--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:50:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2377/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -641.33 -645.79
2 -641.36 -646.37
--------------------------------------
TOTAL -641.34 -646.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887382 0.085127 0.388408 1.474868 0.856500 1501.00 1501.00 1.001
r(A<->C){all} 0.158963 0.018968 0.000040 0.440975 0.121233 212.94 253.56 1.006
r(A<->G){all} 0.178710 0.020705 0.000009 0.463247 0.142934 178.53 201.86 1.003
r(A<->T){all} 0.179480 0.022315 0.000155 0.480718 0.142456 221.40 264.49 1.000
r(C<->G){all} 0.163263 0.018718 0.000044 0.437491 0.127268 171.07 189.05 1.000
r(C<->T){all} 0.165458 0.019005 0.000024 0.440975 0.131414 268.43 286.16 1.001
r(G<->T){all} 0.154126 0.017912 0.000050 0.424091 0.115229 185.46 195.91 1.000
pi(A){all} 0.231647 0.000376 0.193003 0.268748 0.231430 1276.45 1291.02 1.000
pi(C){all} 0.261872 0.000424 0.219948 0.299672 0.261400 1455.60 1478.04 1.000
pi(G){all} 0.268577 0.000422 0.229442 0.309203 0.268035 1293.83 1397.41 1.000
pi(T){all} 0.237904 0.000381 0.200484 0.276467 0.237600 1165.30 1333.15 1.000
alpha{1,2} 0.420192 0.234951 0.000242 1.368362 0.240797 1155.20 1211.95 1.000
alpha{3} 0.456656 0.247916 0.000626 1.472271 0.289040 1321.20 1363.62 1.000
pinvar{all} 0.996534 0.000016 0.988563 1.000000 0.997914 1192.89 1293.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -619.347585
Model 2: PositiveSelection -619.347517
Model 0: one-ratio -619.347517
Model 7: beta -619.347627
Model 8: beta&w>1 -619.347518
Model 0 vs 1 1.3599999988400668E-4
Model 2 vs 1 1.3599999988400668E-4
Model 8 vs 7 2.1799999990435026E-4
>C1
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C2
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C3
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C4
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C5
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C6
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=154
C1 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C2 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C3 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C4 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C5 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C6 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
**************************************************
C1 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C2 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C3 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C4 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C5 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C6 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
**************************************************
C1 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C2 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C3 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C4 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C5 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C6 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
**************************************************
C1 VKSA
C2 VKSA
C3 VKSA
C4 VKSA
C5 VKSA
C6 VKSA
****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 154 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 154 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4620]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4620]--->[4620]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.689 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C2 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C3 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C4 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C5 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
C6 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
**************************************************
C1 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C2 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C3 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C4 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C5 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
C6 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
**************************************************
C1 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C2 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C3 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C4 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C5 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
C6 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
**************************************************
C1 VKSA
C2 VKSA
C3 VKSA
C4 VKSA
C5 VKSA
C6 VKSA
****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
C2 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
C3 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
C4 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
C5 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
C6 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
**************************************************
C1 ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
C2 ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
C3 ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
C4 ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
C5 ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
C6 ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
**************************************************
C1 TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
C2 TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
C3 TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
C4 TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
C5 TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
C6 TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
**************************************************
C1 TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
C2 TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
C3 TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
C4 TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
C5 TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
C6 TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
**************************************************
C1 TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
C2 TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
C3 TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
C4 TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
C5 TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
C6 TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
**************************************************
C1 TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
C2 TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
C3 TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
C4 TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
C5 TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
C6 TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
**************************************************
C1 TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
C2 TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
C3 TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
C4 TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
C5 TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
C6 TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
**************************************************
C1 TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
C2 TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
C3 TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
C4 TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
C5 TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
C6 TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
**************************************************
C1 TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
C2 TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
C3 TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
C4 TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
C5 TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
C6 TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
**************************************************
C1 GTGAAGTCCGCG
C2 GTGAAGTCCGCG
C3 GTGAAGTCCGCG
C4 GTGAAGTCCGCG
C5 GTGAAGTCCGCG
C6 GTGAAGTCCGCG
************
>C1
ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
GTGAAGTCCGCG
>C2
ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
GTGAAGTCCGCG
>C3
ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
GTGAAGTCCGCG
>C4
ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
GTGAAGTCCGCG
>C5
ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
GTGAAGTCCGCG
>C6
ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC
ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT
TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC
TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT
TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT
TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG
TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC
TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG
TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG
GTGAAGTCCGCG
>C1
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C2
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C3
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C4
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C5
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
>C6
MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
VKSA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 462 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855781
Setting output file names to "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 105497292
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5043938471
Seed = 771697920
Swapseed = 1579855781
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1033.978089 -- -24.965149
Chain 2 -- -1033.978149 -- -24.965149
Chain 3 -- -1033.978149 -- -24.965149
Chain 4 -- -1033.978149 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1033.978089 -- -24.965149
Chain 2 -- -1033.978149 -- -24.965149
Chain 3 -- -1033.978149 -- -24.965149
Chain 4 -- -1033.978089 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1033.978] (-1033.978) (-1033.978) (-1033.978) * [-1033.978] (-1033.978) (-1033.978) (-1033.978)
500 -- (-653.097) [-649.054] (-662.015) (-648.370) * (-650.025) [-650.950] (-654.839) (-650.011) -- 0:00:00
1000 -- (-654.498) (-658.236) [-652.606] (-648.736) * (-661.772) (-656.636) (-650.898) [-657.837] -- 0:00:00
1500 -- [-651.819] (-656.208) (-653.535) (-652.765) * [-647.253] (-650.710) (-645.982) (-650.359) -- 0:00:00
2000 -- (-650.429) [-651.948] (-658.557) (-648.708) * (-655.168) (-654.174) [-648.318] (-656.798) -- 0:00:00
2500 -- (-651.916) (-663.295) [-652.650] (-652.292) * [-651.907] (-658.796) (-651.169) (-649.940) -- 0:00:00
3000 -- (-647.849) [-649.765] (-656.900) (-655.823) * (-650.803) (-664.054) (-653.695) [-650.278] -- 0:00:00
3500 -- [-646.790] (-651.412) (-650.456) (-657.892) * (-652.138) [-651.644] (-647.356) (-659.157) -- 0:00:00
4000 -- (-654.796) (-650.892) (-656.284) [-647.519] * [-651.946] (-657.247) (-660.124) (-653.422) -- 0:00:00
4500 -- [-650.320] (-652.011) (-656.108) (-654.747) * (-657.219) [-647.871] (-652.983) (-647.580) -- 0:00:00
5000 -- (-652.772) (-653.625) [-655.745] (-669.927) * (-650.493) (-652.201) [-650.028] (-662.505) -- 0:00:00
Average standard deviation of split frequencies: 0.072020
5500 -- [-658.282] (-653.991) (-647.930) (-658.945) * (-646.218) [-646.416] (-651.289) (-650.093) -- 0:00:00
6000 -- (-652.614) (-649.199) (-661.561) [-655.573] * (-650.120) [-651.568] (-656.965) (-650.471) -- 0:00:00
6500 -- (-645.373) [-645.246] (-658.390) (-649.482) * (-649.853) (-651.207) (-650.972) [-650.450] -- 0:00:00
7000 -- (-654.348) [-650.813] (-648.337) (-651.028) * (-650.415) (-650.883) [-648.325] (-656.350) -- 0:00:00
7500 -- (-649.442) (-644.825) [-653.989] (-649.177) * [-651.202] (-653.053) (-656.499) (-651.132) -- 0:00:00
8000 -- (-644.494) (-642.441) (-654.780) [-642.127] * [-651.905] (-651.316) (-648.377) (-649.552) -- 0:00:00
8500 -- (-651.025) [-640.955] (-644.649) (-640.616) * (-655.033) [-647.312] (-654.643) (-649.264) -- 0:00:00
9000 -- (-650.250) (-644.975) (-646.558) [-640.112] * (-649.207) (-647.498) (-647.188) [-650.432] -- 0:00:00
9500 -- [-651.837] (-642.227) (-651.324) (-643.058) * [-652.677] (-654.703) (-645.815) (-658.541) -- 0:00:00
10000 -- [-647.209] (-639.792) (-652.834) (-641.223) * [-652.912] (-657.640) (-652.962) (-654.050) -- 0:00:00
Average standard deviation of split frequencies: 0.058256
10500 -- (-656.012) (-642.322) [-644.972] (-643.429) * (-648.390) [-643.065] (-649.521) (-657.142) -- 0:00:00
11000 -- (-653.906) (-643.124) (-650.666) [-645.333] * (-652.479) (-648.290) (-653.611) [-648.630] -- 0:00:00
11500 -- (-658.198) (-642.538) [-652.974] (-642.298) * (-653.178) (-657.303) (-654.749) [-647.148] -- 0:00:00
12000 -- (-654.103) (-642.959) (-649.930) [-641.404] * (-657.810) [-651.407] (-655.765) (-651.266) -- 0:01:22
12500 -- (-656.208) [-642.125] (-650.083) (-642.138) * (-643.788) (-655.049) [-646.927] (-657.893) -- 0:01:19
13000 -- (-644.324) [-641.803] (-656.440) (-640.543) * [-641.104] (-652.694) (-649.163) (-649.127) -- 0:01:15
13500 -- (-644.298) [-642.815] (-653.666) (-642.502) * (-641.721) (-645.310) [-651.280] (-648.923) -- 0:01:13
14000 -- (-647.492) (-642.934) (-655.186) [-641.691] * [-642.732] (-645.371) (-645.428) (-651.541) -- 0:01:10
14500 -- (-641.141) [-641.045] (-664.006) (-643.697) * (-645.741) (-652.827) [-663.892] (-648.836) -- 0:01:07
15000 -- (-640.279) [-643.257] (-656.938) (-643.011) * (-644.072) (-653.167) [-652.483] (-654.495) -- 0:01:05
Average standard deviation of split frequencies: 0.050508
15500 -- [-643.324] (-641.170) (-650.836) (-645.991) * (-645.710) (-653.349) [-651.268] (-655.484) -- 0:01:03
16000 -- (-642.193) (-641.073) (-667.429) [-643.407] * (-649.058) [-649.903] (-652.524) (-649.898) -- 0:01:01
16500 -- (-640.458) (-641.456) (-647.322) [-640.063] * (-642.730) [-648.771] (-650.312) (-648.534) -- 0:00:59
17000 -- [-641.599] (-641.567) (-640.687) (-643.710) * (-645.334) (-654.796) [-645.718] (-651.161) -- 0:00:57
17500 -- (-640.273) (-640.659) (-641.543) [-641.577] * [-644.690] (-652.406) (-653.274) (-650.519) -- 0:00:56
18000 -- (-643.244) [-641.336] (-641.259) (-640.825) * [-640.722] (-656.473) (-650.980) (-654.331) -- 0:00:54
18500 -- (-642.008) [-641.609] (-640.698) (-643.108) * (-642.392) (-651.991) (-656.099) [-650.571] -- 0:00:53
19000 -- [-642.956] (-640.432) (-640.142) (-640.644) * (-641.112) (-648.812) (-652.420) [-658.943] -- 0:00:51
19500 -- (-641.869) [-641.399] (-641.425) (-642.507) * [-641.173] (-653.600) (-652.885) (-663.858) -- 0:00:50
20000 -- [-642.263] (-641.215) (-642.121) (-642.663) * [-643.091] (-649.335) (-650.917) (-649.961) -- 0:00:49
Average standard deviation of split frequencies: 0.042936
20500 -- (-640.398) (-642.556) (-641.273) [-640.819] * (-643.611) [-653.680] (-650.962) (-646.674) -- 0:00:47
21000 -- (-644.573) (-644.111) [-641.106] (-642.157) * [-642.360] (-647.735) (-665.170) (-657.076) -- 0:00:46
21500 -- (-643.384) (-642.475) [-641.354] (-641.401) * (-643.665) (-655.941) (-649.089) [-648.639] -- 0:00:45
22000 -- (-641.463) [-645.474] (-643.644) (-642.349) * (-641.716) [-643.300] (-650.632) (-650.967) -- 0:00:44
22500 -- (-642.396) (-647.300) [-640.566] (-643.513) * [-644.135] (-641.665) (-642.302) (-663.778) -- 0:00:43
23000 -- [-642.075] (-644.559) (-643.236) (-641.620) * (-641.891) (-640.460) [-640.946] (-658.539) -- 0:00:42
23500 -- (-641.956) (-641.591) (-643.731) [-640.061] * (-646.549) (-643.530) [-641.468] (-655.961) -- 0:00:41
24000 -- (-648.751) (-640.912) (-643.200) [-641.482] * (-646.134) (-642.077) [-641.069] (-665.911) -- 0:00:40
24500 -- (-644.300) (-640.480) (-642.657) [-644.734] * [-641.964] (-642.070) (-641.731) (-672.162) -- 0:00:39
25000 -- (-640.340) (-641.416) (-640.318) [-640.690] * (-643.696) (-643.491) [-642.415] (-663.272) -- 0:00:39
Average standard deviation of split frequencies: 0.043169
25500 -- (-640.877) (-640.347) (-640.931) [-640.612] * (-641.589) (-642.976) (-640.383) [-643.474] -- 0:00:38
26000 -- (-640.100) [-648.677] (-642.130) (-644.351) * (-641.520) (-644.849) (-639.941) [-640.928] -- 0:00:37
