [-1083.547] (-1085.468) (-1086.155) (-1087.405) * (-1086.693) (-1085.684) (-1085.913) [-1087.263] -- 0:00:02
968000 -- [-1088.621] (-1086.334) (-1086.864) (-1085.934) * (-1085.914) (-1083.639) (-1085.979) [-1086.529] -- 0:00:01
968500 -- (-1086.720) (-1087.617) (-1087.668) [-1084.827] * [-1084.785] (-1084.360) (-1087.435) (-1085.698) -- 0:00:01
969000 -- [-1084.870] (-1087.657) (-1086.244) (-1085.899) * (-1085.968) (-1084.664) (-1086.992) [-1084.498] -- 0:00:01
969500 -- (-1084.826) (-1086.513) (-1087.199) [-1085.154] * (-1084.794) [-1087.030] (-1089.589) (-1083.253) -- 0:00:01
970000 -- (-1085.648) [-1084.422] (-1089.040) (-1085.060) * (-1084.903) (-1085.425) (-1085.145) [-1082.912] -- 0:00:01
Average standard deviation of split frequencies: 0.006313
970500 -- (-1085.318) [-1084.988] (-1086.901) (-1083.762) * (-1084.408) (-1086.050) [-1085.672] (-1083.417) -- 0:00:01
971000 -- (-1084.428) [-1087.952] (-1084.272) (-1083.665) * (-1085.714) (-1086.108) (-1090.442) [-1083.912] -- 0:00:01
971500 -- [-1084.611] (-1085.771) (-1084.480) (-1085.555) * (-1085.435) (-1088.010) (-1087.135) [-1087.681] -- 0:00:01
972000 -- (-1084.561) [-1084.766] (-1088.509) (-1084.822) * [-1083.867] (-1084.713) (-1087.199) (-1084.694) -- 0:00:01
972500 -- (-1084.640) (-1085.759) [-1084.178] (-1086.214) * (-1084.761) (-1085.379) (-1086.215) [-1083.452] -- 0:00:01
973000 -- (-1084.133) (-1086.565) (-1084.775) [-1085.013] * (-1088.190) [-1085.483] (-1085.806) (-1085.454) -- 0:00:01
973500 -- (-1085.138) (-1086.161) [-1085.362] (-1088.331) * (-1085.203) (-1091.872) (-1084.900) [-1083.852] -- 0:00:01
974000 -- (-1086.205) (-1084.400) [-1084.994] (-1087.530) * [-1087.478] (-1087.587) (-1084.230) (-1089.182) -- 0:00:01
974500 -- (-1085.516) (-1084.725) [-1086.757] (-1085.258) * [-1087.252] (-1085.016) (-1084.900) (-1084.220) -- 0:00:01
975000 -- (-1083.437) (-1085.425) [-1084.354] (-1085.574) * (-1087.926) (-1086.403) (-1090.329) [-1085.413] -- 0:00:01
Average standard deviation of split frequencies: 0.005957
975500 -- (-1089.255) (-1085.252) [-1083.809] (-1087.663) * (-1084.720) [-1083.810] (-1086.441) (-1083.837) -- 0:00:01
976000 -- (-1088.285) [-1088.255] (-1086.365) (-1084.445) * (-1088.551) (-1083.723) (-1085.375) [-1086.448] -- 0:00:01
976500 -- (-1083.910) [-1084.839] (-1083.849) (-1084.352) * (-1087.181) [-1084.241] (-1086.877) (-1084.759) -- 0:00:01
977000 -- (-1087.659) (-1086.952) (-1086.987) [-1084.832] * [-1085.019] (-1084.501) (-1084.637) (-1084.112) -- 0:00:01
977500 -- (-1084.252) [-1087.245] (-1084.355) (-1084.693) * [-1083.250] (-1086.765) (-1086.714) (-1083.779) -- 0:00:01
978000 -- [-1083.167] (-1083.827) (-1084.439) (-1085.673) * (-1084.462) (-1084.948) (-1089.802) [-1084.686] -- 0:00:01
978500 -- [-1083.375] (-1085.291) (-1085.568) (-1084.762) * (-1087.462) [-1084.404] (-1085.565) (-1086.074) -- 0:00:01
979000 -- (-1086.635) (-1087.800) (-1084.792) [-1083.745] * (-1088.809) [-1086.251] (-1084.778) (-1083.621) -- 0:00:01
979500 -- [-1083.653] (-1087.563) (-1089.341) (-1085.172) * (-1085.669) (-1088.798) [-1083.441] (-1085.566) -- 0:00:01
980000 -- (-1085.820) (-1089.382) [-1085.813] (-1088.286) * (-1083.553) (-1084.406) [-1088.737] (-1084.924) -- 0:00:01
Average standard deviation of split frequencies: 0.005865
980500 -- [-1086.449] (-1087.068) (-1086.186) (-1084.166) * (-1084.061) [-1083.948] (-1087.181) (-1084.411) -- 0:00:01
981000 -- (-1085.415) (-1084.722) (-1087.896) [-1086.571] * (-1084.521) (-1084.773) (-1088.123) [-1083.892] -- 0:00:01
981500 -- (-1083.573) (-1083.997) (-1085.629) [-1084.051] * [-1088.140] (-1086.444) (-1083.619) (-1087.852) -- 0:00:01
982000 -- [-1084.485] (-1083.207) (-1085.373) (-1085.031) * (-1083.360) (-1084.548) [-1084.362] (-1084.899) -- 0:00:01
982500 -- (-1083.582) (-1087.327) [-1083.755] (-1085.361) * (-1083.680) (-1087.971) (-1084.598) [-1089.324] -- 0:00:01
983000 -- (-1085.423) (-1084.122) [-1083.952] (-1084.096) * (-1085.729) [-1084.996] (-1083.397) (-1086.384) -- 0:00:01
983500 -- [-1085.501] (-1093.163) (-1084.351) (-1084.783) * (-1087.847) (-1085.717) (-1084.799) [-1084.727] -- 0:00:01
984000 -- [-1086.579] (-1088.159) (-1084.880) (-1087.929) * (-1084.313) [-1084.761] (-1083.677) (-1085.560) -- 0:00:00
984500 -- (-1083.754) (-1085.615) (-1085.296) [-1086.096] * (-1086.118) (-1091.653) (-1084.080) [-1087.033] -- 0:00:00
985000 -- (-1083.803) (-1087.847) (-1084.007) [-1084.730] * (-1086.681) (-1087.208) [-1084.376] (-1084.947) -- 0:00:00
Average standard deviation of split frequencies: 0.005737
985500 -- (-1083.451) [-1085.702] (-1085.139) (-1086.488) * (-1084.718) [-1086.147] (-1087.141) (-1084.728) -- 0:00:00
986000 -- [-1084.308] (-1085.701) (-1085.272) (-1084.509) * [-1084.209] (-1087.201) (-1087.547) (-1087.061) -- 0:00:00