26500 -- (-640.231) (-647.966) (-642.070) [-643.472] * (-641.596) (-641.374) (-641.076) [-640.745] -- 0:01:13
27000 -- (-642.618) [-644.347] (-642.750) (-643.631) * (-639.974) [-640.433] (-641.710) (-643.489) -- 0:01:12
27500 -- (-644.322) (-641.076) (-640.695) [-642.291] * (-641.835) (-639.848) [-643.729] (-645.414) -- 0:01:10
28000 -- (-641.248) (-641.436) [-641.357] (-641.914) * (-641.855) (-640.843) [-641.537] (-641.321) -- 0:01:09
28500 -- [-640.583] (-641.957) (-642.003) (-642.261) * (-641.476) (-640.811) [-642.704] (-641.294) -- 0:01:08
29000 -- (-641.905) (-643.073) [-642.017] (-645.356) * (-643.360) (-641.910) [-641.193] (-641.992) -- 0:01:06
29500 -- (-641.752) [-641.001] (-640.432) (-640.371) * (-641.447) [-644.518] (-643.578) (-641.028) -- 0:01:05
30000 -- [-641.993] (-640.987) (-640.402) (-640.657) * [-642.171] (-645.649) (-640.759) (-640.831) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- (-643.046) [-643.427] (-645.118) (-641.066) * [-640.323] (-644.022) (-641.038) (-641.846) -- 0:01:03
31000 -- (-644.473) [-640.630] (-646.351) (-642.053) * (-640.789) (-642.374) [-641.575] (-641.456) -- 0:01:02
31500 -- (-644.817) (-640.407) (-643.359) [-642.887] * (-642.097) (-642.546) (-641.200) [-643.133] -- 0:01:01
32000 -- [-645.305] (-642.643) (-643.000) (-643.139) * (-641.405) (-641.622) [-641.587] (-639.867) -- 0:01:00
32500 -- (-643.271) [-643.181] (-641.838) (-644.250) * (-641.985) (-643.189) [-640.468] (-649.064) -- 0:00:59
33000 -- (-640.983) (-642.012) [-642.191] (-641.466) * (-640.722) [-642.830] (-640.024) (-642.287) -- 0:00:58
33500 -- (-640.510) (-640.454) (-642.143) [-641.226] * [-643.257] (-641.167) (-639.839) (-641.120) -- 0:00:57
34000 -- (-642.298) [-641.872] (-643.568) (-646.578) * (-642.300) (-641.038) [-639.819] (-641.058) -- 0:00:56
34500 -- (-643.455) (-645.624) [-640.948] (-642.566) * [-641.860] (-640.030) (-640.932) (-642.921) -- 0:00:55
35000 -- [-644.034] (-643.192) (-648.845) (-642.924) * (-641.611) [-640.127] (-642.415) (-641.966) -- 0:00:55
Average standard deviation of split frequencies: 0.047286
35500 -- (-645.026) (-640.954) (-645.266) [-641.781] * [-640.589] (-641.259) (-639.846) (-641.315) -- 0:00:54
36000 -- (-644.398) (-640.845) (-643.055) [-640.522] * [-641.586] (-644.590) (-642.927) (-642.021) -- 0:00:53
36500 -- (-641.041) [-641.325] (-641.916) (-643.169) * (-641.619) (-643.767) (-642.464) [-640.832] -- 0:00:52
37000 -- (-641.756) (-645.923) [-641.423] (-640.412) * (-642.122) (-640.506) (-641.455) [-644.536] -- 0:00:52
37500 -- [-641.420] (-644.102) (-641.582) (-644.997) * (-641.881) (-641.194) [-642.470] (-641.226) -- 0:00:51
38000 -- (-641.808) (-643.013) [-640.281] (-643.786) * [-640.637] (-640.443) (-644.258) (-641.443) -- 0:00:50
38500 -- (-640.925) (-642.656) (-640.509) [-641.107] * (-640.138) [-641.507] (-645.446) (-642.119) -- 0:00:49
39000 -- [-641.915] (-645.748) (-644.987) (-643.286) * (-643.815) [-642.430] (-650.473) (-642.370) -- 0:00:49
39500 -- (-644.035) (-643.095) [-640.928] (-640.506) * (-645.546) [-641.311] (-641.691) (-642.184) -- 0:00:48
40000 -- (-643.747) [-643.662] (-642.062) (-640.646) * (-642.631) (-641.548) (-642.679) [-640.296] -- 0:00:48
Average standard deviation of split frequencies: 0.034776
40500 -- [-640.364] (-643.539) (-640.979) (-641.562) * (-646.519) (-643.246) (-641.000) [-641.109] -- 0:00:47
41000 -- (-642.295) (-643.364) [-643.583] (-642.952) * (-642.281) (-641.678) (-645.822) [-641.286] -- 0:00:46
41500 -- (-643.225) [-644.613] (-643.888) (-644.105) * (-645.409) [-641.531] (-641.037) (-640.714) -- 0:00:46
42000 -- (-640.498) (-643.018) [-640.369] (-641.815) * (-643.634) [-641.504] (-639.933) (-640.129) -- 0:00:45
42500 -- (-641.992) (-646.147) (-641.386) [-644.923] * [-640.018] (-646.430) (-641.721) (-640.514) -- 0:00:45
43000 -- [-643.989] (-641.447) (-641.348) (-643.723) * (-644.875) (-642.180) (-643.374) [-643.348] -- 0:01:06
43500 -- (-641.516) [-642.198] (-640.995) (-644.727) * (-641.893) (-647.114) [-643.490] (-642.711) -- 0:01:05
44000 -- (-642.281) (-642.572) [-641.018] (-641.338) * (-641.136) (-642.198) [-642.179] (-641.474) -- 0:01:05
44500 -- (-642.342) (-642.315) (-640.669) [-641.087] * [-641.727] (-643.716) (-643.363) (-643.174) -- 0:01:04
45000 -- [-641.850] (-640.223) (-640.847) (-641.251) * (-644.162) (-644.755) [-640.002] (-644.323) -- 0:01:03
Average standard deviation of split frequencies: 0.033306
45500 -- (-643.545) (-643.229) [-642.481] (-640.596) * (-640.925) (-642.338) [-640.983] (-643.320) -- 0:01:02
46000 -- (-641.418) [-642.270] (-641.497) (-643.145) * (-642.990) [-641.811] (-640.210) (-642.628) -- 0:01:02
46500 -- (-642.375) (-643.803) [-642.310] (-642.311) * (-641.805) [-642.835] (-643.635) (-646.552) -- 0:01:01
47000 -- (-644.035) [-643.370] (-643.121) (-642.206) * (-643.058) (-643.576) (-640.899) [-643.487] -- 0:01:00
47500 -- (-643.506) (-641.846) (-641.747) [-642.010] * (-642.701) [-640.428] (-648.270) (-641.537) -- 0:01:00
48000 -- [-643.708] (-643.393) (-642.134) (-641.444) * [-647.718] (-645.510) (-644.499) (-643.461) -- 0:00:59
48500 -- (-643.105) (-643.355) (-643.100) [-640.141] * (-647.425) (-648.393) [-642.109] (-642.105) -- 0:00:58
49000 -- (-644.148) (-645.492) (-643.855) [-643.054] * (-640.352) [-644.676] (-641.001) (-642.177) -- 0:00:58
49500 -- (-641.728) [-642.822] (-641.794) (-643.414) * (-641.722) (-646.328) [-640.845] (-640.433) -- 0:00:57
50000 -- (-640.544) (-644.702) [-641.362] (-645.477) * (-640.918) (-645.949) (-642.508) [-639.947] -- 0:00:57
Average standard deviation of split frequencies: 0.033788
50500 -- (-642.972) (-643.750) [-642.707] (-645.378) * (-641.497) (-642.098) (-640.897) [-640.402] -- 0:00:56
51000 -- (-641.638) (-641.688) (-645.513) [-641.564] * (-642.962) [-641.242] (-641.622) (-643.815) -- 0:00:55
51500 -- [-642.586] (-646.546) (-640.393) (-642.643) * (-641.239) [-644.401] (-642.950) (-640.248) -- 0:00:55
52000 -- [-641.794] (-643.224) (-640.972) (-643.746) * (-643.991) (-646.716) [-640.931] (-639.989) -- 0:00:54
52500 -- [-643.022] (-641.338) (-641.571) (-645.448) * (-642.196) (-642.917) (-642.236) [-644.117] -- 0:00:54
53000 -- (-642.325) (-643.084) [-640.022] (-642.262) * [-641.199] (-645.035) (-643.387) (-640.306) -- 0:00:53
53500 -- (-642.242) (-643.117) (-640.977) [-642.090] * [-641.275] (-641.260) (-642.696) (-640.261) -- 0:00:53
54000 -- (-645.468) [-639.871] (-639.901) (-642.493) * [-642.403] (-645.418) (-641.610) (-644.029) -- 0:00:52
54500 -- (-640.734) (-641.237) (-639.755) [-644.248] * (-643.603) (-642.627) (-644.369) [-642.390] -- 0:00:52
55000 -- (-641.637) (-648.275) (-641.479) [-646.375] * [-642.384] (-643.934) (-645.144) (-643.209) -- 0:00:51
Average standard deviation of split frequencies: 0.032786
55500 -- (-642.380) (-641.421) [-642.174] (-643.257) * (-643.105) (-641.401) (-643.522) [-642.957] -- 0:00:51
56000 -- (-643.190) (-641.761) [-642.773] (-644.460) * (-641.385) (-643.938) (-642.792) [-640.967] -- 0:00:50
56500 -- (-641.662) (-644.551) [-642.571] (-641.413) * (-644.470) (-643.134) (-642.430) [-640.258] -- 0:00:50
57000 -- (-641.600) [-641.455] (-641.772) (-642.701) * (-641.808) (-643.835) (-648.252) [-646.133] -- 0:00:49
57500 -- (-642.800) (-644.984) (-642.338) [-642.163] * [-641.738] (-641.118) (-648.015) (-649.231) -- 0:00:49
58000 -- (-644.431) (-644.307) (-642.196) [-643.346] * [-643.688] (-641.653) (-645.740) (-640.309) -- 0:00:48
58500 -- (-643.444) (-643.127) (-643.802) [-641.016] * (-641.585) (-642.680) [-642.180] (-641.180) -- 0:00:48
59000 -- (-642.765) [-640.871] (-644.854) (-640.440) * (-648.411) [-645.620] (-641.859) (-640.766) -- 0:00:47
59500 -- (-643.976) (-641.416) [-641.188] (-640.432) * (-643.192) (-644.887) (-639.670) [-642.859] -- 0:01:03
60000 -- [-643.462] (-645.513) (-641.187) (-640.221) * (-649.526) (-641.642) (-642.784) [-645.613] -- 0:01:02
Average standard deviation of split frequencies: 0.031082
60500 -- (-640.474) [-640.457] (-644.581) (-643.669) * (-646.127) [-645.272] (-640.266) (-647.382) -- 0:01:02
61000 -- (-640.055) (-641.049) (-643.736) [-640.643] * (-641.507) [-643.032] (-641.956) (-645.308) -- 0:01:01
61500 -- [-641.191] (-642.477) (-641.692) (-640.236) * [-644.825] (-642.046) (-641.602) (-640.412) -- 0:01:01
62000 -- [-640.440] (-642.608) (-642.719) (-643.520) * (-644.420) [-642.863] (-640.582) (-641.895) -- 0:01:00
62500 -- (-640.726) (-642.979) (-642.648) [-640.595] * (-644.360) [-641.205] (-641.018) (-645.209) -- 0:01:00
63000 -- (-644.046) (-647.481) (-642.161) [-640.023] * [-643.087] (-639.911) (-640.316) (-643.286) -- 0:00:59
63500 -- (-644.341) (-646.573) [-644.419] (-643.030) * (-641.528) (-644.486) (-640.076) [-641.668] -- 0:00:58
64000 -- (-641.048) (-643.909) (-643.039) [-642.719] * [-641.191] (-642.552) (-639.999) (-642.485) -- 0:00:58
64500 -- (-642.647) [-644.404] (-640.936) (-642.967) * (-642.052) (-641.514) [-641.516] (-640.275) -- 0:00:58
65000 -- (-646.199) (-644.613) (-640.569) [-640.746] * [-641.817] (-640.983) (-641.588) (-640.657) -- 0:00:57
Average standard deviation of split frequencies: 0.026427
65500 -- (-643.365) [-641.843] (-641.932) (-640.705) * [-641.952] (-644.111) (-647.583) (-640.554) -- 0:00:57
66000 -- (-644.450) [-642.850] (-640.169) (-640.721) * (-643.589) [-640.698] (-647.464) (-640.690) -- 0:00:56
66500 -- (-642.682) (-640.745) (-644.867) [-640.315] * (-641.095) (-640.704) (-641.000) [-639.928] -- 0:00:56
67000 -- [-640.908] (-641.250) (-643.556) (-639.927) * (-642.291) (-640.256) [-640.572] (-640.133) -- 0:00:55
67500 -- (-649.463) (-647.020) (-644.154) [-640.350] * (-641.433) [-641.023] (-643.030) (-640.439) -- 0:00:55
68000 -- (-641.524) (-643.191) [-643.201] (-640.423) * (-641.031) (-640.914) [-643.705] (-640.960) -- 0:00:54
68500 -- (-644.060) (-641.529) (-642.357) [-642.352] * (-644.692) (-643.227) [-645.482] (-642.847) -- 0:00:54
69000 -- (-649.054) (-642.947) (-641.446) [-642.434] * (-640.676) (-643.202) [-644.046] (-640.778) -- 0:00:53
69500 -- [-642.097] (-643.691) (-646.824) (-640.456) * (-641.566) (-641.173) [-640.911] (-642.693) -- 0:00:53
70000 -- (-644.382) (-643.486) (-644.235) [-641.002] * (-641.095) (-642.770) [-645.513] (-645.211) -- 0:00:53
Average standard deviation of split frequencies: 0.026332
70500 -- [-641.930] (-641.485) (-641.837) (-642.145) * (-640.934) [-641.240] (-641.232) (-642.944) -- 0:00:52
71000 -- [-644.639] (-641.088) (-641.941) (-644.942) * [-640.925] (-642.468) (-641.412) (-643.338) -- 0:00:52
71500 -- [-642.287] (-642.984) (-643.321) (-645.208) * [-640.846] (-643.079) (-641.629) (-643.548) -- 0:00:51
72000 -- (-644.718) [-641.534] (-642.309) (-646.406) * (-641.202) [-642.757] (-642.965) (-645.668) -- 0:00:51
72500 -- (-641.771) (-641.676) (-640.934) [-643.106] * (-641.291) (-647.772) [-642.407] (-644.041) -- 0:00:51
73000 -- (-641.331) (-642.172) (-639.932) [-640.834] * (-640.078) (-644.979) (-640.429) [-641.716] -- 0:00:50
73500 -- [-643.345] (-641.391) (-643.145) (-641.814) * [-640.461] (-648.817) (-642.557) (-646.556) -- 0:00:50
74000 -- [-642.880] (-643.323) (-644.153) (-640.974) * (-640.851) (-645.503) (-641.282) [-641.736] -- 0:00:50
74500 -- [-643.465] (-641.423) (-642.962) (-643.771) * [-640.847] (-642.242) (-641.593) (-642.481) -- 0:00:49
75000 -- (-642.669) [-642.130] (-642.318) (-647.239) * (-640.322) (-647.635) (-643.550) [-648.311] -- 0:00:49
Average standard deviation of split frequencies: 0.025106
75500 -- [-641.893] (-642.753) (-642.671) (-647.115) * (-644.346) (-644.412) [-642.469] (-643.883) -- 0:00:48
76000 -- [-640.833] (-640.190) (-640.698) (-648.622) * (-641.254) [-643.447] (-646.156) (-643.322) -- 0:00:48
76500 -- (-645.625) (-643.254) [-640.972] (-641.522) * (-640.390) [-641.226] (-643.847) (-641.182) -- 0:01:00
77000 -- (-642.131) [-640.575] (-641.816) (-645.206) * (-642.412) [-642.003] (-644.356) (-639.740) -- 0:00:59
77500 -- [-641.657] (-643.272) (-640.327) (-641.639) * (-642.189) [-640.732] (-642.129) (-640.020) -- 0:00:59
78000 -- (-642.608) [-640.135] (-639.892) (-641.025) * (-641.093) [-641.667] (-643.420) (-641.379) -- 0:00:59
78500 -- (-640.715) (-641.171) (-639.874) [-642.638] * (-640.277) [-644.402] (-642.569) (-641.898) -- 0:00:58
79000 -- (-641.041) (-641.446) [-639.962] (-643.352) * (-641.049) (-640.442) [-640.840] (-642.874) -- 0:00:58
79500 -- (-640.875) (-643.636) [-640.220] (-642.236) * [-640.102] (-640.960) (-641.855) (-643.030) -- 0:00:57
80000 -- (-642.619) (-646.210) [-641.310] (-644.907) * [-641.097] (-643.534) (-643.307) (-644.126) -- 0:00:57
Average standard deviation of split frequencies: 0.024349
80500 -- [-641.633] (-643.977) (-641.995) (-640.982) * (-640.580) (-646.641) (-641.299) [-643.357] -- 0:00:57
81000 -- (-645.050) (-643.103) [-640.947] (-642.359) * (-640.669) [-642.511] (-642.061) (-646.078) -- 0:00:56
81500 -- (-644.202) [-641.337] (-641.381) (-644.246) * (-645.288) (-644.091) [-643.559] (-640.166) -- 0:00:56
82000 -- (-647.259) [-641.199] (-644.528) (-642.023) * [-642.596] (-642.556) (-642.232) (-642.603) -- 0:00:55
82500 -- (-642.880) [-640.222] (-644.045) (-643.936) * (-640.176) (-643.568) [-642.863] (-643.017) -- 0:00:55
83000 -- (-643.710) [-640.508] (-642.012) (-643.601) * (-640.654) (-641.375) [-642.922] (-646.309) -- 0:00:55
83500 -- (-641.988) (-641.190) (-639.842) [-640.954] * (-641.231) [-640.345] (-642.599) (-643.166) -- 0:00:54
84000 -- (-640.850) (-640.699) (-643.313) [-641.247] * [-640.082] (-641.778) (-640.844) (-641.150) -- 0:00:54
84500 -- (-641.307) [-641.642] (-641.139) (-641.441) * (-645.218) [-643.329] (-643.348) (-641.850) -- 0:00:54
85000 -- (-642.482) (-640.269) (-641.212) [-641.281] * (-640.778) (-642.458) (-644.555) [-641.573] -- 0:00:53
Average standard deviation of split frequencies: 0.023945
85500 -- (-640.339) [-641.339] (-643.494) (-640.605) * (-641.406) (-643.014) (-645.893) [-643.299] -- 0:00:53
86000 -- [-640.981] (-642.701) (-644.073) (-643.227) * (-640.865) (-641.341) [-640.549] (-646.411) -- 0:00:53
86500 -- (-640.550) [-642.062] (-640.542) (-641.644) * (-642.758) (-640.541) [-640.660] (-640.646) -- 0:00:52
87000 -- [-642.636] (-643.031) (-640.970) (-641.619) * (-645.923) (-640.552) (-643.637) [-639.998] -- 0:00:52
87500 -- (-641.122) [-641.274] (-640.702) (-644.662) * [-642.483] (-642.620) (-643.427) (-644.465) -- 0:00:52
88000 -- [-641.292] (-640.352) (-642.046) (-647.144) * (-645.033) [-641.281] (-643.399) (-641.367) -- 0:00:51
88500 -- (-643.664) [-641.410] (-641.709) (-647.050) * (-642.703) (-642.510) (-641.530) [-640.147] -- 0:00:51
89000 -- (-643.357) [-641.124] (-643.889) (-646.753) * (-644.231) (-644.373) [-641.556] (-650.816) -- 0:00:51
89500 -- [-644.406] (-639.766) (-644.367) (-642.215) * (-642.343) [-641.857] (-641.717) (-642.131) -- 0:00:50
90000 -- (-644.139) (-645.811) (-641.960) [-640.501] * [-643.112] (-641.165) (-642.852) (-644.122) -- 0:00:50
Average standard deviation of split frequencies: 0.024355
90500 -- (-641.952) (-641.779) (-641.591) [-641.181] * (-641.594) (-642.095) [-640.321] (-646.389) -- 0:00:50
91000 -- (-641.844) (-642.242) [-642.327] (-641.725) * (-641.908) [-642.135] (-640.237) (-641.185) -- 0:00:49
91500 -- (-640.026) [-642.186] (-642.085) (-640.495) * (-640.941) (-642.525) [-640.251] (-643.674) -- 0:00:49
92000 -- (-640.806) (-643.265) (-639.884) [-641.096] * (-640.261) (-642.149) [-641.293] (-642.998) -- 0:00:49
92500 -- (-643.504) (-644.953) (-641.394) [-642.613] * (-642.430) (-641.817) (-642.728) [-643.424] -- 0:00:49
93000 -- (-645.684) (-643.244) [-646.072] (-642.575) * (-640.663) [-640.749] (-644.264) (-640.573) -- 0:00:48
93500 -- [-641.052] (-642.189) (-642.531) (-641.616) * [-641.971] (-641.490) (-642.391) (-645.033) -- 0:00:58
94000 -- (-641.750) (-643.081) (-641.243) [-641.277] * (-642.211) (-641.443) [-642.154] (-641.869) -- 0:00:57
94500 -- [-642.339] (-645.017) (-643.224) (-643.581) * (-646.823) [-641.232] (-643.618) (-641.970) -- 0:00:57
95000 -- [-642.236] (-641.929) (-641.870) (-642.143) * (-641.323) (-640.997) [-642.251] (-641.001) -- 0:00:57
Average standard deviation of split frequencies: 0.024811
95500 -- [-641.908] (-651.903) (-644.863) (-640.955) * (-642.669) [-640.408] (-641.645) (-644.322) -- 0:00:56
96000 -- (-641.493) (-647.595) [-644.260] (-639.882) * (-640.919) [-641.332] (-641.587) (-642.110) -- 0:00:56
96500 -- (-642.038) (-640.528) (-641.129) [-639.888] * (-642.328) (-641.174) (-642.401) [-644.094] -- 0:00:56
97000 -- (-642.856) [-641.730] (-641.728) (-641.059) * (-645.686) [-641.786] (-646.825) (-644.919) -- 0:00:55
97500 -- (-644.732) (-640.477) (-642.040) [-640.999] * [-641.706] (-644.084) (-643.959) (-642.616) -- 0:00:55
98000 -- (-642.697) (-639.807) (-641.249) [-643.129] * [-640.482] (-645.318) (-640.191) (-640.117) -- 0:00:55
98500 -- (-642.639) [-641.996] (-642.543) (-643.219) * (-639.991) [-641.465] (-643.967) (-641.050) -- 0:00:54
99000 -- (-643.961) [-640.027] (-642.359) (-644.270) * (-643.454) (-641.594) [-640.626] (-640.949) -- 0:00:54
99500 -- (-643.869) (-640.801) [-640.759] (-643.903) * (-644.503) [-646.382] (-640.916) (-640.818) -- 0:00:54
100000 -- (-643.022) (-643.529) [-640.263] (-640.819) * (-641.908) (-647.445) [-640.768] (-640.285) -- 0:00:54
Average standard deviation of split frequencies: 0.025879
100500 -- [-646.029] (-640.234) (-648.939) (-642.200) * (-641.814) (-640.995) (-645.188) [-640.461] -- 0:00:53
101000 -- [-642.442] (-642.966) (-647.541) (-641.745) * (-641.233) (-642.958) (-641.089) [-641.609] -- 0:00:53
101500 -- [-640.350] (-646.129) (-642.284) (-640.382) * (-640.722) (-641.807) (-640.874) [-641.848] -- 0:00:53
102000 -- [-641.020] (-644.456) (-643.361) (-647.904) * (-641.700) (-643.666) (-641.726) [-644.182] -- 0:00:52
102500 -- (-641.423) (-640.902) (-643.638) [-642.606] * (-642.051) (-641.844) (-643.307) [-642.361] -- 0:00:52
103000 -- (-644.166) (-641.381) (-643.111) [-644.970] * [-642.890] (-648.401) (-645.719) (-640.832) -- 0:00:52
103500 -- (-641.174) (-641.326) [-640.341] (-641.938) * (-642.122) (-640.172) (-642.617) [-642.150] -- 0:00:51
104000 -- (-641.049) (-645.416) (-642.649) [-642.174] * (-641.187) (-645.794) (-643.419) [-641.339] -- 0:00:51
104500 -- (-639.782) (-641.841) (-642.826) [-642.525] * [-641.625] (-650.663) (-642.737) (-646.370) -- 0:00:51
105000 -- (-646.651) [-646.477] (-642.188) (-646.731) * (-645.267) (-643.509) [-639.845] (-642.729) -- 0:00:51
Average standard deviation of split frequencies: 0.023640
105500 -- (-642.906) [-642.362] (-642.366) (-642.461) * (-641.107) (-647.478) [-639.729] (-641.569) -- 0:00:50
106000 -- (-644.935) [-642.225] (-644.269) (-641.001) * (-641.650) (-645.156) [-640.866] (-641.161) -- 0:00:50
106500 -- [-643.183] (-643.266) (-642.052) (-640.766) * (-641.873) [-642.906] (-640.925) (-640.178) -- 0:00:50
107000 -- [-642.898] (-641.333) (-640.573) (-641.301) * (-646.630) (-642.180) [-641.430] (-643.202) -- 0:00:50
107500 -- (-644.029) [-641.792] (-640.816) (-645.658) * (-643.980) (-640.545) (-640.679) [-641.262] -- 0:00:49
108000 -- (-643.996) [-641.284] (-641.644) (-642.429) * (-644.359) [-641.903] (-641.821) (-641.820) -- 0:00:49
108500 -- [-642.718] (-641.012) (-642.529) (-641.422) * (-644.840) (-642.579) (-645.341) [-641.054] -- 0:00:49
109000 -- (-643.283) (-641.910) [-642.805] (-640.358) * (-640.654) (-642.845) (-643.028) [-641.311] -- 0:00:49
109500 -- [-643.064] (-642.526) (-645.803) (-641.358) * (-649.526) (-640.439) [-639.972] (-642.512) -- 0:00:48
110000 -- (-640.283) (-640.771) (-641.790) [-640.855] * [-642.125] (-640.486) (-641.988) (-644.666) -- 0:00:48
Average standard deviation of split frequencies: 0.023092
110500 -- (-640.080) (-641.955) (-640.973) [-641.962] * (-642.077) (-641.231) (-643.035) [-641.738] -- 0:00:56
111000 -- (-641.557) [-642.154] (-641.990) (-647.202) * (-640.445) (-642.244) (-646.702) [-642.832] -- 0:00:56
111500 -- (-645.801) (-641.312) [-640.677] (-644.209) * [-641.622] (-644.540) (-640.054) (-640.669) -- 0:00:55
112000 -- (-642.772) [-641.866] (-642.415) (-643.432) * (-647.562) (-644.686) [-640.969] (-642.695) -- 0:00:55
112500 -- (-641.456) [-641.167] (-641.567) (-643.156) * (-640.982) (-640.643) [-642.862] (-640.607) -- 0:00:55
113000 -- (-642.110) (-641.285) (-640.970) [-643.250] * (-640.397) [-641.031] (-643.793) (-644.245) -- 0:00:54
113500 -- (-644.500) (-642.149) [-641.537] (-642.870) * [-642.211] (-641.984) (-642.294) (-643.283) -- 0:00:54
114000 -- (-640.394) [-641.322] (-641.071) (-645.635) * (-644.504) (-642.964) (-640.221) [-640.379] -- 0:00:54
114500 -- (-642.755) [-647.065] (-642.461) (-643.427) * (-641.057) (-641.823) [-639.736] (-641.686) -- 0:00:54
115000 -- (-642.594) [-643.153] (-642.164) (-640.685) * [-639.919] (-642.224) (-643.527) (-641.162) -- 0:00:53
Average standard deviation of split frequencies: 0.022125
115500 -- [-641.759] (-646.519) (-642.587) (-642.750) * (-644.527) (-642.282) [-645.459] (-641.675) -- 0:00:53
116000 -- (-641.753) (-645.130) [-639.923] (-645.078) * (-643.024) [-641.252] (-645.204) (-640.805) -- 0:00:53
116500 -- (-644.628) (-643.232) [-639.832] (-643.072) * (-640.838) (-641.247) (-642.968) [-640.873] -- 0:00:53
117000 -- [-640.968] (-640.804) (-641.902) (-640.672) * [-640.896] (-650.404) (-641.947) (-642.192) -- 0:00:52
117500 -- (-642.542) (-640.574) (-647.606) [-643.316] * (-641.427) (-645.448) (-640.756) [-640.212] -- 0:00:52
118000 -- [-642.556] (-640.285) (-641.891) (-642.315) * [-641.527] (-642.449) (-646.035) (-646.512) -- 0:00:52
118500 -- (-641.852) (-641.571) [-643.128] (-641.750) * (-641.818) [-647.611] (-644.143) (-642.428) -- 0:00:52
119000 -- (-643.446) (-641.805) (-643.646) [-641.740] * [-641.295] (-641.758) (-641.321) (-644.743) -- 0:00:51
119500 -- [-641.031] (-644.954) (-642.382) (-640.357) * (-642.603) (-642.473) [-640.445] (-642.163) -- 0:00:51
120000 -- (-642.651) (-650.074) (-647.551) [-640.314] * (-643.081) [-640.683] (-642.285) (-642.069) -- 0:00:51
Average standard deviation of split frequencies: 0.022412
120500 -- (-643.439) (-642.406) [-641.656] (-644.671) * (-643.283) (-640.553) (-640.837) [-640.937] -- 0:00:51
121000 -- [-644.486] (-644.799) (-640.530) (-640.927) * [-640.000] (-642.084) (-642.109) (-640.333) -- 0:00:50
121500 -- [-640.643] (-640.597) (-640.194) (-644.081) * (-642.349) [-642.098] (-641.408) (-640.168) -- 0:00:50
122000 -- (-640.327) [-642.093] (-646.572) (-641.453) * (-641.877) [-642.550] (-640.493) (-643.654) -- 0:00:50
122500 -- [-642.527] (-642.616) (-645.155) (-642.697) * (-644.018) [-643.147] (-642.187) (-647.275) -- 0:00:50
123000 -- (-643.654) [-641.627] (-643.360) (-643.777) * (-642.218) [-643.713] (-641.810) (-641.640) -- 0:00:49
123500 -- (-640.943) (-641.269) (-642.720) [-640.759] * (-642.435) (-649.531) (-642.309) [-640.892] -- 0:00:49
124000 -- [-641.201] (-642.633) (-641.138) (-642.834) * (-641.094) [-645.704] (-643.319) (-646.417) -- 0:00:49
124500 -- (-643.983) (-639.874) [-640.172] (-643.410) * (-641.595) (-643.298) (-647.180) [-641.311] -- 0:00:49
125000 -- (-641.291) [-641.105] (-641.547) (-641.392) * (-642.101) [-642.612] (-642.672) (-645.533) -- 0:00:49
Average standard deviation of split frequencies: 0.019642
125500 -- (-641.660) (-639.992) (-643.345) [-643.024] * (-641.367) (-642.329) [-642.949] (-642.777) -- 0:00:48
126000 -- (-641.794) (-641.041) (-643.385) [-641.927] * (-641.817) (-645.117) (-641.234) [-644.777] -- 0:00:48
126500 -- (-641.430) (-644.970) [-641.923] (-642.079) * (-641.675) [-645.435] (-645.103) (-642.788) -- 0:00:48
127000 -- (-643.170) (-643.259) (-640.758) [-642.212] * (-642.255) (-640.916) (-642.845) [-641.872] -- 0:00:54
127500 -- (-640.605) [-641.323] (-640.623) (-641.980) * (-641.477) (-645.076) (-642.224) [-642.281] -- 0:00:54
128000 -- (-642.543) [-642.684] (-641.778) (-641.675) * (-643.944) [-639.867] (-645.424) (-641.235) -- 0:00:54
128500 -- (-641.651) [-644.159] (-644.046) (-643.583) * (-643.400) (-640.317) [-642.618] (-643.778) -- 0:00:54
129000 -- (-641.861) (-640.391) [-641.988] (-643.330) * (-641.959) (-640.584) [-639.900] (-643.812) -- 0:00:54
129500 -- [-642.935] (-640.582) (-643.192) (-643.918) * (-643.109) (-643.563) [-642.468] (-646.001) -- 0:00:53
130000 -- (-642.657) (-643.042) (-642.172) [-641.134] * [-641.450] (-642.866) (-642.084) (-640.687) -- 0:00:53
Average standard deviation of split frequencies: 0.018038
130500 -- [-642.343] (-642.694) (-641.495) (-642.109) * (-643.863) (-641.655) [-643.011] (-641.628) -- 0:00:53
131000 -- [-645.550] (-640.330) (-641.859) (-644.547) * (-641.964) (-641.250) (-642.779) [-640.613] -- 0:00:53
131500 -- (-646.691) [-645.094] (-647.435) (-647.754) * (-642.255) (-641.012) (-642.275) [-641.755] -- 0:00:52
132000 -- [-641.402] (-644.894) (-647.448) (-649.414) * [-640.206] (-641.874) (-640.911) (-640.469) -- 0:00:52
132500 -- (-641.039) (-643.187) (-641.426) [-642.452] * (-645.399) (-640.879) (-641.574) [-640.673] -- 0:00:52
133000 -- (-640.164) [-642.607] (-641.021) (-642.503) * (-641.907) (-639.775) (-646.513) [-643.024] -- 0:00:52
133500 -- (-640.901) (-643.992) [-640.731] (-640.504) * (-642.145) [-640.874] (-642.455) (-644.519) -- 0:00:51
134000 -- (-642.918) (-646.120) (-641.239) [-644.773] * (-643.376) [-640.519] (-644.765) (-644.355) -- 0:00:51
134500 -- [-641.398] (-644.091) (-640.730) (-644.278) * (-642.521) [-641.545] (-643.929) (-642.296) -- 0:00:51
135000 -- (-641.167) [-642.493] (-640.137) (-645.275) * (-643.925) [-642.368] (-646.102) (-640.612) -- 0:00:51
Average standard deviation of split frequencies: 0.018426
135500 -- (-641.436) [-643.115] (-642.297) (-646.053) * [-643.345] (-642.755) (-640.737) (-641.388) -- 0:00:51
136000 -- (-641.803) (-642.064) [-640.287] (-643.120) * (-644.079) [-641.097] (-643.267) (-643.435) -- 0:00:50
136500 -- (-642.027) [-641.544] (-642.600) (-642.774) * (-642.268) (-644.646) (-641.618) [-640.669] -- 0:00:50
137000 -- (-649.939) (-643.202) (-642.947) [-642.984] * (-640.564) [-644.482] (-644.036) (-641.487) -- 0:00:50
137500 -- [-644.167] (-642.057) (-640.542) (-642.474) * (-640.653) [-641.234] (-640.778) (-643.242) -- 0:00:50
138000 -- (-641.510) [-640.979] (-642.118) (-640.634) * [-640.653] (-641.196) (-642.479) (-644.398) -- 0:00:49
138500 -- (-640.418) [-643.233] (-639.994) (-641.822) * (-645.029) (-641.624) (-642.198) [-642.975] -- 0:00:49
139000 -- (-643.691) (-641.133) (-644.238) [-643.771] * [-641.252] (-642.987) (-641.416) (-641.234) -- 0:00:49
139500 -- (-641.373) (-643.950) (-643.030) [-642.067] * (-643.349) (-642.089) (-645.721) [-641.834] -- 0:00:49
140000 -- (-641.667) (-645.582) (-640.792) [-641.693] * [-645.727] (-641.764) (-641.930) (-640.395) -- 0:00:49
Average standard deviation of split frequencies: 0.020852
140500 -- [-642.227] (-640.889) (-641.131) (-643.918) * (-641.169) (-642.001) [-641.994] (-645.387) -- 0:00:48
141000 -- (-643.230) (-645.517) [-639.875] (-640.517) * [-640.616] (-642.466) (-640.628) (-641.610) -- 0:00:48
141500 -- (-642.812) (-641.735) (-645.331) [-641.171] * (-640.789) (-641.518) [-642.138] (-641.350) -- 0:00:48
142000 -- (-643.164) [-641.299] (-644.451) (-640.534) * [-642.428] (-641.749) (-643.353) (-643.788) -- 0:00:48
142500 -- (-642.118) (-641.296) (-644.444) [-643.631] * (-641.596) [-642.033] (-642.054) (-642.318) -- 0:00:48
143000 -- [-642.063] (-642.220) (-642.294) (-641.257) * [-641.211] (-644.004) (-641.562) (-643.390) -- 0:00:47
143500 -- (-641.452) (-640.680) [-642.269] (-639.952) * [-641.198] (-643.399) (-640.977) (-643.516) -- 0:00:47
144000 -- (-643.029) [-640.981] (-640.411) (-642.069) * (-641.863) [-641.723] (-642.464) (-642.647) -- 0:00:53
144500 -- (-642.850) (-643.229) (-646.652) [-640.555] * (-643.871) (-639.965) (-641.020) [-640.244] -- 0:00:53
145000 -- (-641.284) (-640.707) (-642.916) [-640.555] * (-642.798) (-642.859) (-642.315) [-640.081] -- 0:00:53
Average standard deviation of split frequencies: 0.019543
145500 -- (-640.675) (-643.194) (-642.424) [-641.396] * [-644.177] (-641.052) (-641.262) (-639.918) -- 0:00:52
146000 -- (-642.225) (-642.550) (-640.785) [-641.287] * (-643.482) [-641.559] (-646.006) (-639.919) -- 0:00:52
146500 -- (-641.282) (-640.919) (-643.455) [-640.433] * [-640.076] (-641.674) (-643.365) (-642.165) -- 0:00:52
147000 -- (-640.476) (-641.310) (-639.982) [-647.026] * (-644.855) (-641.375) [-644.497] (-641.996) -- 0:00:52
147500 -- (-640.854) (-643.430) [-639.971] (-641.721) * [-642.931] (-640.442) (-640.619) (-642.397) -- 0:00:52
148000 -- (-641.293) [-640.034] (-639.924) (-643.791) * [-642.380] (-642.382) (-642.473) (-641.160) -- 0:00:51
148500 -- [-641.228] (-640.852) (-640.142) (-647.475) * (-643.606) [-641.578] (-645.221) (-641.857) -- 0:00:51
149000 -- [-640.964] (-641.286) (-641.609) (-647.567) * (-641.657) (-643.624) [-642.590] (-641.881) -- 0:00:51
149500 -- [-640.635] (-642.628) (-643.868) (-640.848) * [-642.386] (-640.894) (-641.678) (-643.877) -- 0:00:51
150000 -- [-644.615] (-641.713) (-642.573) (-640.615) * [-641.640] (-642.923) (-641.008) (-643.660) -- 0:00:51
Average standard deviation of split frequencies: 0.019642
150500 -- (-643.005) (-647.845) [-642.600] (-640.754) * (-642.308) [-642.311] (-640.635) (-641.215) -- 0:00:50
151000 -- (-644.607) (-642.225) [-640.407] (-640.994) * (-642.692) (-643.049) [-640.293] (-641.148) -- 0:00:50
151500 -- (-641.353) (-640.849) (-640.180) [-641.314] * (-645.060) (-642.698) [-640.451] (-640.479) -- 0:00:50
152000 -- [-644.422] (-640.844) (-641.302) (-641.383) * (-643.780) (-643.392) [-640.901] (-643.892) -- 0:00:50
152500 -- (-640.568) [-640.938] (-643.120) (-644.553) * (-643.715) (-642.102) [-642.239] (-643.293) -- 0:00:50
153000 -- (-641.496) (-644.524) [-641.248] (-641.085) * (-643.768) [-639.760] (-644.620) (-641.663) -- 0:00:49
153500 -- (-652.515) (-641.785) (-642.381) [-642.303] * [-641.659] (-642.865) (-642.586) (-640.906) -- 0:00:49
154000 -- (-645.802) [-640.741] (-644.811) (-642.536) * [-640.360] (-641.401) (-643.225) (-645.103) -- 0:00:49
154500 -- (-643.590) (-641.888) [-642.160] (-641.899) * [-643.307] (-640.431) (-644.275) (-644.038) -- 0:00:49
155000 -- (-642.883) (-643.161) [-640.616] (-643.076) * (-640.980) (-640.454) [-641.362] (-642.569) -- 0:00:49
Average standard deviation of split frequencies: 0.019197
155500 -- (-642.116) [-640.872] (-643.556) (-645.097) * (-641.855) (-640.694) [-641.515] (-643.539) -- 0:00:48
156000 -- (-643.019) [-642.093] (-643.181) (-641.974) * (-643.289) [-642.811] (-643.860) (-641.130) -- 0:00:48
156500 -- (-644.449) [-643.017] (-641.887) (-642.078) * (-642.727) (-641.983) (-640.368) [-641.588] -- 0:00:48
157000 -- [-643.618] (-642.597) (-641.807) (-643.473) * [-642.983] (-641.725) (-642.113) (-642.285) -- 0:00:48
157500 -- (-643.776) (-641.317) [-642.129] (-642.220) * (-643.924) (-641.464) [-643.262] (-640.173) -- 0:00:48
158000 -- [-642.860] (-644.494) (-639.771) (-643.468) * (-644.518) [-642.936] (-643.883) (-643.972) -- 0:00:47
158500 -- (-640.599) (-641.072) [-640.574] (-643.345) * (-644.559) [-642.199] (-644.100) (-645.918) -- 0:00:47
159000 -- [-643.407] (-641.937) (-640.810) (-642.991) * (-641.867) (-641.239) (-642.611) [-646.427] -- 0:00:47
159500 -- [-644.037] (-642.138) (-643.524) (-645.959) * (-644.589) (-642.807) [-641.960] (-643.304) -- 0:00:47
160000 -- (-642.406) (-643.644) [-642.520] (-640.901) * [-641.627] (-643.079) (-643.573) (-644.346) -- 0:00:52
Average standard deviation of split frequencies: 0.019330
160500 -- (-640.443) (-641.174) [-642.040] (-641.791) * (-642.101) [-645.692] (-643.646) (-641.491) -- 0:00:52
161000 -- (-643.773) (-640.855) [-641.132] (-641.482) * (-643.012) [-642.085] (-641.372) (-642.017) -- 0:00:52
161500 -- [-641.757] (-640.415) (-640.584) (-645.764) * (-640.447) (-641.046) [-642.175] (-641.112) -- 0:00:51
162000 -- (-640.821) (-643.425) (-646.728) [-642.945] * [-641.641] (-641.881) (-640.495) (-642.046) -- 0:00:51
162500 -- (-641.496) (-644.168) [-642.179] (-642.984) * (-641.971) (-641.898) (-645.450) [-647.629] -- 0:00:51
163000 -- [-640.452] (-645.730) (-644.471) (-644.962) * (-640.521) (-641.125) [-642.198] (-645.534) -- 0:00:51
163500 -- (-641.006) (-644.082) [-642.092] (-646.188) * (-644.080) [-640.094] (-644.396) (-639.852) -- 0:00:51
164000 -- [-642.587] (-640.647) (-646.222) (-643.274) * [-644.186] (-645.928) (-641.557) (-642.601) -- 0:00:50
164500 -- (-645.340) [-641.293] (-640.818) (-642.652) * (-645.043) (-650.122) (-640.325) [-639.946] -- 0:00:50
165000 -- (-641.181) [-643.251] (-642.609) (-650.763) * [-641.936] (-644.445) (-642.375) (-640.802) -- 0:00:50
Average standard deviation of split frequencies: 0.017338
165500 -- (-643.323) (-642.927) (-639.873) [-640.429] * [-641.299] (-641.361) (-640.937) (-641.514) -- 0:00:50
166000 -- (-641.558) [-641.170] (-641.153) (-640.799) * (-642.168) (-641.439) [-643.251] (-640.333) -- 0:00:50
166500 -- (-643.842) (-641.494) [-641.235] (-644.759) * (-643.085) (-640.906) [-641.772] (-643.143) -- 0:00:50
167000 -- (-641.630) [-640.499] (-643.124) (-640.351) * (-641.694) (-641.439) (-642.318) [-646.637] -- 0:00:49
167500 -- [-640.628] (-641.913) (-642.075) (-640.463) * [-641.714] (-642.480) (-643.076) (-641.942) -- 0:00:49
168000 -- [-641.828] (-641.840) (-640.725) (-645.703) * [-641.186] (-643.967) (-643.122) (-642.160) -- 0:00:49