986500 -- (-1084.288) [-1084.994] (-1085.042) (-1085.563) * (-1084.344) (-1083.157) [-1083.907] (-1084.708) -- 0:00:00
987000 -- (-1087.770) (-1086.022) [-1083.952] (-1085.662) * [-1086.133] (-1085.887) (-1083.679) (-1086.248) -- 0:00:00
987500 -- (-1083.931) [-1085.055] (-1088.379) (-1085.954) * (-1085.556) (-1085.409) [-1086.760] (-1087.502) -- 0:00:00
988000 -- (-1084.478) (-1084.378) [-1088.252] (-1088.067) * (-1087.181) (-1084.314) [-1083.404] (-1085.100) -- 0:00:00
988500 -- (-1083.505) (-1087.041) (-1083.672) [-1085.639] * [-1085.606] (-1084.789) (-1087.996) (-1084.285) -- 0:00:00
989000 -- (-1084.039) (-1084.403) (-1086.602) [-1085.597] * [-1085.486] (-1085.721) (-1088.194) (-1083.898) -- 0:00:00
989500 -- (-1089.487) [-1087.117] (-1087.945) (-1084.075) * (-1084.537) (-1083.969) (-1087.875) [-1085.073] -- 0:00:00
990000 -- (-1084.748) (-1088.670) [-1088.822] (-1087.598) * (-1085.225) [-1087.030] (-1085.759) (-1085.166) -- 0:00:00
Average standard deviation of split frequencies: 0.005615
990500 -- (-1084.164) [-1085.522] (-1087.460) (-1087.177) * (-1085.248) (-1086.901) [-1084.009] (-1085.460) -- 0:00:00
991000 -- (-1087.365) (-1085.709) (-1088.457) [-1086.143] * (-1087.402) (-1085.430) [-1084.159] (-1085.378) -- 0:00:00
991500 -- (-1086.379) (-1084.630) [-1085.362] (-1087.305) * (-1085.210) (-1089.662) [-1088.051] (-1086.560) -- 0:00:00
992000 -- (-1085.099) (-1087.493) (-1083.601) [-1086.299] * [-1084.339] (-1088.227) (-1089.725) (-1085.262) -- 0:00:00
992500 -- (-1085.436) (-1083.443) [-1087.811] (-1089.805) * (-1084.908) (-1086.339) [-1084.976] (-1086.350) -- 0:00:00
993000 -- (-1085.091) (-1086.481) [-1084.607] (-1088.953) * (-1089.272) [-1084.468] (-1086.082) (-1086.712) -- 0:00:00
993500 -- (-1090.298) (-1083.290) (-1086.810) [-1085.174] * (-1086.588) [-1083.597] (-1084.275) (-1088.678) -- 0:00:00
994000 -- (-1086.539) [-1086.047] (-1085.676) (-1084.414) * (-1086.644) (-1085.354) (-1088.126) [-1087.477] -- 0:00:00
994500 -- (-1083.788) [-1086.866] (-1086.423) (-1086.179) * (-1084.688) (-1083.629) [-1088.016] (-1083.796) -- 0:00:00
995000 -- [-1083.661] (-1089.164) (-1084.501) (-1086.832) * (-1092.478) [-1083.849] (-1086.461) (-1085.902) -- 0:00:00
Average standard deviation of split frequencies: 0.005680
995500 -- (-1085.493) (-1085.328) [-1084.336] (-1083.786) * [-1084.810] (-1087.987) (-1086.336) (-1084.745) -- 0:00:00
996000 -- (-1084.539) (-1083.536) [-1084.840] (-1089.728) * (-1089.086) [-1084.696] (-1084.518) (-1090.099) -- 0:00:00
996500 -- (-1087.309) [-1085.914] (-1083.196) (-1087.070) * [-1086.368] (-1085.409) (-1087.371) (-1086.857) -- 0:00:00
997000 -- (-1084.394) [-1087.151] (-1085.029) (-1086.249) * (-1086.368) (-1084.376) (-1086.047) [-1086.100] -- 0:00:00
997500 -- [-1084.070] (-1086.159) (-1084.660) (-1086.503) * (-1084.588) (-1084.179) [-1085.810] (-1084.443) -- 0:00:00
998000 -- (-1084.870) (-1084.977) [-1085.932] (-1089.569) * (-1085.955) (-1085.043) [-1084.214] (-1087.840) -- 0:00:00
998500 -- (-1089.340) (-1091.568) (-1084.595) [-1085.449] * (-1084.646) (-1083.625) (-1084.692) [-1088.331] -- 0:00:00
999000 -- (-1093.035) (-1084.344) (-1083.799) [-1084.083] * (-1085.049) [-1084.489] (-1084.753) (-1088.293) -- 0:00:00
999500 -- (-1086.500) (-1086.742) (-1086.075) [-1087.407] * [-1083.589] (-1084.644) (-1086.100) (-1091.123) -- 0:00:00
1000000 -- (-1085.746) (-1090.927) [-1085.186] (-1092.060) * [-1084.682] (-1086.511) (-1084.255) (-1089.880) -- 0:00:00
Average standard deviation of split frequencies: 0.006124
Analysis completed in 1 mins 2 seconds
Analysis used 60.67 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1082.91
Likelihood of best state for "cold" chain of run 2 was -1082.91
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.2 % ( 27 %) Dirichlet(Pi{all})
29.3 % ( 22 %) Slider(Pi{all})
79.0 % ( 61 %) Multiplier(Alpha{1,2})
77.4 % ( 45 %) Multiplier(Alpha{3})
20.2 % ( 22 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.3 % ( 23 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.4 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.3 % ( 23 %) Dirichlet(Pi{all})
28.5 % ( 27 %) Slider(Pi{all})
78.9 % ( 50 %) Multiplier(Alpha{1,2})
77.5 % ( 41 %) Multiplier(Alpha{3})
20.9 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.5 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166635 0.82 0.67
3 | 167407 167185 0.84
4 | 166565 165714 166494
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166662 0.82 0.67
3 | 166064 166739 0.84
4 | 166520 167217 166798
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1084.67
| 1 1 |
| 2 1 1 1 2 2 1 1 2 |
| 2 2 1 1 1 1 2 1 |
|1 21 1 1 21 112 12 2 2 2 2 21 2 11 |
| 1 11 1 * 1 1 1 212 2 |