168500 -- [-642.652] (-642.226) (-642.396) (-649.188) * (-641.206) (-645.649) (-649.262) [-642.779] -- 0:00:49
169000 -- (-642.877) (-641.258) (-641.423) [-645.688] * (-641.584) [-640.752] (-648.330) (-641.732) -- 0:00:49
169500 -- (-641.963) (-640.942) [-641.542] (-640.479) * (-643.095) (-642.939) [-641.382] (-641.094) -- 0:00:48
170000 -- (-639.975) (-643.067) [-642.030] (-643.157) * (-640.158) [-642.403] (-641.455) (-644.985) -- 0:00:48
Average standard deviation of split frequencies: 0.016297
170500 -- (-641.433) [-640.391] (-640.997) (-642.435) * (-641.991) (-642.771) [-642.911] (-642.208) -- 0:00:48
171000 -- (-642.387) [-640.538] (-640.804) (-643.228) * [-641.543] (-645.120) (-642.070) (-642.351) -- 0:00:48
171500 -- [-641.354] (-640.867) (-642.672) (-641.859) * (-641.898) (-644.197) (-640.750) [-641.899] -- 0:00:48
172000 -- (-645.341) (-643.659) (-640.529) [-639.990] * (-640.941) [-645.243] (-642.663) (-647.345) -- 0:00:48
172500 -- (-643.578) (-642.590) (-643.044) [-640.172] * (-644.076) (-642.954) [-639.960] (-645.978) -- 0:00:47
173000 -- (-640.954) [-641.186] (-644.832) (-642.138) * (-642.823) (-640.532) (-641.359) [-642.454] -- 0:00:47
173500 -- (-641.030) [-640.852] (-642.903) (-643.681) * [-640.500] (-641.227) (-641.280) (-641.469) -- 0:00:47
174000 -- (-645.560) (-640.552) (-645.399) [-641.933] * (-643.353) [-641.286] (-641.704) (-644.103) -- 0:00:47
174500 -- (-643.074) (-641.017) [-644.172] (-641.201) * (-644.015) (-645.196) (-641.836) [-641.582] -- 0:00:47
175000 -- (-650.726) (-642.854) [-646.315] (-641.289) * (-640.980) [-642.567] (-640.648) (-640.710) -- 0:00:47
Average standard deviation of split frequencies: 0.017173
175500 -- [-644.884] (-646.457) (-644.307) (-641.926) * (-641.794) (-641.996) [-640.741] (-640.826) -- 0:00:46
176000 -- (-644.843) (-643.707) (-643.746) [-641.885] * (-640.286) (-641.009) (-641.792) [-640.946] -- 0:00:46
176500 -- (-643.203) (-641.516) (-646.705) [-641.107] * (-642.953) (-641.296) [-641.121] (-641.701) -- 0:00:51
177000 -- (-648.428) [-645.497] (-640.699) (-640.525) * (-639.848) (-644.728) (-640.589) [-642.474] -- 0:00:51
177500 -- [-642.096] (-639.742) (-641.041) (-642.753) * (-639.807) [-641.762] (-643.803) (-642.459) -- 0:00:50
178000 -- (-641.532) [-641.170] (-642.186) (-647.283) * (-640.134) (-642.062) (-641.046) [-641.641] -- 0:00:50
178500 -- (-643.189) (-639.880) [-640.149] (-643.911) * (-641.064) (-641.720) [-640.923] (-645.244) -- 0:00:50
179000 -- (-641.295) (-640.049) (-640.371) [-645.129] * (-643.729) [-641.568] (-640.906) (-643.402) -- 0:00:50
179500 -- (-643.463) [-640.923] (-642.609) (-642.513) * (-643.052) (-641.687) (-644.854) [-640.821] -- 0:00:50
180000 -- [-643.399] (-640.695) (-642.242) (-643.451) * (-646.746) (-643.326) [-641.763] (-643.328) -- 0:00:50
Average standard deviation of split frequencies: 0.014888
180500 -- (-643.169) (-640.328) (-641.478) [-640.987] * (-646.026) (-642.469) [-641.970] (-641.978) -- 0:00:49
181000 -- (-641.532) (-641.987) (-640.999) [-639.883] * (-640.969) [-642.443] (-643.241) (-643.961) -- 0:00:49
181500 -- [-645.321] (-641.547) (-640.996) (-639.765) * (-642.718) [-643.257] (-640.569) (-641.753) -- 0:00:49
182000 -- [-646.359] (-642.756) (-643.817) (-642.702) * (-643.761) (-641.658) (-644.252) [-640.180] -- 0:00:49
182500 -- (-643.028) (-643.292) (-643.316) [-641.363] * (-640.480) [-640.670] (-644.948) (-641.197) -- 0:00:49
183000 -- (-643.596) [-641.281] (-643.772) (-642.820) * [-641.212] (-642.603) (-643.261) (-640.377) -- 0:00:49
183500 -- (-642.022) (-640.805) (-640.018) [-641.609] * (-642.246) [-643.254] (-642.374) (-639.833) -- 0:00:48
184000 -- (-643.690) (-641.012) (-643.329) [-643.211] * (-642.333) (-641.649) (-641.682) [-640.924] -- 0:00:48
184500 -- (-645.029) (-643.732) (-642.134) [-642.703] * (-643.086) (-640.845) (-641.011) [-641.224] -- 0:00:48
185000 -- (-642.174) (-642.618) [-641.864] (-642.374) * (-640.684) (-641.799) [-640.873] (-642.164) -- 0:00:48
Average standard deviation of split frequencies: 0.014784
185500 -- [-641.176] (-640.778) (-642.725) (-644.354) * (-640.145) (-641.897) (-640.902) [-640.074] -- 0:00:48
186000 -- (-644.937) (-641.036) (-643.184) [-641.474] * (-641.446) [-645.425] (-647.022) (-640.194) -- 0:00:48
186500 -- (-640.428) (-640.583) (-642.302) [-640.707] * (-641.398) (-642.916) [-640.588] (-642.031) -- 0:00:47
187000 -- [-641.021] (-640.419) (-643.771) (-642.215) * [-640.640] (-643.836) (-641.219) (-646.383) -- 0:00:47
187500 -- (-644.421) (-640.366) (-640.815) [-641.016] * (-644.287) [-644.159] (-642.547) (-645.761) -- 0:00:47
188000 -- (-641.273) [-640.725] (-642.652) (-641.723) * [-641.880] (-641.916) (-641.782) (-642.095) -- 0:00:47
188500 -- (-641.949) (-641.561) [-642.299] (-641.632) * (-641.579) [-641.906] (-641.921) (-640.578) -- 0:00:47
189000 -- (-642.647) [-640.228] (-644.617) (-642.554) * [-641.043] (-642.710) (-645.470) (-640.923) -- 0:00:47
189500 -- [-642.559] (-644.928) (-644.552) (-644.122) * (-645.898) (-640.809) (-642.560) [-641.687] -- 0:00:47
190000 -- (-639.905) (-640.672) (-642.076) [-643.101] * [-642.492] (-641.565) (-645.695) (-644.336) -- 0:00:46
Average standard deviation of split frequencies: 0.016620
190500 -- [-640.718] (-641.501) (-644.216) (-645.259) * (-644.977) (-643.326) (-643.246) [-641.097] -- 0:00:46
191000 -- (-643.285) (-641.791) (-641.525) [-639.952] * [-644.738] (-643.279) (-641.202) (-643.723) -- 0:00:46
191500 -- [-641.022] (-642.449) (-644.906) (-642.926) * (-639.744) (-646.420) [-647.285] (-641.986) -- 0:00:46
192000 -- (-640.801) (-641.131) [-642.885] (-641.729) * [-640.948] (-644.925) (-641.072) (-643.769) -- 0:00:46
192500 -- (-641.838) [-642.639] (-644.170) (-644.350) * (-641.444) (-641.028) [-642.089] (-641.968) -- 0:00:46
193000 -- (-642.731) (-640.202) (-644.886) [-642.324] * (-641.367) (-643.157) (-640.520) [-640.406] -- 0:00:45
193500 -- (-640.713) (-644.619) (-641.665) [-641.564] * (-641.942) (-642.561) (-641.372) [-641.210] -- 0:00:50
194000 -- (-645.399) [-644.120] (-640.675) (-642.488) * (-644.306) [-642.970] (-641.937) (-642.696) -- 0:00:49
194500 -- [-639.915] (-644.639) (-641.848) (-641.957) * (-640.073) (-641.559) (-640.556) [-641.673] -- 0:00:49
195000 -- [-640.702] (-649.406) (-643.743) (-641.062) * [-639.838] (-641.296) (-641.104) (-640.001) -- 0:00:49
Average standard deviation of split frequencies: 0.016569
195500 -- (-645.410) (-641.569) (-643.837) [-643.008] * (-640.381) (-642.260) (-647.038) [-642.815] -- 0:00:49
196000 -- (-643.271) [-645.917] (-642.148) (-645.937) * (-641.545) [-641.476] (-640.082) (-643.560) -- 0:00:49
196500 -- (-640.501) [-642.345] (-643.332) (-642.614) * (-643.019) (-641.837) (-641.707) [-642.065] -- 0:00:49
197000 -- (-642.848) (-640.774) [-641.067] (-641.273) * (-642.540) (-641.030) [-641.574] (-639.848) -- 0:00:48
197500 -- [-643.122] (-642.540) (-640.650) (-642.771) * (-643.063) (-640.942) (-641.350) [-640.359] -- 0:00:48
198000 -- [-640.221] (-643.245) (-643.977) (-641.362) * (-642.025) (-640.744) (-646.897) [-640.569] -- 0:00:48
198500 -- (-640.986) [-640.661] (-644.169) (-641.919) * (-640.400) [-644.318] (-640.627) (-641.131) -- 0:00:48
199000 -- (-642.740) (-640.616) (-640.172) [-643.744] * (-641.017) [-640.976] (-640.398) (-643.618) -- 0:00:48
199500 -- [-642.366] (-648.197) (-641.337) (-650.970) * (-640.939) (-640.133) (-642.929) [-642.132] -- 0:00:48
200000 -- [-640.248] (-641.668) (-643.684) (-642.148) * (-646.858) [-641.140] (-643.029) (-641.529) -- 0:00:48
Average standard deviation of split frequencies: 0.015270
200500 -- [-645.247] (-642.537) (-642.112) (-641.071) * [-640.722] (-642.143) (-645.103) (-644.778) -- 0:00:47
201000 -- (-643.620) (-642.703) (-641.909) [-643.425] * [-642.114] (-641.973) (-644.675) (-641.786) -- 0:00:47
201500 -- (-646.207) (-644.122) (-644.478) [-641.409] * (-644.598) (-646.587) (-642.314) [-641.525] -- 0:00:47
202000 -- (-643.512) (-641.992) (-642.849) [-643.632] * (-642.055) (-642.794) [-641.341] (-642.723) -- 0:00:47
202500 -- [-640.736] (-641.387) (-641.604) (-641.150) * (-643.720) (-641.818) (-644.539) [-642.031] -- 0:00:47
203000 -- [-640.749] (-640.652) (-640.655) (-644.148) * (-642.833) [-640.226] (-642.443) (-642.595) -- 0:00:47
203500 -- (-640.642) (-644.093) [-641.118] (-641.825) * [-640.750] (-640.571) (-639.718) (-643.282) -- 0:00:46
204000 -- (-643.241) [-641.615] (-646.073) (-640.393) * (-641.771) [-641.967] (-640.548) (-642.028) -- 0:00:46
204500 -- [-642.725] (-643.035) (-643.929) (-641.623) * [-641.232] (-643.493) (-641.588) (-640.116) -- 0:00:46
205000 -- (-643.088) (-641.326) [-642.861] (-643.224) * (-641.186) [-640.849] (-642.025) (-639.948) -- 0:00:46
Average standard deviation of split frequencies: 0.015256
205500 -- (-646.346) [-643.222] (-641.210) (-640.757) * (-641.462) (-640.380) (-643.020) [-642.377] -- 0:00:46
206000 -- (-642.922) [-643.113] (-643.791) (-642.878) * [-641.036] (-639.901) (-642.949) (-641.317) -- 0:00:46
206500 -- (-640.246) [-644.461] (-642.278) (-642.677) * (-640.399) [-641.347] (-640.789) (-641.967) -- 0:00:46
207000 -- (-640.897) (-641.994) (-641.903) [-641.528] * (-642.778) [-642.019] (-643.907) (-641.983) -- 0:00:45
207500 -- (-640.502) [-642.980] (-641.847) (-640.850) * (-643.961) (-642.075) (-643.332) [-640.620] -- 0:00:45
208000 -- (-641.374) (-641.094) (-641.836) [-641.210] * [-642.558] (-641.345) (-642.448) (-641.629) -- 0:00:45
208500 -- (-642.783) (-641.803) [-640.493] (-642.270) * (-641.277) (-641.870) [-642.425] (-642.705) -- 0:00:45
209000 -- (-645.851) (-641.640) [-641.051] (-640.045) * (-639.809) (-645.239) (-644.793) [-640.438] -- 0:00:45
209500 -- (-647.027) (-646.016) [-642.199] (-639.715) * [-640.634] (-641.278) (-645.430) (-643.430) -- 0:00:45
210000 -- (-642.188) (-642.681) (-643.243) [-640.504] * [-641.794] (-641.348) (-641.172) (-641.338) -- 0:00:45
Average standard deviation of split frequencies: 0.013302
210500 -- [-642.419] (-642.832) (-643.709) (-641.329) * [-640.388] (-643.142) (-640.347) (-641.991) -- 0:00:48
211000 -- (-642.984) (-645.819) [-642.648] (-643.646) * (-641.236) (-642.466) (-642.549) [-641.369] -- 0:00:48
211500 -- (-642.593) (-643.964) [-640.253] (-640.968) * (-642.855) (-642.834) [-642.322] (-644.976) -- 0:00:48
212000 -- (-640.032) (-641.554) [-640.866] (-640.686) * (-645.323) [-641.155] (-643.835) (-644.849) -- 0:00:48
212500 -- (-641.347) (-640.944) (-643.933) [-642.431] * (-643.790) (-643.109) [-639.977] (-644.815) -- 0:00:48
213000 -- [-640.878] (-641.215) (-642.133) (-641.256) * (-643.726) (-642.332) [-640.030] (-643.115) -- 0:00:48
213500 -- (-639.866) (-644.668) [-640.622] (-640.992) * (-644.791) [-643.030] (-642.436) (-640.062) -- 0:00:47
214000 -- [-641.466] (-643.110) (-641.480) (-644.692) * [-642.300] (-639.694) (-641.151) (-644.087) -- 0:00:47
214500 -- (-641.816) (-641.791) (-640.879) [-641.895] * (-644.302) (-645.133) [-641.477] (-644.698) -- 0:00:47
215000 -- (-644.751) (-641.738) (-641.146) [-643.267] * (-641.795) [-644.224] (-644.278) (-642.377) -- 0:00:47
Average standard deviation of split frequencies: 0.012838
215500 -- (-646.866) (-642.852) (-645.038) [-641.004] * [-645.140] (-643.041) (-643.310) (-645.862) -- 0:00:47
216000 -- [-642.600] (-642.679) (-642.168) (-641.894) * [-641.945] (-642.744) (-642.007) (-644.313) -- 0:00:47
216500 -- (-640.968) (-641.466) (-641.292) [-641.849] * (-647.635) [-641.155] (-644.862) (-644.388) -- 0:00:47
217000 -- (-640.636) (-640.543) [-644.140] (-643.745) * (-641.306) (-644.649) [-643.432] (-641.046) -- 0:00:46
217500 -- [-641.935] (-640.652) (-643.885) (-641.528) * [-639.905] (-644.604) (-642.568) (-642.131) -- 0:00:46
218000 -- (-640.846) (-641.888) [-643.607] (-640.540) * (-643.682) [-641.979] (-644.420) (-640.268) -- 0:00:46
218500 -- (-644.283) (-641.425) [-643.592] (-642.158) * (-641.746) (-644.228) [-640.417] (-640.364) -- 0:00:46
219000 -- (-642.666) (-641.119) [-644.669] (-645.534) * (-643.792) (-644.264) [-641.526] (-642.359) -- 0:00:46
219500 -- (-643.723) (-643.398) [-640.912] (-644.651) * (-649.667) [-642.704] (-641.978) (-643.201) -- 0:00:46
220000 -- (-643.122) [-642.805] (-640.632) (-640.789) * (-641.257) [-643.484] (-642.201) (-641.333) -- 0:00:46
Average standard deviation of split frequencies: 0.012064
220500 -- (-646.928) (-640.810) (-640.879) [-641.359] * [-642.345] (-641.734) (-641.232) (-642.920) -- 0:00:45
221000 -- (-645.380) [-643.507] (-644.328) (-642.123) * [-642.231] (-642.709) (-640.397) (-652.624) -- 0:00:45
221500 -- (-643.574) (-640.985) (-640.287) [-641.531] * (-642.603) (-647.425) [-642.230] (-641.950) -- 0:00:45
222000 -- (-645.356) [-643.849] (-640.298) (-640.902) * (-641.957) (-642.467) [-643.493] (-641.338) -- 0:00:45
222500 -- (-642.459) [-641.337] (-644.842) (-640.100) * (-644.893) (-640.084) [-640.850] (-642.009) -- 0:00:45
223000 -- (-642.028) (-641.959) [-642.753] (-643.375) * (-643.211) [-641.322] (-641.998) (-640.996) -- 0:00:45
223500 -- (-641.438) (-643.739) [-643.745] (-642.115) * (-644.038) (-640.579) [-640.783] (-640.828) -- 0:00:45
224000 -- (-640.152) (-642.097) [-643.822] (-646.201) * (-643.732) (-640.345) (-640.455) [-640.456] -- 0:00:45
224500 -- (-641.433) (-640.271) (-642.635) [-641.416] * [-640.862] (-640.072) (-642.694) (-641.002) -- 0:00:44
225000 -- (-642.890) [-641.413] (-643.886) (-644.170) * (-642.187) [-641.102] (-643.686) (-640.477) -- 0:00:44
Average standard deviation of split frequencies: 0.012399
225500 -- (-643.943) (-641.644) (-643.175) [-641.970] * (-641.122) [-641.013] (-640.667) (-642.368) -- 0:00:44
226000 -- (-640.337) [-646.235] (-643.484) (-643.154) * (-640.357) (-643.268) [-640.907] (-643.072) -- 0:00:47
226500 -- (-641.224) (-640.600) (-646.572) [-642.393] * [-642.515] (-641.585) (-643.087) (-641.905) -- 0:00:47
227000 -- (-642.118) (-642.521) (-642.869) [-643.098] * [-642.455] (-643.874) (-644.345) (-646.447) -- 0:00:47
227500 -- [-641.458] (-641.458) (-640.654) (-643.540) * (-644.012) [-646.348] (-641.812) (-641.879) -- 0:00:47
228000 -- [-640.901] (-640.916) (-641.564) (-641.826) * (-645.055) (-642.155) [-641.779] (-641.703) -- 0:00:47
228500 -- (-643.074) (-643.801) (-643.110) [-644.807] * (-640.285) (-641.994) [-642.172] (-641.508) -- 0:00:47
229000 -- (-641.777) (-647.088) [-641.920] (-642.605) * [-643.959] (-642.254) (-644.309) (-640.554) -- 0:00:47
229500 -- (-644.408) (-644.116) (-641.832) [-642.533] * (-641.489) (-641.545) [-641.240] (-642.927) -- 0:00:47
230000 -- [-641.165] (-641.306) (-641.742) (-643.371) * (-641.799) (-642.840) [-643.540] (-642.945) -- 0:00:46
Average standard deviation of split frequencies: 0.012376
230500 -- [-642.194] (-641.720) (-646.501) (-640.642) * (-648.703) [-644.319] (-640.316) (-642.181) -- 0:00:46
231000 -- (-640.411) [-641.991] (-644.272) (-640.566) * (-641.906) [-640.147] (-642.112) (-642.697) -- 0:00:46
231500 -- (-640.764) [-642.958] (-640.411) (-642.801) * (-641.980) (-641.334) [-640.482] (-640.992) -- 0:00:46
232000 -- (-642.596) [-643.426] (-641.073) (-641.969) * (-643.340) (-641.298) [-640.355] (-642.122) -- 0:00:46
232500 -- (-643.612) (-643.583) [-641.914] (-641.886) * (-643.730) (-642.500) [-642.360] (-647.246) -- 0:00:46
233000 -- (-643.728) [-643.806] (-643.010) (-641.773) * (-646.897) (-641.062) [-642.678] (-642.893) -- 0:00:46
233500 -- (-640.290) (-642.913) [-641.017] (-644.244) * (-643.107) (-641.308) [-641.241] (-642.771) -- 0:00:45
234000 -- [-642.150] (-644.988) (-643.679) (-644.027) * (-645.770) [-640.667] (-642.723) (-641.445) -- 0:00:45
234500 -- (-641.751) (-640.668) [-641.158] (-643.056) * [-640.715] (-646.170) (-643.771) (-641.501) -- 0:00:45
235000 -- (-642.553) (-641.972) [-641.019] (-643.150) * (-640.762) (-640.977) (-642.010) [-641.447] -- 0:00:45
Average standard deviation of split frequencies: 0.012762
235500 -- (-641.444) (-643.780) (-643.768) [-645.738] * (-639.718) [-641.971] (-642.011) (-644.186) -- 0:00:45
236000 -- (-642.993) (-645.472) (-650.354) [-644.822] * (-642.507) [-643.566] (-644.005) (-641.407) -- 0:00:45
236500 -- [-640.648] (-641.976) (-644.033) (-644.600) * (-643.874) (-643.063) [-645.512] (-641.515) -- 0:00:45
237000 -- (-642.462) [-640.722] (-642.114) (-642.782) * (-645.760) (-642.434) (-645.143) [-642.563] -- 0:00:45
237500 -- (-644.059) [-642.171] (-641.896) (-642.998) * [-644.568] (-641.862) (-644.628) (-644.136) -- 0:00:44
238000 -- (-643.919) (-641.731) (-640.697) [-641.232] * (-640.922) (-644.350) [-641.204] (-642.319) -- 0:00:44
238500 -- (-644.313) [-641.046] (-642.922) (-642.846) * (-641.062) (-640.987) (-641.823) [-641.632] -- 0:00:44
239000 -- (-645.083) [-640.112] (-641.662) (-642.885) * (-644.175) (-640.505) (-640.867) [-641.835] -- 0:00:44
239500 -- (-642.900) [-641.170] (-644.128) (-643.019) * (-642.160) (-641.001) (-643.519) [-640.987] -- 0:00:44
240000 -- [-645.419] (-640.577) (-641.740) (-643.737) * (-641.197) [-640.861] (-643.950) (-640.492) -- 0:00:44
Average standard deviation of split frequencies: 0.014038
240500 -- (-642.035) (-641.256) (-642.920) [-646.834] * [-640.726] (-640.634) (-641.431) (-643.972) -- 0:00:44
241000 -- (-640.887) (-643.356) (-643.488) [-643.492] * (-645.804) (-643.096) (-642.341) [-641.534] -- 0:00:47
241500 -- (-643.115) (-645.234) [-642.537] (-643.150) * (-642.209) (-645.141) (-643.219) [-641.174] -- 0:00:47
242000 -- (-644.764) (-641.820) [-642.617] (-646.558) * (-644.344) (-642.496) [-642.528] (-641.820) -- 0:00:46
242500 -- (-640.358) (-640.216) (-644.459) [-640.738] * (-641.375) (-642.066) [-643.429] (-642.721) -- 0:00:46
243000 -- (-640.939) (-640.389) [-639.840] (-640.251) * (-642.624) [-642.151] (-641.182) (-640.611) -- 0:00:46
243500 -- (-645.239) (-640.898) [-641.045] (-643.526) * (-642.945) (-644.089) (-641.430) [-640.541] -- 0:00:46
244000 -- [-640.833] (-645.970) (-643.081) (-641.509) * (-640.674) [-644.373] (-640.900) (-641.199) -- 0:00:46
244500 -- [-643.055] (-641.337) (-641.558) (-640.843) * (-644.563) [-643.154] (-642.598) (-642.860) -- 0:00:46
245000 -- (-640.034) (-642.402) [-639.998] (-640.944) * (-642.186) [-641.521] (-641.826) (-642.103) -- 0:00:46
Average standard deviation of split frequencies: 0.013701
245500 -- (-642.304) [-640.813] (-639.998) (-645.093) * [-640.607] (-641.845) (-644.586) (-642.815) -- 0:00:46
246000 -- [-642.030] (-643.877) (-641.097) (-642.121) * [-640.751] (-642.723) (-644.722) (-640.209) -- 0:00:45
246500 -- (-645.543) (-641.572) [-642.629] (-639.917) * (-642.190) (-642.653) (-641.458) [-642.112] -- 0:00:45
247000 -- (-643.269) (-640.956) (-642.502) [-639.748] * (-640.154) (-640.565) (-640.830) [-641.787] -- 0:00:45
247500 -- (-643.296) (-642.465) [-641.607] (-644.803) * (-643.415) (-641.707) (-640.527) [-640.583] -- 0:00:45
248000 -- (-643.614) (-641.525) [-644.492] (-644.340) * (-640.320) (-641.580) [-643.032] (-640.649) -- 0:00:45
248500 -- (-642.833) (-643.765) (-643.406) [-642.258] * (-640.618) (-641.876) [-642.443] (-643.101) -- 0:00:45
249000 -- (-646.738) [-640.427] (-643.216) (-640.724) * [-641.954] (-641.238) (-643.136) (-643.972) -- 0:00:45
249500 -- [-640.055] (-641.266) (-643.234) (-640.498) * (-644.836) [-642.512] (-641.235) (-644.731) -- 0:00:45
250000 -- (-640.496) (-643.706) [-640.101] (-641.260) * (-643.769) (-643.539) (-643.632) [-640.560] -- 0:00:45
Average standard deviation of split frequencies: 0.013791
250500 -- (-645.231) (-643.946) (-644.692) [-642.684] * (-642.589) [-644.466] (-641.250) (-641.656) -- 0:00:44
251000 -- (-639.959) (-642.918) [-639.666] (-649.634) * (-642.793) [-642.737] (-644.110) (-645.049) -- 0:00:44
251500 -- (-641.223) (-641.018) [-640.816] (-645.233) * (-643.047) (-641.036) (-643.355) [-641.003] -- 0:00:44
252000 -- (-641.608) (-643.392) [-640.310] (-645.798) * (-641.466) (-642.537) [-641.796] (-642.090) -- 0:00:44
252500 -- [-641.119] (-644.327) (-641.111) (-647.323) * (-642.471) (-641.175) (-644.840) [-641.883] -- 0:00:44
253000 -- [-640.633] (-640.267) (-643.000) (-640.857) * (-641.607) [-643.375] (-641.222) (-642.728) -- 0:00:44
253500 -- (-641.941) [-644.864] (-641.607) (-640.371) * (-641.559) [-640.981] (-640.584) (-643.786) -- 0:00:44
254000 -- (-640.355) [-644.230] (-641.406) (-647.025) * (-640.082) (-643.774) (-643.152) [-642.025] -- 0:00:44
254500 -- [-642.084] (-641.947) (-641.386) (-644.867) * (-644.404) (-641.493) [-640.442] (-641.872) -- 0:00:43
255000 -- (-641.974) (-641.758) (-642.002) [-642.764] * [-641.565] (-641.300) (-642.738) (-641.661) -- 0:00:43
Average standard deviation of split frequencies: 0.015550
255500 -- (-640.241) (-643.146) [-640.739] (-642.858) * (-641.465) [-643.360] (-646.234) (-642.500) -- 0:00:43
256000 -- (-643.026) (-648.460) [-640.196] (-642.893) * (-640.422) [-640.678] (-643.690) (-643.363) -- 0:00:43
256500 -- (-642.937) [-644.796] (-644.759) (-640.186) * [-641.849] (-640.609) (-643.066) (-642.692) -- 0:00:46
257000 -- (-644.237) (-643.720) [-640.783] (-640.166) * [-641.324] (-640.756) (-642.136) (-642.793) -- 0:00:46
257500 -- [-642.835] (-644.132) (-640.828) (-641.820) * [-641.762] (-642.202) (-643.705) (-642.200) -- 0:00:46
258000 -- (-640.983) (-644.732) (-643.250) [-643.615] * (-645.992) (-641.927) (-643.976) [-640.855] -- 0:00:46
258500 -- (-642.420) (-641.306) (-643.688) [-641.350] * [-641.344] (-640.240) (-640.289) (-640.366) -- 0:00:45
259000 -- [-645.260] (-640.321) (-642.523) (-644.143) * (-641.848) (-642.140) (-643.242) [-644.107] -- 0:00:45
259500 -- (-639.869) [-641.616] (-642.776) (-643.284) * (-644.414) [-640.687] (-644.904) (-646.312) -- 0:00:45
260000 -- (-641.477) (-642.550) (-642.805) [-642.030] * (-646.824) [-643.781] (-641.117) (-642.658) -- 0:00:45
Average standard deviation of split frequencies: 0.013865
260500 -- (-641.649) (-644.906) [-640.158] (-642.110) * [-643.439] (-640.921) (-650.248) (-644.607) -- 0:00:45
261000 -- (-641.882) (-641.894) (-642.530) [-643.697] * (-641.788) [-640.518] (-646.246) (-643.094) -- 0:00:45
261500 -- (-644.080) (-640.665) (-641.663) [-641.898] * [-639.881] (-641.419) (-641.062) (-643.840) -- 0:00:45
262000 -- [-641.732] (-641.674) (-641.101) (-641.658) * (-640.252) (-642.755) (-641.368) [-642.144] -- 0:00:45
262500 -- (-645.476) [-640.737] (-642.941) (-641.286) * (-642.371) [-643.089] (-644.411) (-645.222) -- 0:00:44
263000 -- [-640.670] (-640.287) (-643.448) (-641.519) * (-642.364) (-645.922) (-649.914) [-640.618] -- 0:00:44
263500 -- (-644.236) (-641.193) [-642.146] (-641.993) * (-641.891) (-641.016) [-642.675] (-641.699) -- 0:00:44
264000 -- [-644.228] (-642.080) (-651.018) (-644.338) * (-643.529) (-643.244) [-642.898] (-643.060) -- 0:00:44
264500 -- (-641.124) (-640.469) (-639.900) [-643.085] * [-641.041] (-641.772) (-640.235) (-640.691) -- 0:00:44
265000 -- (-641.056) (-640.467) (-642.992) [-640.599] * (-641.874) [-639.752] (-644.747) (-643.974) -- 0:00:44
Average standard deviation of split frequencies: 0.013991
265500 -- [-642.240] (-642.681) (-642.187) (-640.195) * [-640.925] (-647.836) (-641.632) (-640.546) -- 0:00:44
266000 -- (-645.140) [-642.285] (-641.204) (-643.610) * (-641.910) [-640.850] (-647.496) (-641.473) -- 0:00:44
266500 -- (-643.006) [-639.879] (-640.737) (-642.110) * (-642.850) [-642.263] (-645.867) (-641.161) -- 0:00:44
267000 -- (-642.351) (-643.611) [-643.257] (-641.843) * (-642.206) (-639.857) [-641.352] (-641.193) -- 0:00:43
267500 -- (-642.649) (-645.750) (-641.081) [-641.265] * [-640.349] (-641.191) (-642.957) (-644.872) -- 0:00:43
268000 -- (-642.041) (-644.039) (-643.835) [-641.991] * (-642.769) (-643.880) (-642.778) [-645.093] -- 0:00:43
268500 -- [-642.233] (-645.819) (-643.785) (-646.980) * (-641.483) (-644.761) [-642.471] (-641.040) -- 0:00:43
269000 -- [-643.354] (-642.269) (-642.167) (-643.447) * (-640.663) (-643.535) (-642.471) [-641.920] -- 0:00:43
269500 -- (-640.861) [-640.640] (-640.850) (-645.437) * [-640.677] (-642.343) (-641.311) (-641.605) -- 0:00:43
270000 -- (-640.619) [-641.232] (-640.509) (-643.220) * (-643.351) [-640.856] (-642.152) (-641.466) -- 0:00:43
Average standard deviation of split frequencies: 0.014804
270500 -- (-641.405) [-641.837] (-641.655) (-641.774) * [-647.189] (-641.684) (-641.631) (-641.419) -- 0:00:43
271000 -- (-641.993) [-640.165] (-641.643) (-644.468) * (-647.122) [-641.446] (-641.536) (-640.509) -- 0:00:43
271500 -- [-640.745] (-642.399) (-641.830) (-641.033) * (-644.219) (-640.298) [-640.843] (-640.315) -- 0:00:42
272000 -- (-645.016) [-642.708] (-640.486) (-639.672) * (-642.408) (-641.369) (-641.533) [-646.196] -- 0:00:42
272500 -- (-641.330) (-641.631) (-640.218) [-641.077] * (-641.837) (-641.213) [-643.273] (-642.621) -- 0:00:42
273000 -- (-640.967) [-640.101] (-642.477) (-640.673) * (-641.280) (-640.556) [-642.259] (-643.618) -- 0:00:42
273500 -- (-641.305) (-642.274) (-643.225) [-642.404] * (-641.841) (-641.215) [-641.048] (-640.554) -- 0:00:45
274000 -- (-642.130) [-642.729] (-640.839) (-642.429) * [-641.719] (-640.360) (-641.614) (-647.495) -- 0:00:45
274500 -- (-644.515) (-642.060) [-640.373] (-644.303) * [-640.343] (-641.035) (-641.769) (-650.535) -- 0:00:44
275000 -- [-642.455] (-642.879) (-642.386) (-641.935) * (-641.156) (-641.265) (-642.239) [-641.654] -- 0:00:44
Average standard deviation of split frequencies: 0.013854
275500 -- (-642.423) [-641.057] (-643.550) (-642.732) * (-640.827) (-643.533) (-645.676) [-642.770] -- 0:00:44
276000 -- (-644.470) [-641.828] (-643.213) (-654.592) * [-642.038] (-644.132) (-642.623) (-643.775) -- 0:00:44
276500 -- (-643.502) (-643.511) [-641.731] (-645.517) * [-640.629] (-646.040) (-642.550) (-641.612) -- 0:00:44
277000 -- (-643.499) [-642.123] (-641.665) (-642.787) * (-642.427) (-644.673) (-641.808) [-642.957] -- 0:00:44
277500 -- [-641.611] (-643.004) (-640.184) (-644.127) * (-640.829) (-642.021) [-642.819] (-645.904) -- 0:00:44
278000 -- (-645.451) (-641.827) (-640.849) [-642.405] * (-642.159) (-643.936) (-642.698) [-640.020] -- 0:00:44
278500 -- (-643.150) (-640.975) (-641.349) [-642.381] * (-640.955) (-643.226) [-643.719] (-645.443) -- 0:00:44
279000 -- (-642.136) (-643.641) (-644.525) [-643.127] * (-640.528) (-644.573) (-640.388) [-640.457] -- 0:00:43
279500 -- (-644.536) (-643.452) (-644.292) [-642.110] * (-643.408) (-647.057) (-640.853) [-644.085] -- 0:00:43
280000 -- (-641.391) (-640.686) (-646.640) [-644.918] * [-640.858] (-648.000) (-640.536) (-641.784) -- 0:00:43
Average standard deviation of split frequencies: 0.014836
280500 -- (-641.551) [-641.856] (-641.763) (-649.145) * (-642.637) (-642.896) [-642.416] (-641.175) -- 0:00:43
281000 -- [-642.955] (-640.517) (-643.425) (-642.252) * (-642.985) (-642.781) [-643.031] (-643.084) -- 0:00:43
281500 -- (-644.867) (-641.262) [-640.116] (-642.101) * (-641.818) (-645.129) (-640.147) [-640.893] -- 0:00:43
282000 -- (-649.682) (-641.723) [-642.695] (-642.081) * (-640.346) (-640.647) [-642.134] (-640.616) -- 0:00:43
282500 -- (-643.849) (-641.587) (-641.880) [-642.065] * (-639.768) [-644.750] (-643.701) (-641.408) -- 0:00:43
283000 -- (-642.482) (-643.602) (-640.937) [-642.846] * (-641.155) (-645.165) [-640.401] (-640.420) -- 0:00:43
283500 -- [-642.754] (-644.526) (-640.988) (-641.176) * (-643.740) (-640.386) [-640.772] (-641.797) -- 0:00:42
284000 -- [-642.965] (-641.650) (-645.801) (-646.213) * (-642.601) (-640.482) [-642.256] (-640.243) -- 0:00:42
284500 -- (-642.921) [-643.171] (-639.787) (-641.844) * (-640.548) (-642.365) [-642.908] (-640.243) -- 0:00:42
285000 -- (-640.696) [-644.788] (-642.433) (-643.243) * (-640.728) [-643.383] (-640.837) (-641.811) -- 0:00:42
Average standard deviation of split frequencies: 0.014193
285500 -- (-643.493) (-643.925) [-641.017] (-643.144) * [-639.965] (-640.934) (-642.154) (-640.524) -- 0:00:42
286000 -- (-640.826) (-641.648) (-641.025) [-641.253] * (-640.145) (-640.930) [-641.367] (-641.089) -- 0:00:42
286500 -- (-643.320) (-641.261) (-640.501) [-640.186] * [-642.275] (-642.496) (-641.701) (-642.351) -- 0:00:42
287000 -- (-643.698) (-641.911) [-641.048] (-641.062) * (-641.846) [-642.711] (-645.065) (-643.092) -- 0:00:42
287500 -- (-641.650) (-642.444) (-644.069) [-641.123] * (-643.622) (-643.775) (-645.136) [-643.103] -- 0:00:42
288000 -- (-641.748) (-641.001) [-641.294] (-644.510) * (-646.204) [-641.925] (-644.593) (-644.088) -- 0:00:42
288500 -- (-640.656) (-644.565) (-643.400) [-643.437] * (-640.917) (-640.903) (-641.288) [-643.310] -- 0:00:41
289000 -- (-640.625) (-642.454) (-641.780) [-641.546] * [-642.601] (-644.415) (-641.087) (-641.859) -- 0:00:41
289500 -- [-641.381] (-643.662) (-643.861) (-640.500) * (-644.786) (-644.640) [-645.647] (-641.292) -- 0:00:44
290000 -- (-643.201) [-640.205] (-644.418) (-640.231) * (-641.964) (-640.652) [-644.381] (-640.380) -- 0:00:44
Average standard deviation of split frequencies: 0.013245
290500 -- (-642.389) [-643.357] (-644.349) (-640.830) * (-641.732) [-643.534] (-643.363) (-640.135) -- 0:00:43
291000 -- (-640.721) (-642.315) (-641.958) [-642.430] * (-645.766) (-643.325) [-642.330] (-640.160) -- 0:00:43
291500 -- (-640.683) (-644.100) (-641.479) [-643.260] * (-643.924) [-640.725] (-641.632) (-640.975) -- 0:00:43
292000 -- [-641.057] (-642.085) (-642.121) (-639.758) * (-642.686) (-643.128) [-640.236] (-643.681) -- 0:00:43
292500 -- (-644.608) [-641.988] (-639.947) (-641.262) * (-642.661) (-642.982) [-641.576] (-643.067) -- 0:00:43
293000 -- [-641.202] (-640.128) (-642.994) (-641.674) * (-643.485) (-641.338) (-643.679) [-643.501] -- 0:00:43
293500 -- (-641.221) (-643.387) [-643.426] (-643.394) * (-642.343) (-643.126) (-642.372) [-640.982] -- 0:00:43
294000 -- (-644.768) (-643.148) [-642.400] (-641.663) * (-642.182) (-644.155) (-641.541) [-642.080] -- 0:00:43
294500 -- (-641.610) [-643.296] (-640.752) (-641.203) * (-644.240) (-642.484) (-641.379) [-642.120] -- 0:00:43
295000 -- (-643.202) (-642.078) [-640.142] (-645.003) * (-641.505) (-642.913) [-641.399] (-641.663) -- 0:00:43
Average standard deviation of split frequencies: 0.012829
295500 -- (-641.519) (-641.704) [-642.727] (-643.505) * (-641.550) (-646.186) [-641.252] (-640.793) -- 0:00:42
296000 -- (-648.878) (-641.967) [-640.311] (-643.299) * (-642.190) (-641.937) [-642.578] (-640.178) -- 0:00:42
296500 -- (-646.703) (-641.050) [-644.517] (-642.886) * [-641.132] (-639.863) (-640.631) (-641.763) -- 0:00:42
297000 -- (-642.956) (-641.986) [-641.627] (-642.890) * (-642.081) (-641.245) [-640.208] (-642.740) -- 0:00:42
297500 -- (-641.973) (-639.943) [-644.800] (-645.292) * (-640.913) (-642.731) [-643.598] (-640.638) -- 0:00:42
298000 -- (-641.832) (-641.767) [-642.892] (-640.757) * (-640.395) (-641.472) (-641.184) [-643.121] -- 0:00:42
298500 -- (-642.610) [-642.075] (-643.138) (-641.574) * (-640.188) (-645.002) (-642.808) [-640.540] -- 0:00:42
299000 -- (-640.730) (-641.157) (-642.109) [-640.481] * (-643.070) [-643.872] (-644.681) (-641.082) -- 0:00:42
299500 -- (-640.843) (-642.112) (-642.976) [-641.223] * [-642.060] (-646.072) (-641.314) (-642.363) -- 0:00:42
300000 -- (-641.733) [-643.829] (-642.789) (-641.161) * (-641.995) (-643.313) [-641.595] (-643.309) -- 0:00:42
Average standard deviation of split frequencies: 0.014633
300500 -- (-641.507) [-642.821] (-642.096) (-641.112) * (-641.468) (-644.465) (-642.744) [-642.282] -- 0:00:41
301000 -- [-641.148] (-644.408) (-641.561) (-643.562) * (-644.276) (-648.018) [-642.180] (-642.989) -- 0:00:41
301500 -- (-641.999) (-641.232) (-642.328) [-642.233] * (-641.935) [-642.910] (-642.701) (-642.812) -- 0:00:41
302000 -- (-642.219) (-642.212) (-643.024) [-642.280] * (-643.836) [-642.362] (-641.275) (-641.450) -- 0:00:41
302500 -- [-641.909] (-641.467) (-642.489) (-644.154) * (-643.500) (-641.519) (-640.132) [-641.040] -- 0:00:41
303000 -- (-640.280) (-644.954) (-643.334) [-640.540] * (-643.392) (-640.050) [-640.457] (-640.934) -- 0:00:41
303500 -- [-642.727] (-642.800) (-642.373) (-641.027) * (-642.242) (-641.304) [-640.178] (-645.940) -- 0:00:41
304000 -- (-640.539) (-641.950) [-645.961] (-640.274) * (-642.218) (-643.119) (-641.296) [-641.223] -- 0:00:41
304500 -- (-642.016) (-641.446) [-644.332] (-641.250) * (-641.031) [-643.232] (-642.822) (-643.019) -- 0:00:41
305000 -- (-642.228) (-644.256) (-643.133) [-642.692] * (-641.175) (-642.976) (-641.193) [-643.141] -- 0:00:41
Average standard deviation of split frequencies: 0.014806
305500 -- [-642.436] (-644.486) (-641.306) (-642.610) * [-642.950] (-644.504) (-642.714) (-643.526) -- 0:00:40
306000 -- (-640.447) (-641.648) [-642.193] (-642.357) * (-642.762) [-643.846] (-650.352) (-642.884) -- 0:00:43
306500 -- [-640.611] (-642.273) (-643.064) (-644.156) * (-641.694) (-641.048) [-642.724] (-642.132) -- 0:00:42
307000 -- (-640.012) (-643.121) [-642.101] (-643.172) * (-644.094) (-641.085) (-642.765) [-642.411] -- 0:00:42
307500 -- (-641.085) (-642.310) (-641.867) [-642.918] * (-640.249) [-641.664] (-642.026) (-644.577) -- 0:00:42
308000 -- [-640.216] (-642.497) (-641.571) (-643.443) * [-640.744] (-641.326) (-643.677) (-643.670) -- 0:00:42
308500 -- (-641.636) [-644.101] (-640.036) (-643.921) * (-641.785) (-644.872) (-643.855) [-643.538] -- 0:00:42
309000 -- (-643.828) [-641.874] (-640.148) (-644.893) * (-640.591) (-643.446) (-640.398) [-641.867] -- 0:00:42