| 2 1 1 *2 1 12 2 11 1 2 2 12 11 2 2|
| 11 2 2 2122 2 2 2 2 2 2 2 |
| 2 1 2 2 2 2 1 2 1 1 1 1 |
| 2 2 1 1 |
|2 2 1 2 2 2 1 1|
| 1 2 2 1 2 |
| |
| 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1086.59
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1084.57 -1087.26
2 -1084.63 -1087.75
--------------------------------------
TOTAL -1084.60 -1087.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906501 0.088721 0.398354 1.526107 0.874581 1358.58 1429.79 1.002
r(A<->C){all} 0.164771 0.017856 0.000004 0.432517 0.131971 258.74 281.21 1.000
r(A<->G){all} 0.170833 0.019332 0.000038 0.446101 0.139209 198.21 270.59 1.002
r(A<->T){all} 0.184000 0.024146 0.000130 0.498017 0.140291 192.80 197.25 1.001
r(C<->G){all} 0.155486 0.019446 0.000032 0.450868 0.117257 174.46 203.59 1.000
r(C<->T){all} 0.154445 0.017156 0.000041 0.424082 0.121694 269.03 284.98 1.004
r(G<->T){all} 0.170465 0.020300 0.000020 0.462038 0.134338 147.96 179.32 1.006
pi(A){all} 0.221170 0.000217 0.191885 0.250276 0.220703 1109.05 1169.88 1.000
pi(C){all} 0.242604 0.000225 0.214190 0.272717 0.242524 1159.16 1267.44 1.001
pi(G){all} 0.274599 0.000244 0.245259 0.306715 0.274110 1010.67 1148.67 1.000
pi(T){all} 0.261627 0.000232 0.234159 0.294011 0.261062 1191.68 1248.85 1.001
alpha{1,2} 0.423876 0.242447 0.000171 1.396295 0.256191 1153.36 1232.82 1.000
alpha{3} 0.499297 0.300309 0.000533 1.545741 0.314733 1240.60 1244.60 1.000
pinvar{all} 0.998028 0.000005 0.993630 0.999998 0.998732 1261.48 1323.34 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- .**.**
9 -- ...*.*
10 -- ....**
11 -- ...**.
12 -- .*.*..
13 -- ..**..
14 -- .*...*
15 -- .***.*
16 -- .**...
17 -- ..*..*
18 -- .****.
19 -- .*..*.
20 -- ..*.*.
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.003298 0.151899 0.156562 2
8 452 0.150566 0.002827 0.148568 0.152565 2
9 447 0.148901 0.002355 0.147235 0.150566 2
10 437 0.145570 0.013662 0.135909 0.155230 2
11 435 0.144903 0.002355 0.143238 0.146569 2
12 434 0.144570 0.007537 0.139241 0.149900 2
13 433 0.144237 0.002355 0.142572 0.145903 2
14 431 0.143571 0.002355 0.141905 0.145237 2
15 423 0.140906 0.015546 0.129913 0.151899 2
16 421 0.140240 0.014604 0.129913 0.150566 2
17 417 0.138907 0.001413 0.137908 0.139907 2
18 415 0.138241 0.001413 0.137242 0.139241 2
19 413 0.137575 0.004240 0.134577 0.140573 2
20 408 0.135909 0.009422 0.129247 0.142572 2
21 392 0.130580 0.008480 0.124584 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097628 0.009590 0.000001 0.289771 0.068491 1.000 2
length{all}[2] 0.103899 0.011211 0.000029 0.314910 0.070994 1.000 2
length{all}[3] 0.101708 0.010269 0.000028 0.295952 0.071851 1.000 2
length{all}[4] 0.098880 0.009811 0.000009 0.295544 0.069520 1.001 2
length{all}[5] 0.101826 0.010381 0.000008 0.299028 0.071816 1.000 2
length{all}[6] 0.101920 0.010241 0.000019 0.304438 0.070742 1.000 2
length{all}[7] 0.099317 0.007886 0.000071 0.275301 0.071794 0.999 2
length{all}[8] 0.108694 0.011324 0.000193 0.302266 0.073234 0.999 2
length{all}[9] 0.104986 0.011588 0.000520 0.336676 0.070886 1.001 2
length{all}[10] 0.102208 0.010400 0.000228 0.288160 0.078867 1.002 2
length{all}[11] 0.102313 0.010672 0.000121 0.340778 0.067761 0.999 2
length{all}[12] 0.092489 0.008681 0.000561 0.288808 0.060348 0.998 2
length{all}[13] 0.098456 0.008069 0.000414 0.271752 0.074736 1.009 2
length{all}[14] 0.098204 0.010617 0.000105 0.300630 0.070095 1.002 2
length{all}[15] 0.096518 0.009228 0.000004 0.285903 0.065493 0.998 2
length{all}[16] 0.100449 0.011070 0.000668 0.315761 0.061163 1.000 2
length{all}[17] 0.095311 0.010385 0.000149 0.280100 0.064342 0.998 2
length{all}[18] 0.099178 0.008180 0.000574 0.286139 0.069780 0.998 2
length{all}[19] 0.102159 0.009475 0.001133 0.277551 0.073603 0.998 2
length{all}[20] 0.095597 0.008382 0.000229 0.284955 0.068309 0.998 2
length{all}[21] 0.104465 0.010110 0.000098 0.305004 0.073743 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006124
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 783
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 61 patterns at 261 / 261 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 61 patterns at 261 / 261 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
59536 bytes for conP
5368 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060432 0.028326 0.074480 0.081078 0.094382 0.092970 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1169.384558
Iterating by ming2
Initial: fx= 1169.384558
x= 0.06043 0.02833 0.07448 0.08108 0.09438 0.09297 0.30000 1.30000
1 h-m-p 0.0000 0.0001 629.0490 ++ 1125.949051 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0102 104.5635 +++ 1096.181166 m 0.0102 25 | 2/8
3 h-m-p 0.0018 0.0088 40.3618 ------------.. | 2/8
4 h-m-p 0.0000 0.0000 555.9870 ++ 1094.862649 m 0.0000 57 | 3/8
5 h-m-p 0.0000 0.0001 816.6629 ++ 1074.375027 m 0.0001 68 | 4/8
6 h-m-p 0.0000 0.0001 166.9056 ++ 1068.293102 m 0.0001 79 | 5/8
7 h-m-p 0.0001 0.0003 121.0177 ++ 1058.193544 m 0.0003 90 | 6/8
8 h-m-p 0.0000 0.0000 341.2894 ++ 1057.960596 m 0.0000 101 | 7/8
9 h-m-p 1.6000 8.0000 0.0000 ++ 1057.960596 m 8.0000 112 | 7/8
10 h-m-p 0.0160 8.0000 0.0711 ----------C 1057.960596 0 0.0000 134 | 7/8
11 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960596 m 8.0000 149 | 7/8
12 h-m-p 0.0160 8.0000 0.2454 -----------C 1057.960596 0 0.0000 172 | 7/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960596 m 8.0000 187 | 7/8
14 h-m-p 0.0160 8.0000 0.2392 ------------Y 1057.960596 0 0.0000 211 | 7/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960596 m 8.0000 226 | 7/8
16 h-m-p 0.0160 8.0000 0.2415 ----------C 1057.960596 0 0.0000 248 | 7/8
17 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/8
18 h-m-p 0.0160 8.0000 0.0008 +++++ 1057.960591 m 8.0000 286 | 7/8
19 h-m-p 0.0275 8.0000 0.2374 ------------Y 1057.960591 0 0.0000 310 | 7/8
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/8
21 h-m-p 0.0160 8.0000 0.0008 +++++ 1057.960585 m 8.0000 348 | 7/8
22 h-m-p 0.0286 8.0000 0.2339 -----------C 1057.960585 0 0.0000 371 | 7/8
23 h-m-p 0.0160 8.0000 1.7887 -------------.. | 7/8
24 h-m-p 0.0160 8.0000 0.0009 +++++ 1057.960579 m 8.0000 408 | 7/8
25 h-m-p 0.0300 8.0000 0.2302 -----------C 1057.960579 0 0.0000 431 | 7/8
26 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960579 m 8.0000 446 | 7/8
27 h-m-p 0.0160 8.0000 0.2269 ----------Y 1057.960579 0 0.0000 468 | 7/8
28 h-m-p 0.0160 8.0000 0.0001 ----------C 1057.960579 0 0.0000 490 | 7/8
29 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960579 m 8.0000 505 | 7/8
30 h-m-p 0.0160 8.0000 0.0511 -----------C 1057.960579 0 0.0000 528 | 7/8
31 h-m-p 0.0160 8.0000 0.0000 -------Y 1057.960579 0 0.0000 547 | 7/8
32 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960579 m 8.0000 562 | 7/8
33 h-m-p 0.0160 8.0000 0.1449 -------------.. | 7/8
34 h-m-p 0.0160 8.0000 0.0009 +++++ 1057.960572 m 8.0000 600 | 7/8
35 h-m-p 0.0313 8.0000 0.2273 ----------Y 1057.960572 0 0.0000 622 | 7/8
36 h-m-p 0.0160 8.0000 0.0002 ------Y 1057.960572 0 0.0000 640 | 7/8
37 h-m-p 0.0160 8.0000 1.7672 -------------.. | 7/8
38 h-m-p 0.0160 8.0000 0.0009 +++++ 1057.960565 m 8.0000 677 | 7/8
39 h-m-p 0.0331 8.0000 0.2219 ----------Y 1057.960565 0 0.0000 699 | 7/8
40 h-m-p 0.0160 8.0000 0.0003 +++++ 1057.960563 m 8.0000 714 | 7/8
41 h-m-p 0.0160 8.0000 0.2193 ----------Y 1057.960563 0 0.0000 736 | 7/8
42 h-m-p 0.0160 8.0000 1.7526 -------------.. | 7/8
43 h-m-p 0.0160 8.0000 0.0010 +++++ 1057.960556 m 8.0000 773 | 7/8
44 h-m-p 0.0353 8.0000 0.2176 -----------C 1057.960556 0 0.0000 796 | 7/8
45 h-m-p 0.0160 8.0000 0.0000 ---------C 1057.960556 0 0.0000 817 | 7/8
46 h-m-p 0.0160 8.0000 0.0000 ------------Y 1057.960556 0 0.0000 841
Out..
lnL = -1057.960556
842 lfun, 842 eigenQcodon, 5052 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070545 0.080719 0.077693 0.020756 0.015654 0.101604 0.000100 0.787084 0.371224
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 16.151727
np = 9
lnL0 = -1148.607877
Iterating by ming2
Initial: fx= 1148.607877
x= 0.07054 0.08072 0.07769 0.02076 0.01565 0.10160 0.00011 0.78708 0.37122
1 h-m-p 0.0000 0.0000 589.7037 ++ 1147.733678 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 646.9392 ++ 1125.355587 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0001 176.4794 ++ 1120.357661 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0009 318.0724 +++ 1069.846040 m 0.0009 51 | 4/9
5 h-m-p 0.0000 0.0000 3447.7914 ++ 1065.312696 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 63.5130 ++ 1065.107839 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0000 110.9689 ++ 1063.981016 m 0.0000 87 | 7/9
8 h-m-p 0.0000 0.0004 73.1808 +++ 1057.960531 m 0.0004 100 | 8/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 1057.960530 m 8.0000 112 | 8/9
10 h-m-p 0.0020 1.0227 0.8383 ------------.. | 8/9
11 h-m-p 0.0160 8.0000 0.0011 +++++ 1057.960520 m 8.0000 151 | 8/9
12 h-m-p 0.0439 4.2547 0.2036 ------------Y 1057.960520 0 0.0000 176 | 8/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960520 m 8.0000 192 | 8/9
14 h-m-p 0.0089 4.4466 0.1949 -----------C 1057.960520 0 0.0000 216 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 ---------Y 1057.960520 0 0.0000 238 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960520 m 8.0000 254 | 8/9
17 h-m-p 0.0081 4.0541 0.0329 +++++ 1057.960283 m 4.0541 270 | 9/9
18 h-m-p 0.0160 8.0000 0.0000 N 1057.960283 0 0.0160 283 | 9/9
19 h-m-p 0.0160 8.0000 0.0000 N 1057.960283 0 0.0160 295
Out..