309500 -- [-641.467] (-643.792) (-639.937) (-641.835) * (-640.413) [-642.886] (-642.223) (-642.380) -- 0:00:42
310000 -- [-642.671] (-646.308) (-645.771) (-647.077) * (-641.518) (-643.471) (-642.673) [-642.130] -- 0:00:42
Average standard deviation of split frequencies: 0.012898
310500 -- (-643.221) (-645.650) [-645.164] (-645.124) * (-640.493) [-641.802] (-642.497) (-641.114) -- 0:00:42
311000 -- (-643.982) [-641.303] (-643.001) (-644.286) * (-642.067) [-640.013] (-641.173) (-644.535) -- 0:00:42
311500 -- (-645.974) (-641.541) [-641.820] (-640.914) * (-645.758) (-643.826) (-641.716) [-644.883] -- 0:00:41
312000 -- (-646.366) (-644.674) [-643.150] (-640.690) * (-644.776) (-641.226) (-642.977) [-643.224] -- 0:00:41
312500 -- [-641.372] (-644.436) (-640.419) (-643.170) * [-641.263] (-641.226) (-642.213) (-642.235) -- 0:00:41
313000 -- (-646.947) [-640.388] (-642.006) (-643.038) * [-642.308] (-642.631) (-642.151) (-642.947) -- 0:00:41
313500 -- (-641.299) (-640.491) (-644.907) [-641.538] * [-641.690] (-640.895) (-642.839) (-644.092) -- 0:00:41
314000 -- (-642.833) [-641.556] (-643.196) (-644.122) * (-645.526) [-641.133] (-643.904) (-642.487) -- 0:00:41
314500 -- (-641.538) (-642.635) (-642.053) [-643.591] * (-649.194) (-644.232) (-642.165) [-641.012] -- 0:00:41
315000 -- (-640.422) (-641.654) (-643.569) [-642.035] * (-642.154) [-640.146] (-641.751) (-644.404) -- 0:00:41
Average standard deviation of split frequencies: 0.012955
315500 -- (-643.365) (-642.253) [-641.404] (-643.259) * (-643.425) (-644.735) (-640.933) [-640.433] -- 0:00:41
316000 -- [-640.748] (-646.848) (-640.307) (-641.107) * [-641.144] (-641.142) (-642.603) (-646.814) -- 0:00:41
316500 -- (-640.135) (-639.677) [-639.655] (-643.374) * (-641.402) (-641.690) (-641.814) [-643.099] -- 0:00:41
317000 -- (-640.526) (-641.073) [-643.323] (-647.651) * [-641.151] (-641.305) (-642.484) (-644.057) -- 0:00:40
317500 -- (-642.310) (-644.004) [-640.636] (-641.410) * (-642.530) [-643.008] (-642.980) (-641.685) -- 0:00:40
318000 -- (-640.480) (-643.369) [-641.710] (-641.780) * [-640.967] (-641.535) (-641.709) (-642.235) -- 0:00:40
318500 -- (-644.210) (-646.212) (-642.595) [-645.934] * (-643.250) [-640.346] (-640.988) (-644.497) -- 0:00:40
319000 -- [-641.506] (-643.174) (-644.444) (-643.738) * (-644.703) (-641.027) [-641.140] (-643.113) -- 0:00:40
319500 -- (-641.359) (-642.430) [-642.568] (-642.317) * (-643.935) (-645.087) [-641.644] (-643.610) -- 0:00:40
320000 -- (-642.587) (-643.928) [-642.580] (-641.082) * (-641.890) (-641.337) (-641.892) [-641.134] -- 0:00:40
Average standard deviation of split frequencies: 0.011242
320500 -- (-642.727) (-643.210) (-649.974) [-642.791] * (-642.497) (-640.478) [-640.832] (-641.882) -- 0:00:40
321000 -- (-642.326) [-645.227] (-641.993) (-641.415) * (-644.049) (-640.198) [-641.087] (-641.639) -- 0:00:40
321500 -- (-641.734) (-643.083) (-643.326) [-640.340] * (-640.516) [-640.226] (-642.472) (-641.762) -- 0:00:40
322000 -- (-640.826) (-647.619) [-640.912] (-641.842) * [-643.594] (-641.474) (-644.807) (-641.535) -- 0:00:40
322500 -- [-642.832] (-641.941) (-640.639) (-642.742) * (-641.094) [-642.773] (-643.200) (-640.265) -- 0:00:42
323000 -- (-640.688) [-642.155] (-642.239) (-641.318) * (-643.648) (-645.955) (-645.651) [-642.231] -- 0:00:41
323500 -- [-644.147] (-645.925) (-644.637) (-642.400) * (-641.034) (-647.361) (-640.568) [-641.436] -- 0:00:41
324000 -- (-645.324) [-645.624] (-641.536) (-640.410) * (-644.196) [-642.841] (-640.720) (-641.075) -- 0:00:41
324500 -- [-641.679] (-645.578) (-644.084) (-641.084) * (-640.495) (-641.862) [-641.099] (-642.090) -- 0:00:41
325000 -- (-643.078) (-643.559) [-641.496] (-642.256) * [-640.096] (-641.880) (-643.600) (-646.583) -- 0:00:41
Average standard deviation of split frequencies: 0.011809
325500 -- [-640.614] (-643.121) (-642.603) (-647.331) * (-641.212) (-640.196) [-645.463] (-645.179) -- 0:00:41
326000 -- (-641.605) (-642.180) [-642.910] (-641.657) * (-645.967) [-641.626] (-642.748) (-646.788) -- 0:00:41
326500 -- (-642.865) [-642.335] (-644.552) (-642.051) * (-641.772) (-642.563) [-641.127] (-645.308) -- 0:00:41
327000 -- (-642.180) (-644.354) [-640.011] (-641.984) * (-641.359) (-644.258) [-640.642] (-642.626) -- 0:00:41
327500 -- (-646.277) (-643.353) [-642.007] (-641.594) * (-643.256) [-643.347] (-641.915) (-641.419) -- 0:00:41
328000 -- (-643.848) [-641.786] (-642.366) (-643.084) * (-645.623) [-642.664] (-644.292) (-644.057) -- 0:00:40
328500 -- [-642.252] (-641.781) (-644.731) (-640.199) * (-641.094) (-641.502) (-641.519) [-642.521] -- 0:00:40
329000 -- (-644.439) [-648.757] (-642.282) (-641.288) * (-639.904) (-640.239) [-640.375] (-641.049) -- 0:00:40
329500 -- (-644.687) [-643.553] (-643.140) (-641.556) * [-641.330] (-640.915) (-641.883) (-642.257) -- 0:00:40
330000 -- [-645.628] (-641.743) (-642.757) (-641.236) * (-640.824) (-643.609) [-641.886] (-642.600) -- 0:00:40
Average standard deviation of split frequencies: 0.011326
330500 -- [-640.841] (-641.508) (-640.018) (-641.831) * (-640.543) (-640.741) [-642.437] (-644.872) -- 0:00:40
331000 -- (-642.674) [-640.697] (-640.492) (-640.940) * (-640.936) (-640.339) (-643.419) [-640.740] -- 0:00:40
331500 -- (-640.338) (-643.065) [-640.374] (-640.991) * (-640.838) [-647.202] (-640.866) (-641.272) -- 0:00:40
332000 -- (-640.668) (-640.745) (-641.869) [-640.762] * [-643.319] (-643.717) (-643.778) (-640.955) -- 0:00:40
332500 -- (-641.090) (-643.733) [-641.292] (-644.271) * (-642.262) (-641.835) (-642.508) [-640.358] -- 0:00:40
333000 -- (-639.903) [-643.861] (-642.258) (-643.168) * (-641.798) (-642.967) [-641.476] (-640.891) -- 0:00:40
333500 -- (-644.335) [-642.082] (-641.388) (-644.585) * (-641.779) (-642.590) [-642.295] (-644.122) -- 0:00:39
334000 -- [-644.707] (-641.955) (-639.828) (-642.197) * (-642.969) [-641.903] (-641.826) (-643.565) -- 0:00:39
334500 -- (-648.895) [-641.306] (-640.109) (-641.588) * (-640.577) (-646.114) [-641.112] (-641.339) -- 0:00:39
335000 -- (-644.044) [-640.364] (-644.277) (-640.533) * (-642.713) (-644.521) [-642.096] (-643.905) -- 0:00:39
Average standard deviation of split frequencies: 0.010234
335500 -- (-641.747) (-642.755) [-641.219] (-644.018) * [-642.313] (-642.923) (-640.229) (-646.863) -- 0:00:39
336000 -- (-644.631) (-640.881) (-641.408) [-641.017] * (-641.182) (-642.288) [-643.098] (-644.726) -- 0:00:39
336500 -- (-645.784) (-642.389) (-641.139) [-642.658] * (-641.254) (-640.490) [-641.602] (-642.847) -- 0:00:39
337000 -- (-646.572) [-640.583] (-640.284) (-643.738) * (-640.350) [-644.628] (-640.361) (-642.216) -- 0:00:39
337500 -- (-643.755) (-640.039) (-642.955) [-640.517] * (-640.047) (-640.943) [-640.346] (-642.960) -- 0:00:39
338000 -- (-646.934) (-642.884) (-644.144) [-646.497] * (-644.577) (-640.992) [-643.941] (-642.434) -- 0:00:39
338500 -- (-644.991) (-642.823) [-644.823] (-641.509) * (-643.453) (-640.480) (-642.879) [-641.223] -- 0:00:39
339000 -- [-642.765] (-641.240) (-643.805) (-643.401) * (-641.814) (-640.639) [-642.595] (-644.266) -- 0:00:38
339500 -- (-642.935) [-641.056] (-644.356) (-641.818) * (-639.973) (-644.323) [-642.561] (-643.678) -- 0:00:40
340000 -- [-640.225] (-641.047) (-641.751) (-643.971) * (-640.291) (-645.912) [-642.618] (-640.904) -- 0:00:40
Average standard deviation of split frequencies: 0.010012
340500 -- (-642.960) (-641.963) [-640.696] (-641.308) * [-640.836] (-644.161) (-642.379) (-641.958) -- 0:00:40
341000 -- (-641.452) [-641.524] (-640.897) (-639.820) * (-641.884) (-642.571) [-643.233] (-641.378) -- 0:00:40
341500 -- (-640.248) (-642.483) (-640.576) [-642.751] * (-643.359) [-641.729] (-643.705) (-640.773) -- 0:00:40
342000 -- [-639.976] (-639.854) (-640.656) (-643.604) * [-640.531] (-645.697) (-640.563) (-640.772) -- 0:00:40
342500 -- [-643.320] (-642.905) (-641.625) (-645.394) * [-642.114] (-643.381) (-640.790) (-641.147) -- 0:00:40
343000 -- [-640.843] (-641.921) (-640.581) (-643.827) * (-642.707) (-642.439) [-640.891] (-643.558) -- 0:00:40
343500 -- (-640.383) (-641.885) (-639.855) [-643.249] * [-642.731] (-642.796) (-641.993) (-647.532) -- 0:00:40
344000 -- (-645.755) (-644.312) (-640.485) [-640.980] * (-641.040) [-642.647] (-640.606) (-644.079) -- 0:00:40
344500 -- (-642.696) (-645.059) (-642.047) [-641.238] * (-641.791) [-641.578] (-643.902) (-643.464) -- 0:00:39
345000 -- (-640.152) [-640.562] (-641.196) (-640.991) * (-642.803) (-640.445) (-642.111) [-641.158] -- 0:00:39
Average standard deviation of split frequencies: 0.009056
345500 -- [-645.458] (-640.390) (-642.423) (-641.468) * [-644.371] (-641.766) (-642.917) (-640.224) -- 0:00:39
346000 -- [-644.267] (-643.120) (-642.360) (-640.597) * (-642.947) [-643.076] (-643.743) (-639.899) -- 0:00:39
346500 -- [-642.928] (-644.073) (-641.763) (-641.965) * [-641.749] (-641.884) (-641.372) (-641.046) -- 0:00:39
347000 -- (-647.338) (-640.392) [-643.066] (-643.861) * (-640.565) [-640.861] (-640.782) (-640.946) -- 0:00:39
347500 -- (-641.310) [-642.134] (-643.019) (-642.383) * (-641.099) (-640.760) (-643.536) [-641.192] -- 0:00:39
348000 -- (-642.358) [-640.676] (-643.849) (-642.862) * [-641.869] (-642.823) (-642.802) (-640.797) -- 0:00:39
348500 -- (-649.951) [-640.612] (-642.669) (-640.587) * (-643.182) (-641.057) [-640.887] (-641.008) -- 0:00:39
349000 -- (-642.220) (-643.489) (-641.050) [-640.877] * (-641.037) [-641.411] (-641.699) (-643.624) -- 0:00:39
349500 -- [-642.518] (-641.208) (-640.266) (-642.551) * (-643.700) (-642.501) (-640.935) [-643.568] -- 0:00:39
350000 -- (-642.651) [-641.076] (-641.976) (-640.953) * (-642.036) (-643.590) [-641.829] (-641.848) -- 0:00:39
Average standard deviation of split frequencies: 0.009015
350500 -- (-642.728) (-641.732) (-642.891) [-641.017] * (-641.878) (-644.097) (-645.159) [-640.726] -- 0:00:38
351000 -- (-645.341) (-642.180) [-651.983] (-640.707) * (-642.163) (-642.456) (-642.816) [-640.141] -- 0:00:38
351500 -- (-643.486) (-645.981) [-644.416] (-643.998) * (-642.548) (-645.631) [-641.111] (-642.004) -- 0:00:38
352000 -- [-640.034] (-640.231) (-641.185) (-642.987) * [-644.629] (-640.667) (-641.467) (-644.353) -- 0:00:38
352500 -- [-640.237] (-645.489) (-640.235) (-641.887) * [-640.742] (-640.127) (-641.714) (-644.381) -- 0:00:38
353000 -- [-642.498] (-642.775) (-639.907) (-642.077) * [-640.711] (-640.828) (-645.937) (-641.823) -- 0:00:38
353500 -- (-640.339) (-640.328) [-640.773] (-643.767) * (-640.353) (-641.287) [-642.670] (-642.471) -- 0:00:38
354000 -- (-643.875) (-644.404) [-641.195] (-642.446) * (-641.432) (-641.281) [-641.273] (-641.239) -- 0:00:38
354500 -- (-642.817) [-642.550] (-643.586) (-642.427) * (-641.001) [-640.985] (-643.501) (-643.484) -- 0:00:38
355000 -- (-641.274) (-642.909) [-646.143] (-642.074) * (-643.245) (-643.835) (-640.488) [-640.301] -- 0:00:38
Average standard deviation of split frequencies: 0.009036
355500 -- (-641.961) [-641.538] (-641.463) (-644.502) * (-643.002) [-640.932] (-641.995) (-641.458) -- 0:00:38
356000 -- (-644.522) (-643.192) [-640.611] (-642.450) * (-643.958) (-644.056) [-644.665] (-644.552) -- 0:00:39
356500 -- (-643.059) (-647.598) [-640.724] (-641.638) * (-640.364) (-641.197) (-642.069) [-642.033] -- 0:00:39
357000 -- (-641.681) (-643.874) [-641.714] (-641.057) * [-643.917] (-641.268) (-642.301) (-639.986) -- 0:00:39
357500 -- [-641.586] (-641.733) (-640.339) (-641.891) * (-641.665) [-639.790] (-646.440) (-643.102) -- 0:00:39
358000 -- (-642.288) (-641.878) [-641.924] (-640.892) * (-642.292) (-639.812) [-642.695] (-640.428) -- 0:00:39
358500 -- [-641.246] (-640.645) (-643.601) (-640.563) * [-643.158] (-641.240) (-642.598) (-640.725) -- 0:00:39
359000 -- (-647.607) [-643.488] (-643.697) (-640.768) * (-644.794) (-640.768) (-648.483) [-642.941] -- 0:00:39
359500 -- (-642.548) (-644.279) [-646.059] (-641.912) * (-643.022) (-644.529) [-641.284] (-641.978) -- 0:00:39
360000 -- [-645.569] (-641.036) (-644.331) (-642.613) * (-643.928) (-642.689) (-646.479) [-640.642] -- 0:00:39
Average standard deviation of split frequencies: 0.008919
360500 -- (-642.963) (-641.929) [-642.424] (-640.281) * [-643.714] (-640.456) (-644.611) (-641.996) -- 0:00:39
361000 -- (-644.253) (-640.671) (-641.832) [-641.388] * (-645.067) (-642.759) (-641.262) [-644.135] -- 0:00:38
361500 -- (-641.392) [-640.689] (-642.720) (-641.466) * (-642.564) (-644.687) (-640.968) [-646.981] -- 0:00:38
362000 -- (-640.187) [-639.772] (-641.609) (-642.068) * (-642.576) (-640.855) (-642.061) [-645.490] -- 0:00:38
362500 -- (-641.280) (-641.231) [-643.593] (-640.537) * (-641.438) (-639.965) (-641.374) [-642.810] -- 0:00:38
363000 -- [-641.248] (-642.700) (-643.417) (-641.617) * (-643.276) (-641.649) (-643.013) [-643.400] -- 0:00:38
363500 -- (-640.738) [-640.587] (-643.348) (-642.878) * (-643.711) [-640.684] (-642.003) (-641.154) -- 0:00:38
364000 -- (-641.183) [-645.131] (-640.617) (-641.714) * (-642.290) (-643.759) (-641.695) [-644.204] -- 0:00:38
364500 -- (-641.302) (-640.192) [-640.133] (-645.165) * [-641.893] (-645.069) (-641.862) (-643.033) -- 0:00:38
365000 -- (-641.528) [-642.069] (-640.333) (-645.854) * (-641.676) [-645.401] (-642.908) (-640.929) -- 0:00:38
Average standard deviation of split frequencies: 0.008940
365500 -- (-641.530) (-643.945) (-644.421) [-640.068] * (-642.462) [-645.571] (-643.098) (-641.430) -- 0:00:38
366000 -- (-643.063) (-642.069) (-640.837) [-640.643] * (-640.990) (-642.171) [-641.584] (-642.729) -- 0:00:38
366500 -- (-642.143) (-643.231) [-642.615] (-646.823) * [-642.311] (-641.455) (-643.110) (-639.991) -- 0:00:38
367000 -- (-642.287) [-645.835] (-641.069) (-647.452) * (-642.454) (-643.034) (-640.316) [-642.283] -- 0:00:37
367500 -- (-645.079) [-641.900] (-640.655) (-641.672) * (-643.830) (-642.547) (-640.162) [-642.123] -- 0:00:37
368000 -- (-641.673) [-642.887] (-642.779) (-642.205) * [-641.144] (-642.589) (-641.613) (-643.079) -- 0:00:37
368500 -- (-644.198) (-646.079) (-647.086) [-643.334] * (-641.784) [-643.311] (-641.403) (-641.086) -- 0:00:37
369000 -- (-643.139) (-647.022) (-641.279) [-640.994] * (-642.794) (-646.299) (-640.633) [-641.200] -- 0:00:37
369500 -- (-646.321) (-647.456) [-645.669] (-640.014) * (-642.249) [-642.051] (-641.776) (-639.901) -- 0:00:37
370000 -- (-640.881) (-644.458) (-644.268) [-641.980] * (-643.014) (-642.167) [-641.931] (-641.428) -- 0:00:37
Average standard deviation of split frequencies: 0.009202
370500 -- (-643.600) [-642.631] (-641.225) (-642.677) * (-648.865) (-647.914) [-640.314] (-642.282) -- 0:00:37
371000 -- [-641.739] (-640.373) (-641.447) (-640.169) * [-648.432] (-643.107) (-641.227) (-643.184) -- 0:00:37
371500 -- (-640.178) (-641.161) [-642.800] (-643.370) * (-644.280) [-640.372] (-640.834) (-645.858) -- 0:00:37
372000 -- (-644.164) (-642.099) [-642.826] (-640.988) * [-640.690] (-642.547) (-640.516) (-643.885) -- 0:00:37
372500 -- (-643.899) (-642.013) [-641.899] (-641.005) * (-643.997) (-642.826) (-641.346) [-640.688] -- 0:00:38
373000 -- (-641.068) [-641.793] (-642.104) (-642.789) * [-644.622] (-642.350) (-643.341) (-642.149) -- 0:00:38
373500 -- (-640.792) [-642.346] (-640.899) (-643.738) * (-645.714) [-644.665] (-644.509) (-640.793) -- 0:00:38
374000 -- [-643.619] (-641.606) (-641.273) (-642.556) * [-641.286] (-642.278) (-644.257) (-640.862) -- 0:00:38
374500 -- (-643.223) (-644.045) [-641.529] (-640.834) * (-643.051) (-640.788) (-646.848) [-643.263] -- 0:00:38
375000 -- (-642.611) (-645.578) [-642.061] (-644.688) * (-643.613) [-640.245] (-643.693) (-642.285) -- 0:00:38
Average standard deviation of split frequencies: 0.009219
375500 -- (-640.328) [-640.352] (-642.547) (-643.754) * [-648.067] (-640.170) (-643.685) (-643.879) -- 0:00:38
376000 -- (-640.651) (-640.734) [-642.592] (-641.826) * (-641.719) [-641.199] (-640.974) (-643.872) -- 0:00:38
376500 -- (-641.213) (-640.965) [-640.860] (-642.344) * (-642.715) (-640.668) (-641.800) [-640.489] -- 0:00:38
377000 -- (-641.981) (-641.479) [-641.256] (-644.893) * (-641.904) (-643.720) [-642.216] (-640.272) -- 0:00:38
377500 -- (-645.335) [-640.312] (-644.500) (-642.684) * (-644.500) [-642.102] (-643.425) (-640.533) -- 0:00:37
378000 -- [-641.441] (-640.369) (-644.271) (-642.556) * [-640.370] (-641.205) (-642.486) (-641.855) -- 0:00:37
378500 -- (-641.526) [-644.491] (-642.888) (-641.960) * [-643.433] (-640.508) (-642.610) (-640.291) -- 0:00:37
379000 -- (-640.595) [-641.554] (-646.254) (-643.752) * (-642.430) [-641.300] (-645.694) (-642.065) -- 0:00:37
379500 -- [-640.676] (-641.606) (-643.733) (-641.656) * [-641.413] (-640.789) (-647.628) (-644.908) -- 0:00:37