lnL = -1057.960283
296 lfun, 888 eigenQcodon, 3552 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.043662 0.023110 0.020199 0.071133 0.075793 0.066757 0.000100 1.369244 0.162873 0.136951 2.670732
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.635657
np = 11
lnL0 = -1124.497831
Iterating by ming2
Initial: fx= 1124.497831
x= 0.04366 0.02311 0.02020 0.07113 0.07579 0.06676 0.00011 1.36924 0.16287 0.13695 2.67073
1 h-m-p 0.0000 0.0000 472.5767 ++ 1124.150802 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 203.9751 ++++ 1098.715204 m 0.0007 32 | 2/11
3 h-m-p 0.0004 0.0019 109.3280 ++ 1080.337097 m 0.0019 46 | 3/11
4 h-m-p 0.0002 0.0008 74.7087 ++ 1075.974532 m 0.0008 60 | 4/11
5 h-m-p 0.0000 0.0001 735.8782 ++ 1067.002204 m 0.0001 74 | 5/11
6 h-m-p 0.0001 0.0004 101.2464 ++ 1064.919563 m 0.0004 88 | 6/11
7 h-m-p 0.0000 0.0000 85846.2750 ++ 1061.448049 m 0.0000 102 | 7/11
8 h-m-p 0.0004 0.0104 64.6927 +++ 1057.960764 m 0.0104 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0002 ++ 1057.960764 m 8.0000 131 | 8/11
10 h-m-p 0.0059 2.9301 1.5430 -----------N 1057.960764 0 0.0000 159 | 8/11
11 h-m-p 0.0160 8.0000 0.0182 +++++ 1057.960753 m 8.0000 176 | 8/11
12 h-m-p 0.0650 2.1795 2.2415 ------------N 1057.960753 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0004 +++++ 1057.960753 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 6.4970 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960752 m 8.0000 267 | 8/11
16 h-m-p 0.0160 8.0000 1.3063 ------------N 1057.960752 0 0.0000 296 | 8/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960752 m 8.0000 313 | 8/11
18 h-m-p 0.0160 8.0000 18.6238 -------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960752 m 8.0000 358 | 8/11
20 h-m-p 0.0160 8.0000 0.4643 -----------Y 1057.960752 0 0.0000 386 | 8/11
21 h-m-p 0.0160 8.0000 0.0147 +++++ 1057.960737 m 8.0000 406 | 8/11
22 h-m-p 0.0525 8.0000 2.2447 ------------Y 1057.960737 0 0.0000 435 | 8/11
23 h-m-p 0.0160 8.0000 0.0002 +++++ 1057.960737 m 8.0000 452 | 8/11
24 h-m-p 0.0160 8.0000 3.0166 -----------Y 1057.960737 0 0.0000 480 | 8/11
25 h-m-p 0.0160 8.0000 0.0021 +++++ 1057.960735 m 8.0000 497 | 8/11
26 h-m-p 0.0160 8.0000 3.2231 -----------C 1057.960735 0 0.0000 525 | 8/11
27 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
28 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960735 m 8.0000 570 | 8/11
29 h-m-p 0.0160 8.0000 2.2317 -------------.. | 8/11
30 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960735 m 8.0000 615 | 8/11
31 h-m-p 0.0160 8.0000 2.4688 -----------N 1057.960735 0 0.0000 643 | 8/11
32 h-m-p 0.0160 8.0000 0.0003 +++++ 1057.960735 m 8.0000 660 | 8/11
33 h-m-p 0.0160 8.0000 2.6364 -------------.. | 8/11
34 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960735 m 8.0000 705 | 8/11
35 h-m-p 0.0160 8.0000 1.2237 -------------.. | 8/11
36 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960735 m 8.0000 750 | 8/11
37 h-m-p 0.0160 8.0000 0.6013 -----------Y 1057.960735 0 0.0000 778 | 8/11
38 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960734 m 8.0000 798 | 8/11
39 h-m-p 0.0160 8.0000 2.4258 ------------C 1057.960734 0 0.0000 827 | 8/11
40 h-m-p 0.0160 8.0000 0.0155 +++++ 1057.960719 m 8.0000 844 | 8/11
41 h-m-p 0.0467 8.0000 2.6505 --------------.. | 8/11
42 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960719 m 8.0000 890 | 8/11
43 h-m-p 0.0160 8.0000 2.0641 -----------N 1057.960719 0 0.0000 918 | 8/11
44 h-m-p 0.0160 8.0000 0.0431 +++++ 1057.960667 m 8.0000 935 | 8/11
45 h-m-p 0.1013 8.0000 3.4069 --------------.. | 8/11
46 h-m-p 0.0160 8.0000 0.0002 +++++ 1057.960667 m 8.0000 981 | 8/11
47 h-m-p 0.0160 8.0000 0.7777 ----------C 1057.960667 0 0.0000 1008 | 8/11
48 h-m-p 0.0160 8.0000 0.0005 ----------N 1057.960667 0 0.0000 1035 | 8/11
49 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960667 m 8.0000 1055 | 8/11
50 h-m-p 0.0160 8.0000 3.1050 -----------C 1057.960667 0 0.0000 1083 | 8/11
51 h-m-p 0.0160 8.0000 0.0001 +++++ 1057.960667 m 8.0000 1100 | 8/11
52 h-m-p 0.0160 8.0000 6.0196 ------------N 1057.960667 0 0.0000 1129 | 8/11
53 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960667 m 8.0000 1146 | 8/11
54 h-m-p 0.0160 8.0000 0.0505 +++++ 1057.960643 m 8.0000 1166 | 8/11
55 h-m-p 0.1005 8.0000 4.0169 ------------Y 1057.960643 0 0.0000 1195 | 8/11
56 h-m-p 0.0160 8.0000 0.0000 ---N 1057.960643 0 0.0001 1212 | 8/11
57 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960643 m 8.0000 1232 | 8/11
58 h-m-p 0.0160 8.0000 1.6673 ------------N 1057.960643 0 0.0000 1261 | 8/11
59 h-m-p 0.0160 8.0000 0.0000 +++++ 1057.960643 m 8.0000 1278 | 8/11
60 h-m-p 0.0160 8.0000 0.0463 +++++ 1057.960594 m 8.0000 1298 | 8/11
61 h-m-p 0.0444 8.0000 8.3592 --------------.. | 8/11
62 h-m-p 0.0160 8.0000 0.0002 +++++ 1057.960593 m 8.0000 1344 | 8/11
63 h-m-p 0.0028 1.3867 3.3991 +++++ 1057.960286 m 1.3867 1364 | 9/11
64 h-m-p 1.6000 8.0000 0.0976 ++ 1057.960285 m 8.0000 1378 | 9/11
65 h-m-p 1.3193 8.0000 0.5920 ++ 1057.960283 m 8.0000 1394 | 9/11
66 h-m-p 1.6000 8.0000 0.0383 ++ 1057.960283 m 8.0000 1410 | 9/11
67 h-m-p 0.2736 8.0000 1.1215 +++ 1057.960283 m 8.0000 1427 | 9/11
68 h-m-p 1.6000 8.0000 0.0000 Y 1057.960283 0 1.6000 1441 | 9/11
69 h-m-p 0.0160 8.0000 0.0000 C 1057.960283 0 0.0160 1457
Out..
lnL = -1057.960283
1458 lfun, 5832 eigenQcodon, 26244 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1058.020568 S = -1057.961506 -0.022869
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 61 patterns 0:09
did 20 / 61 patterns 0:09
did 30 / 61 patterns 0:09
did 40 / 61 patterns 0:09
did 50 / 61 patterns 0:09
did 60 / 61 patterns 0:09
did 61 / 61 patterns 0:09
Time used: 0:09
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087036 0.023865 0.075322 0.040097 0.075610 0.014222 0.000100 1.176988 1.599263
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.089082
np = 9
lnL0 = -1135.549911
Iterating by ming2
Initial: fx= 1135.549911
x= 0.08704 0.02387 0.07532 0.04010 0.07561 0.01422 0.00011 1.17699 1.59926
1 h-m-p 0.0000 0.0000 583.6565 ++ 1134.707531 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0077 68.7474 +++++ 1107.850391 m 0.0077 29 | 2/9
3 h-m-p 0.0000 0.0002 114.7491 ++ 1106.052125 m 0.0002 41 | 3/9
4 h-m-p 0.0001 0.0006 341.3627 ++ 1080.047247 m 0.0006 53 | 4/9
5 h-m-p 0.0001 0.0005 646.1038 ++ 1064.284237 m 0.0005 65 | 5/9
6 h-m-p 0.0000 0.0000 1609.1273 ++ 1064.089380 m 0.0000 77 | 6/9
7 h-m-p 0.0000 0.0001 427.9564 ++ 1057.960583 m 0.0001 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 1057.960583 m 8.0000 101 | 7/9
9 h-m-p 0.0003 0.1561 2.8209 +++++ 1057.960283 m 0.1561 118 | 8/9
10 h-m-p 1.6000 8.0000 0.0001 ----C 1057.960283 0 0.0016 134 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 --C 1057.960283 0 0.0250 149
Out..
lnL = -1057.960283
150 lfun, 1650 eigenQcodon, 9000 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.059733 0.089012 0.022805 0.011825 0.087245 0.055250 0.000100 0.900000 0.254686 1.106328 2.977273
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.062667
np = 11
lnL0 = -1124.055076
Iterating by ming2
Initial: fx= 1124.055076
x= 0.05973 0.08901 0.02280 0.01183 0.08725 0.05525 0.00011 0.90000 0.25469 1.10633 2.97727
1 h-m-p 0.0000 0.0000 415.4327 ++ 1123.907666 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 366.0323 ++ 1110.822258 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0001 238.5541 ++ 1100.659602 m 0.0001 44 | 3/11
4 h-m-p 0.0002 0.0011 199.2581 ++ 1079.768773 m 0.0011 58 | 4/11
5 h-m-p 0.0005 0.0026 67.0960 ++ 1070.927874 m 0.0026 72 | 5/11
6 h-m-p 0.0000 0.0002 923.8078 ++ 1067.950423 m 0.0002 86 | 6/11
7 h-m-p 0.0000 0.0001 2984.3362 ++ 1060.636954 m 0.0001 100 | 7/11
8 h-m-p 0.0029 0.0147 13.7272 ++ 1057.960636 m 0.0147 114 | 8/11
9 h-m-p 1.6000 8.0000 0.0004 ++ 1057.960633 m 8.0000 128 | 8/11
10 h-m-p 0.0160 8.0000 0.2318 -----------Y 1057.960633 0 0.0000 156 | 8/11
11 h-m-p 0.0160 8.0000 0.0037 +++++ 1057.960567 m 8.0000 176 | 8/11
12 h-m-p 0.2924 8.0000 0.1013 -------------Y 1057.960567 0 0.0000 206 | 8/11
13 h-m-p 0.0160 8.0000 0.0022 +++++ 1057.960517 m 8.0000 226 | 8/11
14 h-m-p 0.2010 8.0000 0.0870 --------------Y 1057.960517 0 0.0000 257 | 8/11
15 h-m-p 0.0154 7.7244 0.0053 +++++ 1057.960283 m 7.7244 277 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 C 1057.960283 0 1.6000 294 | 9/11
17 h-m-p 0.5062 8.0000 0.0000 ++ 1057.960283 m 8.0000 310 | 9/11
18 h-m-p 0.0321 8.0000 0.0036 ++++ 1057.960283 m 8.0000 328 | 9/11
19 h-m-p 0.4971 8.0000 0.0585 ----Y 1057.960283 0 0.0005 348 | 9/11
20 h-m-p 0.3524 8.0000 0.0001 Y 1057.960283 0 0.0881 364 | 9/11
21 h-m-p 0.0213 8.0000 0.0003 Y 1057.960283 0 0.0130 380 | 9/11
22 h-m-p 0.5266 8.0000 0.0000 Y 1057.960283 0 0.5266 396 | 9/11
23 h-m-p 0.3448 8.0000 0.0000 Y 1057.960283 0 0.3448 412 | 9/11
24 h-m-p 0.5778 8.0000 0.0000 Y 1057.960283 0 0.5778 428 | 9/11
25 h-m-p 0.3663 8.0000 0.0000 N 1057.960283 0 0.3663 444 | 9/11
26 h-m-p 1.6000 8.0000 0.0000 Y 1057.960283 0 1.6000 460 | 9/11
27 h-m-p 0.6679 8.0000 0.0000 Y 1057.960283 0 0.1670 476 | 9/11
28 h-m-p 0.5261 8.0000 0.0000 N 1057.960283 0 0.1315 492 | 9/11
29 h-m-p 0.0337 8.0000 0.0000 N 1057.960283 0 0.0337 508 | 9/11
30 h-m-p 0.5293 8.0000 0.0000 --N 1057.960283 0 0.0083 526
Out..