380000 -- (-641.103) (-641.084) [-641.009] (-644.121) * (-645.910) [-646.197] (-645.507) (-640.543) -- 0:00:37
Average standard deviation of split frequencies: 0.009907
380500 -- (-641.854) (-643.344) (-640.609) [-641.726] * (-643.051) [-644.083] (-643.007) (-643.320) -- 0:00:37
381000 -- (-640.904) (-643.855) [-640.592] (-641.701) * [-642.063] (-643.005) (-641.773) (-640.916) -- 0:00:37
381500 -- (-639.962) (-642.675) [-641.577] (-642.059) * (-647.854) (-642.352) [-641.411] (-641.119) -- 0:00:37
382000 -- (-641.575) (-642.735) [-641.710] (-643.032) * (-646.308) (-641.849) (-639.908) [-641.173] -- 0:00:37
382500 -- (-643.934) (-642.969) (-641.324) [-644.063] * (-641.463) (-643.832) (-644.910) [-643.170] -- 0:00:37
383000 -- (-642.757) (-642.265) (-640.367) [-641.501] * (-643.776) [-641.421] (-640.934) (-648.689) -- 0:00:37
383500 -- (-642.332) (-644.482) [-640.230] (-641.749) * (-640.752) (-641.413) (-641.027) [-643.357] -- 0:00:36
384000 -- (-643.566) [-642.752] (-641.462) (-641.363) * (-643.512) (-643.982) [-641.725] (-641.432) -- 0:00:36
384500 -- (-642.349) (-640.945) [-641.826] (-643.008) * [-640.124] (-641.052) (-642.856) (-643.225) -- 0:00:36
385000 -- (-642.641) (-642.513) [-642.715] (-640.664) * (-639.977) (-640.610) [-646.644] (-642.184) -- 0:00:36
Average standard deviation of split frequencies: 0.009092
385500 -- (-643.462) (-640.715) [-642.969] (-640.503) * (-641.417) [-641.025] (-643.147) (-644.033) -- 0:00:36
386000 -- (-644.299) [-642.523] (-642.875) (-642.208) * (-642.910) [-641.970] (-641.978) (-640.786) -- 0:00:36
386500 -- (-641.996) [-640.599] (-641.140) (-643.276) * (-641.144) (-642.975) (-644.419) [-640.741] -- 0:00:36
387000 -- (-641.362) (-640.603) [-640.791] (-645.111) * [-640.981] (-640.706) (-642.110) (-642.325) -- 0:00:36
387500 -- (-643.381) [-640.615] (-643.178) (-640.849) * (-642.765) [-640.585] (-640.803) (-640.038) -- 0:00:36
388000 -- [-641.397] (-643.346) (-645.017) (-642.008) * (-641.333) (-641.911) [-641.380] (-640.226) -- 0:00:36
388500 -- (-641.655) (-643.196) [-640.140] (-648.603) * [-641.422] (-645.225) (-642.032) (-641.299) -- 0:00:36
389000 -- [-640.978] (-642.555) (-642.709) (-641.472) * (-642.587) (-644.815) (-641.985) [-641.896] -- 0:00:36
389500 -- (-645.540) (-641.529) [-643.089] (-642.347) * (-641.018) [-641.128] (-642.358) (-642.834) -- 0:00:37
390000 -- [-641.422] (-642.484) (-641.396) (-644.170) * (-642.589) (-642.974) [-642.668] (-641.647) -- 0:00:37
Average standard deviation of split frequencies: 0.009385
390500 -- (-642.791) [-643.668] (-642.935) (-643.306) * (-640.874) [-641.646] (-643.013) (-641.949) -- 0:00:37
391000 -- (-642.713) [-641.230] (-640.738) (-641.162) * (-641.420) (-640.953) (-643.070) [-640.576] -- 0:00:37
391500 -- (-642.385) [-642.821] (-640.973) (-641.974) * (-641.132) (-641.925) (-642.798) [-642.015] -- 0:00:37
392000 -- [-641.247] (-642.867) (-642.977) (-641.775) * [-642.921] (-641.455) (-644.320) (-640.848) -- 0:00:37
392500 -- [-642.708] (-642.457) (-646.188) (-640.989) * (-640.926) [-641.910] (-644.956) (-641.120) -- 0:00:37
393000 -- (-642.949) (-641.508) (-641.559) [-646.244] * [-642.179] (-644.069) (-647.901) (-640.005) -- 0:00:37
393500 -- (-642.321) [-645.962] (-640.284) (-643.135) * (-642.432) (-641.535) [-645.795] (-642.205) -- 0:00:36
394000 -- [-639.778] (-642.528) (-642.239) (-641.075) * (-641.830) (-642.126) (-642.625) [-640.831] -- 0:00:36
394500 -- (-648.654) [-642.819] (-641.514) (-642.250) * (-640.730) (-643.153) [-641.429] (-641.772) -- 0:00:36
395000 -- (-642.430) (-644.190) (-641.128) [-642.797] * (-644.873) (-641.497) [-641.790] (-643.958) -- 0:00:36
Average standard deviation of split frequencies: 0.008963
395500 -- (-643.564) (-642.695) (-641.122) [-641.019] * (-645.145) [-642.533] (-642.103) (-644.655) -- 0:00:36
396000 -- (-641.399) (-643.289) [-643.169] (-641.239) * [-641.547] (-641.770) (-643.730) (-642.566) -- 0:00:36
396500 -- (-642.129) (-646.734) [-643.062] (-641.584) * [-643.027] (-640.684) (-641.216) (-641.442) -- 0:00:36
397000 -- (-642.481) (-642.252) [-644.269] (-641.011) * [-642.942] (-641.572) (-642.250) (-642.990) -- 0:00:36
397500 -- (-641.676) (-648.971) [-641.866] (-643.396) * (-640.393) (-642.921) (-642.046) [-640.149] -- 0:00:36
398000 -- (-641.194) (-640.605) [-643.512] (-643.066) * [-641.305] (-641.663) (-642.722) (-640.037) -- 0:00:36
398500 -- (-640.549) (-640.339) [-644.218] (-641.654) * (-641.640) (-643.107) [-642.954] (-641.211) -- 0:00:36
399000 -- (-640.996) (-640.311) [-642.449] (-643.222) * (-642.399) (-645.386) (-641.037) [-643.188] -- 0:00:36
399500 -- (-645.029) (-645.563) [-641.126] (-640.678) * (-641.859) (-643.662) [-640.778] (-643.223) -- 0:00:36
400000 -- (-642.774) (-644.009) [-641.737] (-640.366) * (-642.227) (-642.503) [-641.251] (-643.845) -- 0:00:36
Average standard deviation of split frequencies: 0.009256
400500 -- (-640.716) [-645.611] (-642.792) (-642.869) * (-641.944) [-643.579] (-645.568) (-644.879) -- 0:00:35
401000 -- (-640.912) (-641.187) [-642.626] (-641.869) * (-644.582) [-644.691] (-642.207) (-643.371) -- 0:00:35
401500 -- (-643.770) (-643.220) [-642.457] (-640.911) * (-642.624) (-642.843) [-642.087] (-647.194) -- 0:00:35
402000 -- [-641.709] (-643.041) (-643.272) (-641.005) * (-641.647) [-646.547] (-642.752) (-644.895) -- 0:00:35
402500 -- (-641.154) (-642.547) (-643.559) [-642.007] * (-640.431) [-645.492] (-640.779) (-647.593) -- 0:00:35
403000 -- (-642.291) [-640.675] (-642.723) (-645.784) * (-639.951) [-640.188] (-641.814) (-646.285) -- 0:00:35
403500 -- (-642.129) (-641.745) (-643.586) [-640.864] * [-641.655] (-640.743) (-642.745) (-648.202) -- 0:00:35
404000 -- (-642.639) [-641.775] (-641.659) (-643.630) * [-641.689] (-639.839) (-641.923) (-642.016) -- 0:00:35
404500 -- (-640.475) [-643.988] (-641.446) (-643.852) * (-644.119) [-641.317] (-642.669) (-643.818) -- 0:00:35
405000 -- [-641.294] (-645.355) (-641.139) (-643.165) * (-640.434) [-641.412] (-640.707) (-643.150) -- 0:00:35
Average standard deviation of split frequencies: 0.009216
405500 -- [-640.431] (-641.257) (-642.267) (-642.793) * (-640.551) [-640.611] (-641.790) (-641.339) -- 0:00:35
406000 -- (-639.944) (-641.584) [-640.610] (-643.736) * [-643.040] (-641.544) (-646.073) (-641.873) -- 0:00:36
406500 -- (-640.985) (-639.830) [-642.157] (-643.501) * (-643.332) [-641.398] (-642.172) (-641.602) -- 0:00:36
407000 -- (-641.450) [-642.253] (-643.067) (-642.858) * (-646.396) (-642.137) [-641.514] (-640.524) -- 0:00:36
407500 -- (-643.961) (-642.884) (-642.284) [-643.621] * (-652.417) [-641.043] (-641.768) (-641.165) -- 0:00:36
408000 -- (-643.436) (-642.932) [-643.701] (-640.538) * (-641.598) (-643.896) [-641.367] (-643.827) -- 0:00:36
408500 -- (-642.254) (-645.131) [-641.793] (-642.335) * (-643.495) (-644.165) (-640.439) [-641.101] -- 0:00:36
409000 -- [-642.943] (-643.041) (-642.135) (-644.940) * [-643.467] (-642.039) (-641.354) (-642.243) -- 0:00:36
409500 -- [-641.394] (-644.322) (-642.325) (-643.228) * (-643.144) [-641.047] (-642.823) (-639.998) -- 0:00:36
410000 -- (-643.319) (-644.311) (-642.807) [-641.360] * (-642.043) (-640.960) (-642.468) [-641.448] -- 0:00:35
Average standard deviation of split frequencies: 0.008877
410500 -- (-641.845) (-645.058) [-641.592] (-640.579) * [-642.448] (-640.986) (-642.661) (-641.887) -- 0:00:35
411000 -- (-643.818) [-641.822] (-642.602) (-645.628) * (-644.141) (-642.413) (-642.936) [-640.506] -- 0:00:35
411500 -- (-641.324) [-640.829] (-639.867) (-640.301) * (-643.324) [-640.339] (-642.806) (-643.838) -- 0:00:35
412000 -- (-644.601) [-641.535] (-641.893) (-642.619) * (-642.045) [-641.825] (-640.196) (-652.113) -- 0:00:35
412500 -- (-640.852) (-643.165) (-641.582) [-641.599] * (-640.953) (-644.414) (-640.381) [-644.139] -- 0:00:35
413000 -- (-644.967) [-640.700] (-642.518) (-641.286) * (-640.264) [-641.870] (-640.816) (-641.400) -- 0:00:35
413500 -- (-643.483) [-641.847] (-642.683) (-640.296) * [-644.255] (-641.546) (-641.962) (-644.337) -- 0:00:35
414000 -- (-641.539) (-640.277) (-641.409) [-644.683] * [-641.975] (-641.713) (-641.909) (-643.218) -- 0:00:35
414500 -- (-646.852) (-643.530) [-640.393] (-640.588) * [-640.419] (-641.152) (-642.947) (-647.370) -- 0:00:35
415000 -- (-643.022) (-644.645) [-640.103] (-640.460) * (-642.613) (-642.222) (-649.864) [-642.597] -- 0:00:35
Average standard deviation of split frequencies: 0.007781
415500 -- [-642.287] (-642.045) (-641.574) (-640.575) * (-645.368) [-639.990] (-640.210) (-641.871) -- 0:00:35
416000 -- (-640.753) [-640.742] (-643.624) (-642.046) * (-645.997) [-640.147] (-642.333) (-641.636) -- 0:00:35
416500 -- [-644.451] (-643.598) (-641.578) (-644.495) * (-643.610) [-641.284] (-644.784) (-642.408) -- 0:00:35
417000 -- (-642.400) [-642.575] (-646.024) (-641.391) * (-639.882) (-641.195) (-643.056) [-642.075] -- 0:00:34
417500 -- (-642.493) (-644.371) (-642.480) [-640.929] * (-642.313) [-640.859] (-642.850) (-641.621) -- 0:00:34
418000 -- (-642.421) (-640.727) [-642.179] (-643.496) * (-640.982) (-646.940) (-641.268) [-640.376] -- 0:00:34
418500 -- (-642.100) [-643.323] (-642.143) (-644.082) * [-640.745] (-642.403) (-642.133) (-640.223) -- 0:00:34
419000 -- [-642.337] (-643.663) (-641.961) (-642.005) * (-642.810) (-645.372) (-641.989) [-640.162] -- 0:00:34
419500 -- [-642.835] (-641.620) (-641.247) (-641.412) * (-642.045) (-642.186) [-641.498] (-639.653) -- 0:00:34
420000 -- [-640.465] (-642.175) (-640.281) (-643.936) * [-642.565] (-640.761) (-641.177) (-643.467) -- 0:00:34
Average standard deviation of split frequencies: 0.007770
420500 -- [-641.883] (-642.617) (-643.555) (-642.539) * (-642.933) (-648.934) (-640.029) [-643.540] -- 0:00:34
421000 -- (-642.748) (-642.528) [-640.994] (-641.324) * [-641.878] (-643.083) (-641.039) (-646.192) -- 0:00:34
421500 -- (-644.623) (-642.040) (-640.737) [-642.584] * [-643.021] (-642.285) (-643.829) (-644.378) -- 0:00:34
422000 -- (-642.768) (-642.017) [-641.173] (-645.019) * [-641.635] (-643.770) (-648.485) (-643.210) -- 0:00:34
422500 -- (-643.830) [-641.726] (-644.418) (-640.311) * (-644.504) (-645.500) [-642.934] (-642.943) -- 0:00:35
423000 -- (-642.836) [-642.965] (-642.354) (-642.683) * (-640.971) [-645.423] (-643.458) (-641.406) -- 0:00:35
423500 -- [-642.610] (-641.362) (-641.792) (-646.121) * (-642.692) (-642.050) [-643.937] (-645.742) -- 0:00:35
424000 -- (-640.652) (-643.483) [-640.503] (-646.005) * [-640.920] (-644.892) (-642.277) (-640.366) -- 0:00:35
424500 -- [-641.667] (-643.851) (-641.625) (-641.162) * (-641.419) [-644.165] (-642.922) (-642.185) -- 0:00:35
425000 -- (-642.296) [-642.748] (-641.081) (-640.170) * (-642.386) [-640.125] (-642.731) (-641.016) -- 0:00:35
Average standard deviation of split frequencies: 0.007539
425500 -- (-643.825) [-642.481] (-640.708) (-641.625) * [-641.815] (-643.268) (-642.118) (-643.346) -- 0:00:35
426000 -- (-642.377) (-642.225) [-641.782] (-640.911) * [-639.849] (-640.666) (-640.599) (-642.289) -- 0:00:35
426500 -- [-642.947] (-645.414) (-641.778) (-640.570) * (-643.454) [-641.227] (-646.380) (-641.516) -- 0:00:34
427000 -- (-643.569) (-641.607) [-641.874] (-640.433) * (-641.813) [-641.504] (-640.353) (-641.105) -- 0:00:34
427500 -- (-646.868) [-642.544] (-645.377) (-640.494) * (-640.808) (-641.876) [-642.897] (-640.396) -- 0:00:34
428000 -- [-643.500] (-640.131) (-641.011) (-642.899) * (-640.666) (-643.498) [-641.213] (-643.686) -- 0:00:34
428500 -- (-642.567) [-641.233] (-644.153) (-640.672) * (-645.343) (-642.672) [-640.491] (-643.953) -- 0:00:34
429000 -- [-642.003] (-642.629) (-644.297) (-640.984) * (-644.276) (-640.963) (-644.804) [-646.368] -- 0:00:34
429500 -- (-643.212) [-642.305] (-641.345) (-642.276) * (-643.706) (-645.158) [-641.412] (-642.016) -- 0:00:34
430000 -- (-642.797) (-643.848) (-644.033) [-641.146] * (-644.676) (-642.879) (-641.299) [-640.790] -- 0:00:34
Average standard deviation of split frequencies: 0.007320
430500 -- (-643.108) [-643.239] (-642.945) (-644.767) * (-645.149) [-641.270] (-643.958) (-641.087) -- 0:00:34
431000 -- (-645.833) (-640.770) (-641.757) [-643.294] * [-642.163] (-640.424) (-640.965) (-640.436) -- 0:00:34
431500 -- (-641.624) (-640.655) (-641.534) [-639.644] * (-645.191) (-644.851) [-641.117] (-640.661) -- 0:00:34
432000 -- (-641.496) [-641.392] (-647.794) (-639.987) * (-640.149) (-642.804) (-640.393) [-643.635] -- 0:00:34
432500 -- (-641.580) (-642.175) (-641.161) [-640.367] * (-641.093) (-641.649) (-640.173) [-643.068] -- 0:00:34
433000 -- (-641.982) (-641.663) (-640.483) [-641.281] * [-640.644] (-642.597) (-641.204) (-646.664) -- 0:00:34
433500 -- (-642.787) [-643.406] (-640.807) (-643.229) * [-641.085] (-642.907) (-641.989) (-644.194) -- 0:00:33
434000 -- (-641.224) (-641.532) (-643.948) [-642.475] * [-644.582] (-640.673) (-642.770) (-645.388) -- 0:00:33
434500 -- (-642.526) [-642.351] (-640.763) (-642.576) * (-642.835) (-641.098) (-639.912) [-640.823] -- 0:00:33
435000 -- (-643.889) (-642.035) (-642.829) [-641.287] * [-640.885] (-640.629) (-641.811) (-640.518) -- 0:00:33
Average standard deviation of split frequencies: 0.006893
435500 -- (-641.284) [-641.386] (-640.715) (-645.365) * (-640.239) (-640.502) [-641.572] (-640.492) -- 0:00:33
436000 -- (-643.507) [-640.666] (-641.847) (-642.813) * (-640.170) [-640.603] (-642.626) (-642.602) -- 0:00:33
436500 -- [-640.856] (-640.527) (-641.710) (-645.116) * [-644.246] (-640.872) (-641.734) (-642.856) -- 0:00:33
437000 -- [-642.002] (-641.222) (-643.378) (-641.323) * (-642.766) (-643.628) (-642.918) [-643.951] -- 0:00:33
437500 -- (-643.614) (-643.418) (-641.004) [-640.208] * (-641.059) (-640.790) (-641.921) [-644.112] -- 0:00:33
438000 -- [-640.698] (-646.233) (-642.389) (-641.744) * [-648.129] (-641.907) (-643.533) (-642.884) -- 0:00:33
438500 -- (-642.253) [-641.825] (-643.462) (-646.481) * (-641.552) (-642.073) (-642.147) [-644.713] -- 0:00:33
439000 -- [-640.378] (-641.335) (-641.311) (-644.529) * (-642.204) [-641.891] (-641.638) (-642.401) -- 0:00:33
439500 -- [-642.948] (-640.218) (-641.386) (-644.107) * (-641.275) (-642.194) [-644.349] (-641.367) -- 0:00:34
440000 -- [-640.346] (-641.337) (-644.123) (-641.504) * (-640.866) [-641.381] (-643.074) (-641.273) -- 0:00:34
Average standard deviation of split frequencies: 0.006846
440500 -- [-640.700] (-640.853) (-641.633) (-642.984) * [-640.872] (-641.927) (-643.413) (-640.760) -- 0:00:34
441000 -- (-640.363) [-641.734] (-642.040) (-642.675) * (-643.246) [-640.642] (-642.337) (-643.709) -- 0:00:34
441500 -- (-640.242) [-641.924] (-642.755) (-642.360) * (-641.352) [-640.379] (-639.786) (-642.214) -- 0:00:34
442000 -- (-643.958) [-641.288] (-646.797) (-641.497) * (-642.052) [-640.842] (-639.949) (-641.276) -- 0:00:34
442500 -- (-644.066) (-641.247) (-642.763) [-641.344] * (-643.409) (-642.622) [-640.541] (-643.686) -- 0:00:34
443000 -- [-642.287] (-641.908) (-643.942) (-641.049) * (-642.561) (-641.250) (-645.048) [-644.503] -- 0:00:33
443500 -- [-642.271] (-639.858) (-642.157) (-642.425) * (-644.666) [-639.820] (-645.171) (-643.096) -- 0:00:33
444000 -- (-641.244) (-644.448) [-641.279] (-645.620) * (-640.713) [-641.362] (-641.179) (-645.912) -- 0:00:33
444500 -- (-643.435) (-644.974) [-642.268] (-643.628) * [-640.712] (-642.548) (-642.956) (-641.789) -- 0:00:33
445000 -- [-644.614] (-644.842) (-646.574) (-642.236) * (-639.946) (-641.070) (-642.914) [-649.400] -- 0:00:33
Average standard deviation of split frequencies: 0.006936
445500 -- [-641.670] (-643.947) (-641.252) (-650.465) * (-642.444) (-641.161) [-643.009] (-640.717) -- 0:00:33
446000 -- (-644.261) (-641.247) [-642.059] (-642.109) * (-641.964) [-642.294] (-643.303) (-640.112) -- 0:00:33
446500 -- (-641.176) [-644.153] (-642.202) (-644.285) * (-643.534) (-641.931) [-643.117] (-642.005) -- 0:00:33
447000 -- (-641.707) (-647.461) [-643.508] (-644.703) * (-642.813) (-640.560) [-642.273] (-641.000) -- 0:00:33
447500 -- (-640.209) (-643.258) (-644.641) [-642.927] * (-643.409) (-644.458) (-644.329) [-644.998] -- 0:00:33
448000 -- (-643.526) (-640.886) (-642.669) [-644.881] * [-640.741] (-641.091) (-642.395) (-642.448) -- 0:00:33
448500 -- (-640.988) (-648.685) (-640.453) [-642.605] * [-641.057] (-642.851) (-643.767) (-641.483) -- 0:00:33
449000 -- (-641.919) (-644.937) (-643.308) [-640.004] * (-646.567) (-640.854) [-641.984] (-640.499) -- 0:00:33
449500 -- (-641.079) (-641.812) (-650.486) [-640.576] * [-645.697] (-647.011) (-641.714) (-640.850) -- 0:00:33
450000 -- (-641.270) (-640.578) [-640.831] (-641.862) * (-646.420) (-642.974) [-641.153] (-641.015) -- 0:00:33
Average standard deviation of split frequencies: 0.007462