lnL = -1057.960283
527 lfun, 6324 eigenQcodon, 34782 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1058.038211 S = -1057.961505 -0.034238
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 61 patterns 0:20
did 20 / 61 patterns 0:20
did 30 / 61 patterns 0:21
did 40 / 61 patterns 0:21
did 50 / 61 patterns 0:21
did 60 / 61 patterns 0:21
did 61 / 61 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=261
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
NC_002677_1_NP_302538_1_1410_ML2359 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE
**************************************************
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
NC_002677_1_NP_302538_1_1410_ML2359 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF
**************************************************
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
NC_002677_1_NP_302538_1_1410_ML2359 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND
**************************************************
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
NC_002677_1_NP_302538_1_1410_ML2359 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI
**************************************************
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
NC_002677_1_NP_302538_1_1410_ML2359 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI
**************************************************
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 EDKTLEWCDRA
NC_002677_1_NP_302538_1_1410_ML2359 EDKTLEWCDRA
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 EDKTLEWCDRA
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 EDKTLEWCDRA
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 EDKTLEWCDRA
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 EDKTLEWCDRA
***********
>NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA GAAGATAAAACCCTCGAATGGTGTGATCGAGCT >NC_002677_1_NP_302538_1_1410_ML2359 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA GAAGATAAAACCCTCGAATGGTGTGATCGAGCT >NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA GAAGATAAAACCCTCGAATGGTGTGATCGAGCT >NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA GAAGATAAAACCCTCGAATGGTGTGATCGAGCT >NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA GAAGATAAAACCCTCGAATGGTGTGATCGAGCT >NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 ATGCTGCACGTTCTTAGACCAGGGTATGCTGGCGCGGTGAACGGGCACTC GAACAACGGCAACGATGATGAAACATCTACCACCCCTACGCTATATATTT TCCCGCATGCAGGTGGAGATGCGACATACTATGTCCCATTTTCCCGGGAG TTTTCAGCGGACATAAAGCGGATCGCTGTTCACTACCCAGGGCAGCGCGA TGGGTATGGCTTGCCGGCGCTTACTAGTATTCCCGCTCTCGCTGACGAAA TCTTTGCGATCATGAAGCCGTCGGCGCCGCCGGAGGGGGCAGTCGCTTTT TTTGGTCACAGCATGGGCGGCATGCTGGCTTTCGAAGTTGCGTTGAGATT CCAATCGGCGGGGTATCGTCTTATCGCCCTTTTCGTCTCGGCCTGCTCGG CTCCGGGGTATATTAGGTACAAGCAGATCAAAGATTTTTCCGATAACGAT ATGCTGGACTTAGTCGTCCGCATGACCGGCATGAATCCGGATTTTTTTGA GGACGAAGAATTCCGTGTTGGAGTGCTTCCTACATTGCGTGCGGCCCGCA TCATTGCAGGTTATAATTGTCCGCCAGAGACGACGGTTTCATGCCCAATT TATACTTACATTGGCGATAAGGATTGGATTGCTACCCAAGAAGACATGAA GCCATGGCGTGAGCGAACTACGGGAGCGTTCGCGATTCGCGTGTTTCCTG GGGACCATTTCTACCTTAACGGAAATTTGTCAGAGCTAGTATGCGATATA GAAGATAAAACCCTCGAATGGTGTGATCGAGCT
>NC_011896_1_WP_010908858_1_2520_MLBR_RS12005 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI EDKTLEWCDRA >NC_002677_1_NP_302538_1_1410_ML2359 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI EDKTLEWCDRA >NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI EDKTLEWCDRA >NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI EDKTLEWCDRA >NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI EDKTLEWCDRA >NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295 MLHVLRPGYAGAVNGHSNNGNDDETSTTPTLYIFPHAGGDATYYVPFSRE FSADIKRIAVHYPGQRDGYGLPALTSIPALADEIFAIMKPSAPPEGAVAF FGHSMGGMLAFEVALRFQSAGYRLIALFVSACSAPGYIRYKQIKDFSDND MLDLVVRMTGMNPDFFEDEEFRVGVLPTLRAARIIAGYNCPPETTVSCPI YTYIGDKDWIATQEDMKPWRERTTGAFAIRVFPGDHFYLNGNLSELVCDI EDKTLEWCDRA
#NEXUS
[ID: 5263563589]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908858_1_2520_MLBR_RS12005
NC_002677_1_NP_302538_1_1410_ML2359
NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565
NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920
NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975
NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908858_1_2520_MLBR_RS12005,
2 NC_002677_1_NP_302538_1_1410_ML2359,
3 NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565,
4 NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920,
5 NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975,
6 NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06849054,2:0.07099409,3:0.07185147,4:0.06951954,5:0.07181564,6:0.0707418);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06849054,2:0.07099409,3:0.07185147,4:0.06951954,5:0.07181564,6:0.0707418);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1084.57 -1087.26
2 -1084.63 -1087.75
--------------------------------------
TOTAL -1084.60 -1087.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2359/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.906501 0.088721 0.398354 1.526107 0.874581 1358.58 1429.79 1.002
r(A<->C){all} 0.164771 0.017856 0.000004 0.432517 0.131971 258.74 281.21 1.000
r(A<->G){all} 0.170833 0.019332 0.000038 0.446101 0.139209 198.21 270.59 1.002
r(A<->T){all} 0.184000 0.024146 0.000130 0.498017 0.140291 192.80 197.25 1.001
r(C<->G){all} 0.155486 0.019446 0.000032 0.450868 0.117257 174.46 203.59 1.000
r(C<->T){all} 0.154445 0.017156 0.000041 0.424082 0.121694 269.03 284.98 1.004
r(G<->T){all} 0.170465 0.020300 0.000020 0.462038 0.134338 147.96 179.32 1.006
pi(A){all} 0.221170 0.000217 0.191885 0.250276 0.220703 1109.05 1169.88 1.000
pi(C){all} 0.242604 0.000225 0.214190 0.272717 0.242524 1159.16 1267.44 1.001
pi(G){all} 0.274599 0.000244 0.245259 0.306715 0.274110 1010.67 1148.67 1.000
pi(T){all} 0.261627 0.000232 0.234159 0.294011 0.261062 1191.68 1248.85 1.001
alpha{1,2} 0.423876 0.242447 0.000171 1.396295 0.256191 1153.36 1232.82 1.000
alpha{3} 0.499297 0.300309 0.000533 1.545741 0.314733 1240.60 1244.60 1.000
pinvar{all} 0.998028 0.000005 0.993630 0.999998 0.998732 1261.48 1323.34 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2359/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 261
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 9 9 9 9 9 9 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 8 8 8 8 8 8 | Cys TGT 2 2 2 2 2 2
TTC 7 7 7 7 7 7 | TCC 2 2 2 2 2 2 | TAC 5 5 5 5 5 5 | TGC 3 3 3 3 3 3
Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 6 6 6 6 6 6 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 4 4 4 4 4 4
CTA 2 2 2 2 2 2 | CCA 6 6 6 6 6 6 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 3 3 3 3 3 3 | CCG 8 8 8 8 8 8 | CAG 2 2 2 2 2 2 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 8 8 8 8 8 8 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 5 5 5 5 5 5 | AAC 6 6 6 6 6 6 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 2 2 2 2 2 2
Met ATG 8 8 8 8 8 8 | ACG 4 4 4 4 4 4 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 9 9 9 9 9 9 | Asp GAT 13 13 13 13 13 13 | Gly GGT 3 3 3 3 3 3
GTC 5 5 5 5 5 5 | GCC 3 3 3 3 3 3 | GAC 6 6 6 6 6 6 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 8 8 8 8 8 8 | GGA 4 4 4 4 4 4
GTG 3 3 3 3 3 3 | GCG 11 11 11 11 11 11 | GAG 6 6 6 6 6 6 | GGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908858_1_2520_MLBR_RS12005
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
#2: NC_002677_1_NP_302538_1_1410_ML2359
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
#3: NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
#4: NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
#5: NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
#6: NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 54 | Ser S TCT 6 | Tyr Y TAT 48 | Cys C TGT 12
TTC 42 | TCC 12 | TAC 30 | TGC 18
Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 30 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 36 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 24
CTC 12 | CCC 6 | CAC 24 | CGC 24
CTA 12 | CCA 36 | Gln Q CAA 12 | CGA 12
CTG 18 | CCG 48 | CAG 12 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 48 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 6
ATC 36 | ACC 30 | AAC 36 | AGC 6
ATA 12 | ACA 18 | Lys K AAA 12 | Arg R AGA 12
Met M ATG 48 | ACG 24 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 54 | Asp D GAT 78 | Gly G GGT 18
GTC 30 | GCC 18 | GAC 36 | GGC 42
GTA 6 | GCA 18 | Glu E GAA 48 | GGA 24
GTG 18 | GCG 66 | GAG 36 | GGG 48
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20307 C:0.20307 A:0.22989 G:0.36398
position 2: T:0.27586 C:0.26820 A:0.27586 G:0.18008
position 3: T:0.30651 C:0.25670 A:0.15709 G:0.27969
Average T:0.26181 C:0.24266 A:0.22095 G:0.27458
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1057.960556 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.166539
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908858_1_2520_MLBR_RS12005: 0.000004, NC_002677_1_NP_302538_1_1410_ML2359: 0.000004, NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565: 0.000004, NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920: 0.000004, NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975: 0.000004, NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.16654
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 621.5 161.5 0.1665 0.0000 0.0000 0.0 0.0
7..2 0.000 621.5 161.5 0.1665 0.0000 0.0000 0.0 0.0
7..3 0.000 621.5 161.5 0.1665 0.0000 0.0000 0.0 0.0
7..4 0.000 621.5 161.5 0.1665 0.0000 0.0000 0.0 0.0
7..5 0.000 621.5 161.5 0.1665 0.0000 0.0000 0.0 0.0
7..6 0.000 621.5 161.5 0.1665 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1057.960283 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908858_1_2520_MLBR_RS12005: 0.000004, NC_002677_1_NP_302538_1_1410_ML2359: 0.000004, NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565: 0.000004, NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920: 0.000004, NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975: 0.000004, NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1057.960283 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908858_1_2520_MLBR_RS12005: 0.000004, NC_002677_1_NP_302538_1_1410_ML2359: 0.000004, NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565: 0.000004, NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920: 0.000004, NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975: 0.000004, NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908858_1_2520_MLBR_RS12005)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:09
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1057.960283 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.832464
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908858_1_2520_MLBR_RS12005: 0.000004, NC_002677_1_NP_302538_1_1410_ML2359: 0.000004, NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565: 0.000004, NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920: 0.000004, NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975: 0.000004, NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.83246
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1057.960283 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.486901 3.233243
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908858_1_2520_MLBR_RS12005: 0.000004, NC_002677_1_NP_302538_1_1410_ML2359: 0.000004, NZ_LVXE01000080_1_WP_010908858_1_2758_A3216_RS13565: 0.000004, NZ_LYPH01000082_1_WP_010908858_1_2687_A8144_RS12920: 0.000004, NZ_CP029543_1_WP_010908858_1_2546_DIJ64_RS12975: 0.000004, NZ_AP014567_1_WP_010908858_1_2610_JK2ML_RS13295: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.48690
(p1 = 0.00001) w = 3.23324
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 3.23324
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 621.5 161.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908858_1_2520_MLBR_RS12005)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095
Time used: 0:21
Model 1: NearlyNeutral -1057.960283 Model 2: PositiveSelection -1057.960283 Model 0: one-ratio -1057.960556 Model 7: beta -1057.960283 Model 8: beta&w>1 -1057.960283 Model 0 vs 1 5.460000002130982E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