450500 -- (-641.142) (-645.117) (-642.302) [-641.917] * (-642.419) (-640.657) (-640.919) [-642.417] -- 0:00:32
451000 -- (-643.113) (-643.972) [-641.024] (-645.088) * (-643.000) [-641.309] (-640.551) (-643.426) -- 0:00:32
451500 -- (-640.565) [-641.536] (-641.300) (-643.769) * [-643.208] (-642.830) (-641.537) (-641.561) -- 0:00:32
452000 -- (-641.258) (-641.839) (-641.282) [-640.292] * (-643.078) [-641.734] (-642.265) (-640.094) -- 0:00:32
452500 -- (-643.803) (-640.615) [-643.426] (-643.217) * (-641.550) (-641.579) [-641.608] (-640.647) -- 0:00:32
453000 -- [-643.385] (-640.484) (-642.248) (-640.811) * (-643.260) [-642.708] (-641.500) (-641.390) -- 0:00:32
453500 -- [-640.981] (-639.874) (-640.896) (-641.914) * (-644.596) [-641.849] (-643.106) (-642.360) -- 0:00:32
454000 -- (-640.763) [-639.926] (-640.051) (-643.640) * (-644.430) (-643.478) (-640.853) [-644.972] -- 0:00:32
454500 -- [-640.247] (-639.924) (-641.332) (-642.644) * (-644.121) (-643.047) (-641.396) [-644.078] -- 0:00:32
455000 -- (-644.426) (-641.118) (-642.245) [-641.869] * (-643.552) (-640.892) (-643.842) [-641.694] -- 0:00:32
Average standard deviation of split frequencies: 0.006892
455500 -- (-642.474) (-640.736) [-640.785] (-642.232) * (-641.007) (-643.927) [-640.542] (-643.741) -- 0:00:32
456000 -- (-642.515) (-641.706) (-639.940) [-642.101] * (-642.659) (-642.158) [-642.200] (-641.268) -- 0:00:33
456500 -- (-640.068) (-640.857) [-645.847] (-642.461) * (-642.157) (-641.058) [-643.713] (-640.349) -- 0:00:33
457000 -- [-642.352] (-641.018) (-646.709) (-642.350) * [-641.787] (-642.701) (-643.011) (-641.521) -- 0:00:33
457500 -- (-641.116) [-642.432] (-644.081) (-643.021) * (-643.524) (-641.039) [-646.117] (-642.075) -- 0:00:33
458000 -- [-642.246] (-642.805) (-641.110) (-642.121) * (-642.401) (-641.880) [-641.627] (-641.084) -- 0:00:33
458500 -- (-642.427) [-641.635] (-643.305) (-643.858) * (-640.542) (-641.958) [-644.259] (-641.086) -- 0:00:33
459000 -- (-641.261) [-642.594] (-640.402) (-640.802) * (-640.663) (-641.457) (-642.201) [-641.054] -- 0:00:33
459500 -- (-641.963) (-640.175) [-641.315] (-641.312) * (-640.172) [-640.920] (-641.934) (-644.904) -- 0:00:32
460000 -- [-642.385] (-643.443) (-641.566) (-641.970) * (-643.215) [-647.705] (-641.820) (-645.640) -- 0:00:32
Average standard deviation of split frequencies: 0.008732
460500 -- (-644.271) [-640.412] (-641.128) (-641.055) * (-643.891) (-641.078) [-640.452] (-642.997) -- 0:00:32
461000 -- (-644.986) [-639.758] (-645.954) (-645.666) * (-642.169) (-640.581) (-642.749) [-642.387] -- 0:00:32
461500 -- (-640.977) (-642.820) [-641.516] (-641.880) * [-640.957] (-640.574) (-641.923) (-644.899) -- 0:00:32
462000 -- (-642.480) [-640.240] (-644.826) (-642.213) * (-640.970) (-642.480) [-641.938] (-640.403) -- 0:00:32
462500 -- (-643.352) [-640.190] (-641.387) (-643.200) * [-641.766] (-641.768) (-646.412) (-640.346) -- 0:00:32
463000 -- (-640.929) (-642.661) (-641.484) [-643.836] * [-640.686] (-640.967) (-645.526) (-641.158) -- 0:00:32
463500 -- [-641.148] (-641.412) (-641.637) (-642.036) * (-641.746) [-644.970] (-641.642) (-645.834) -- 0:00:32
464000 -- (-640.137) (-641.189) [-642.572] (-644.024) * (-642.473) (-641.927) [-640.737] (-647.359) -- 0:00:32
464500 -- (-641.267) (-643.276) (-645.298) [-642.477] * (-640.990) (-644.407) (-643.051) [-643.395] -- 0:00:32
465000 -- (-641.427) [-640.600] (-650.250) (-641.082) * [-641.161] (-644.528) (-644.358) (-643.481) -- 0:00:32
Average standard deviation of split frequencies: 0.009239
465500 -- [-640.881] (-642.299) (-643.662) (-641.623) * (-644.121) [-642.098] (-641.890) (-646.923) -- 0:00:32
466000 -- (-641.903) (-641.493) (-642.263) [-642.218] * (-640.563) (-650.029) [-642.172] (-644.720) -- 0:00:32
466500 -- (-642.012) (-641.053) [-642.612] (-640.933) * (-640.628) (-641.589) (-644.163) [-644.200] -- 0:00:32
467000 -- (-642.300) (-644.867) [-639.873] (-643.250) * (-644.722) [-640.730] (-642.354) (-645.951) -- 0:00:31
467500 -- (-640.691) [-641.574] (-640.041) (-641.394) * (-643.568) (-641.811) (-641.313) [-640.971] -- 0:00:31
468000 -- (-644.682) (-641.366) (-640.637) [-644.270] * (-644.535) (-643.728) (-643.292) [-642.032] -- 0:00:31
468500 -- (-643.326) [-640.692] (-640.916) (-642.293) * (-645.095) [-641.641] (-643.901) (-641.608) -- 0:00:31
469000 -- [-642.061] (-640.144) (-641.142) (-642.375) * (-649.329) (-642.027) (-643.338) [-642.863] -- 0:00:31
469500 -- [-641.116] (-641.675) (-644.688) (-640.424) * (-642.188) (-643.080) [-645.113] (-642.635) -- 0:00:31
470000 -- (-643.750) (-645.052) [-643.381] (-645.468) * (-646.848) (-643.250) (-640.874) [-640.865] -- 0:00:31
Average standard deviation of split frequencies: 0.009482
470500 -- [-641.537] (-642.334) (-645.597) (-640.383) * (-642.265) (-641.556) (-641.443) [-639.677] -- 0:00:31
471000 -- (-642.604) (-645.038) (-641.265) [-640.034] * (-644.652) [-642.565] (-647.079) (-642.860) -- 0:00:31
471500 -- [-648.431] (-642.560) (-649.533) (-640.119) * (-642.347) (-640.214) (-643.492) [-640.359] -- 0:00:31
472000 -- (-642.163) (-644.129) (-644.270) [-640.664] * (-643.201) (-644.303) (-641.583) [-640.171] -- 0:00:31
472500 -- (-642.654) [-642.436] (-640.476) (-642.523) * (-641.687) (-644.553) (-642.438) [-641.317] -- 0:00:32
473000 -- (-643.286) [-642.568] (-641.663) (-642.738) * (-643.773) (-643.274) (-640.224) [-642.132] -- 0:00:32
473500 -- (-641.545) (-642.615) [-641.719] (-643.404) * (-641.915) (-647.195) (-641.301) [-642.980] -- 0:00:32
474000 -- (-640.423) (-643.195) (-641.894) [-641.264] * (-640.760) [-642.632] (-640.383) (-641.548) -- 0:00:32
474500 -- (-644.609) (-642.412) (-645.213) [-640.929] * (-639.894) (-642.693) (-641.410) [-641.679] -- 0:00:32
475000 -- (-647.182) [-639.751] (-642.226) (-642.299) * (-640.201) [-642.316] (-641.381) (-640.932) -- 0:00:32
Average standard deviation of split frequencies: 0.009771
475500 -- (-644.345) (-643.379) [-641.054] (-644.341) * (-642.102) (-642.484) [-641.410] (-640.633) -- 0:00:31
476000 -- (-643.621) (-640.738) [-642.125] (-644.115) * (-642.396) [-641.192] (-641.713) (-641.077) -- 0:00:31
476500 -- (-641.483) [-642.633] (-644.799) (-644.608) * [-641.657] (-643.771) (-641.875) (-642.766) -- 0:00:31
477000 -- (-650.979) [-639.772] (-640.569) (-641.446) * (-643.187) [-639.890] (-643.636) (-643.181) -- 0:00:31
477500 -- (-642.289) [-641.443] (-640.871) (-640.709) * (-646.966) [-641.168] (-640.599) (-643.015) -- 0:00:31
478000 -- [-644.832] (-643.899) (-644.890) (-640.420) * (-647.954) [-642.399] (-640.983) (-641.719) -- 0:00:31
478500 -- (-643.569) [-641.645] (-646.356) (-642.742) * (-644.159) (-640.292) [-640.452] (-641.904) -- 0:00:31
479000 -- (-641.214) (-642.044) (-643.063) [-639.962] * [-642.313] (-641.867) (-640.449) (-642.599) -- 0:00:31
479500 -- (-640.832) (-641.694) [-643.081] (-640.268) * (-642.560) [-640.364] (-642.180) (-640.691) -- 0:00:31
480000 -- (-641.448) (-641.709) (-641.355) [-642.181] * (-641.682) (-641.060) (-642.578) [-640.803] -- 0:00:31
Average standard deviation of split frequencies: 0.009938
480500 -- (-643.911) [-641.285] (-642.746) (-641.147) * (-641.587) (-644.690) [-640.451] (-642.818) -- 0:00:31
481000 -- (-641.662) (-640.475) (-641.055) [-640.026] * (-643.647) (-642.162) [-642.167] (-643.864) -- 0:00:31
481500 -- (-642.031) [-642.962] (-642.881) (-641.747) * [-641.451] (-640.410) (-641.656) (-641.923) -- 0:00:31
482000 -- (-645.717) (-644.145) (-643.623) [-642.941] * (-642.906) (-641.084) (-640.537) [-641.411] -- 0:00:31
482500 -- [-642.949] (-642.220) (-642.285) (-643.003) * (-644.241) [-641.268] (-644.841) (-646.987) -- 0:00:31
483000 -- [-641.125] (-644.054) (-642.374) (-641.548) * (-643.419) (-644.481) (-641.504) [-643.935] -- 0:00:31
483500 -- [-640.872] (-643.752) (-645.705) (-641.002) * (-641.543) (-643.051) [-640.414] (-643.013) -- 0:00:30
484000 -- [-640.323] (-642.066) (-641.816) (-640.892) * (-642.025) [-641.409] (-640.049) (-642.043) -- 0:00:30
484500 -- [-641.800] (-641.994) (-644.889) (-645.294) * (-641.729) [-641.871] (-640.457) (-643.475) -- 0:00:30
485000 -- [-641.549] (-640.214) (-642.431) (-641.708) * [-640.449] (-642.185) (-641.884) (-644.581) -- 0:00:30
Average standard deviation of split frequencies: 0.009570
485500 -- (-641.844) (-640.543) [-641.121] (-641.736) * (-641.936) (-642.543) (-641.284) [-642.179] -- 0:00:30
486000 -- (-645.264) (-641.396) [-641.424] (-642.581) * (-644.920) (-644.820) (-640.796) [-639.896] -- 0:00:30
486500 -- (-641.573) (-641.330) (-642.361) [-643.709] * (-643.001) (-646.089) [-642.572] (-640.968) -- 0:00:30
487000 -- (-648.200) (-645.198) (-640.962) [-642.013] * [-640.777] (-642.111) (-644.244) (-648.825) -- 0:00:30
487500 -- (-642.589) (-645.569) [-641.630] (-644.393) * (-641.187) (-644.152) (-644.557) [-651.783] -- 0:00:30
488000 -- [-641.479] (-642.598) (-641.231) (-651.980) * [-643.401] (-642.003) (-643.853) (-641.607) -- 0:00:30
488500 -- (-646.253) (-643.969) (-643.720) [-641.181] * (-642.382) [-642.871] (-640.485) (-641.723) -- 0:00:30
489000 -- (-644.329) (-642.397) (-645.322) [-640.151] * (-644.543) (-642.154) [-644.093] (-643.308) -- 0:00:30
489500 -- (-643.943) [-642.933] (-642.798) (-643.280) * (-642.402) [-645.127] (-640.946) (-642.258) -- 0:00:31
490000 -- (-643.983) (-642.241) [-642.251] (-643.348) * (-645.283) (-640.718) [-641.506] (-641.158) -- 0:00:31
Average standard deviation of split frequencies: 0.008903
490500 -- [-644.387] (-643.202) (-641.637) (-643.896) * (-642.458) (-640.536) (-640.772) [-642.337] -- 0:00:31
491000 -- [-640.597] (-642.604) (-643.000) (-640.968) * (-643.811) [-640.912] (-642.502) (-641.956) -- 0:00:31
491500 -- (-642.706) (-642.589) (-641.099) [-641.886] * (-640.558) (-641.535) [-642.594] (-641.202) -- 0:00:31
492000 -- [-641.023] (-642.601) (-640.462) (-642.259) * [-640.804] (-646.170) (-640.607) (-643.484) -- 0:00:30
492500 -- (-640.315) (-641.218) (-641.547) [-642.454] * [-641.697] (-642.623) (-643.099) (-642.520) -- 0:00:30
493000 -- [-641.328] (-640.309) (-641.759) (-644.354) * (-641.689) (-640.437) [-640.641] (-643.614) -- 0:00:30
493500 -- (-641.890) [-642.383] (-640.244) (-641.804) * [-641.706] (-640.502) (-640.633) (-641.635) -- 0:00:30
494000 -- (-641.278) [-642.167] (-641.338) (-643.197) * (-640.950) (-640.761) (-640.511) [-640.643] -- 0:00:30
494500 -- [-640.858] (-643.191) (-641.429) (-643.597) * (-641.757) (-641.626) (-644.059) [-640.272] -- 0:00:30
495000 -- (-643.386) (-643.148) (-640.964) [-642.490] * [-640.399] (-643.996) (-642.066) (-642.266) -- 0:00:30
Average standard deviation of split frequencies: 0.008364
495500 -- [-640.860] (-641.149) (-641.146) (-641.880) * [-646.158] (-643.472) (-643.368) (-644.644) -- 0:00:30
496000 -- (-645.822) [-641.876] (-642.356) (-641.089) * (-644.176) (-641.461) [-644.365] (-642.042) -- 0:00:30
496500 -- (-639.922) (-641.019) (-640.748) [-640.802] * [-641.286] (-641.565) (-642.760) (-646.353) -- 0:00:30
497000 -- (-653.378) (-640.788) [-641.992] (-640.875) * (-641.345) (-641.091) (-642.574) [-643.093] -- 0:00:30
497500 -- (-644.492) [-641.594] (-644.730) (-640.192) * (-640.702) (-642.679) (-641.147) [-645.192] -- 0:00:30
498000 -- (-640.530) (-641.357) (-640.082) [-640.136] * (-641.638) (-641.579) [-640.087] (-641.665) -- 0:00:30
498500 -- (-644.122) (-642.342) [-642.060] (-641.012) * (-643.601) [-641.840] (-640.418) (-644.495) -- 0:00:30
499000 -- (-640.461) [-643.290] (-648.517) (-642.957) * [-642.046] (-644.915) (-642.909) (-641.421) -- 0:00:30
499500 -- [-640.528] (-642.874) (-645.037) (-640.713) * (-640.915) (-642.538) (-643.067) [-640.827] -- 0:00:30
500000 -- (-641.539) (-644.650) [-642.631] (-641.833) * (-641.188) (-648.186) [-642.268] (-643.718) -- 0:00:30
Average standard deviation of split frequencies: 0.008600
500500 -- (-642.831) (-641.546) (-640.541) [-641.795] * (-640.629) (-643.810) [-640.759] (-644.963) -- 0:00:29
501000 -- [-641.871] (-646.460) (-640.463) (-646.282) * [-641.450] (-642.259) (-640.424) (-641.439) -- 0:00:29
501500 -- (-642.286) (-641.865) (-644.144) [-644.081] * (-642.084) (-642.576) [-643.613] (-640.237) -- 0:00:29
502000 -- (-640.562) [-641.067] (-643.017) (-640.404) * [-642.449] (-641.739) (-640.724) (-641.317) -- 0:00:29
502500 -- [-639.898] (-641.643) (-641.779) (-640.131) * (-644.249) (-646.256) [-640.996] (-647.016) -- 0:00:29
503000 -- [-641.437] (-642.532) (-641.937) (-640.427) * [-640.114] (-642.094) (-640.697) (-645.023) -- 0:00:29
503500 -- (-640.678) (-642.508) [-640.386] (-640.492) * (-641.618) (-642.063) [-643.189] (-643.011) -- 0:00:29
504000 -- (-640.194) (-645.149) [-640.508] (-643.951) * (-642.315) [-642.622] (-644.576) (-640.244) -- 0:00:29
504500 -- (-640.590) (-643.075) (-641.987) [-643.396] * (-642.810) (-641.232) [-643.272] (-641.094) -- 0:00:29
505000 -- (-643.131) (-642.416) (-642.049) [-646.846] * (-640.477) [-642.459] (-647.180) (-641.381) -- 0:00:29
Average standard deviation of split frequencies: 0.008447
505500 -- (-641.083) (-644.071) [-641.726] (-645.148) * (-642.260) [-643.012] (-643.334) (-642.672) -- 0:00:29
506000 -- (-640.659) (-645.751) [-641.940] (-646.059) * (-642.034) (-644.198) [-641.769] (-645.442) -- 0:00:30
506500 -- [-642.761] (-643.073) (-642.383) (-640.103) * (-643.151) [-649.018] (-645.666) (-643.154) -- 0:00:30
507000 -- (-641.515) (-642.550) (-640.715) [-640.773] * (-640.851) [-641.730] (-644.694) (-640.970) -- 0:00:30
507500 -- (-643.213) (-640.491) [-642.898] (-645.123) * (-642.754) (-641.632) [-643.078] (-640.756) -- 0:00:30
508000 -- (-649.143) (-642.746) (-644.173) [-641.560] * (-642.725) (-642.132) [-642.275] (-639.868) -- 0:00:30
508500 -- (-641.475) (-640.987) [-643.605] (-645.370) * (-643.117) (-643.990) [-641.561] (-643.496) -- 0:00:29
509000 -- (-640.631) (-642.659) (-649.028) [-641.397] * [-640.322] (-641.642) (-640.777) (-641.305) -- 0:00:29
509500 -- [-641.437] (-639.897) (-645.413) (-641.005) * [-639.965] (-641.516) (-647.544) (-642.318) -- 0:00:29
510000 -- (-646.927) (-640.894) (-642.689) [-641.132] * (-644.991) [-640.437] (-643.065) (-645.343) -- 0:00:29
Average standard deviation of split frequencies: 0.009170
510500 -- (-645.318) [-641.397] (-643.079) (-644.542) * [-643.242] (-646.540) (-644.520) (-641.257) -- 0:00:29
511000 -- (-642.623) (-642.849) [-641.655] (-641.538) * (-642.298) (-641.543) (-641.682) [-641.130] -- 0:00:29
511500 -- [-641.640] (-640.236) (-640.200) (-644.366) * [-642.399] (-641.844) (-641.492) (-641.200) -- 0:00:29
512000 -- (-640.650) (-641.734) (-640.472) [-640.478] * (-640.194) (-641.976) [-641.197] (-641.382) -- 0:00:29
512500 -- [-641.746] (-640.988) (-646.172) (-640.234) * (-644.938) (-642.208) [-641.934] (-641.414) -- 0:00:29
513000 -- [-642.417] (-643.749) (-644.538) (-640.139) * (-641.820) [-644.301] (-641.028) (-641.636) -- 0:00:29
513500 -- (-640.362) (-641.018) [-642.816] (-642.367) * (-641.434) [-640.448] (-641.763) (-642.764) -- 0:00:29
514000 -- (-641.451) (-642.759) (-641.446) [-646.008] * [-640.378] (-640.687) (-642.343) (-641.370) -- 0:00:29
514500 -- [-641.959] (-645.251) (-642.938) (-643.200) * (-641.490) (-644.838) [-642.117] (-642.544) -- 0:00:29
515000 -- (-640.968) (-640.011) [-641.378] (-643.627) * [-641.837] (-644.534) (-644.488) (-642.141) -- 0:00:29
Average standard deviation of split frequencies: 0.009440
515500 -- (-644.306) (-640.797) (-640.300) [-642.867] * [-643.069] (-645.253) (-644.723) (-640.349) -- 0:00:29
516000 -- (-643.202) [-641.661] (-640.385) (-641.136) * [-642.730] (-641.783) (-641.051) (-641.800) -- 0:00:29
516500 -- (-641.442) (-644.191) [-640.358] (-640.893) * (-646.560) (-644.027) (-643.141) [-641.308] -- 0:00:29
517000 -- (-641.927) [-642.690] (-640.149) (-642.025) * (-641.962) (-645.879) (-646.139) [-641.470] -- 0:00:28
517500 -- (-644.301) (-640.394) (-640.883) [-642.954] * (-644.242) [-645.691] (-642.849) (-642.279) -- 0:00:28
518000 -- (-641.508) [-640.321] (-639.893) (-645.642) * (-641.773) [-643.123] (-643.148) (-640.700) -- 0:00:28
518500 -- (-642.138) [-640.873] (-642.541) (-640.691) * (-644.346) [-640.618] (-642.185) (-641.510) -- 0:00:28
519000 -- (-641.560) (-640.743) (-646.228) [-640.852] * (-641.256) (-642.627) (-646.368) [-642.232] -- 0:00:28
519500 -- (-642.778) [-640.376] (-646.741) (-641.470) * [-641.971] (-641.201) (-640.690) (-640.513) -- 0:00:28
520000 -- (-641.729) (-640.231) (-642.217) [-642.650] * (-642.270) (-641.440) [-641.540] (-641.286) -- 0:00:28
Average standard deviation of split frequencies: 0.009778
520500 -- [-641.066] (-642.205) (-641.582) (-640.826) * (-641.609) [-648.158] (-642.870) (-642.309) -- 0:00:28
521000 -- (-642.025) (-640.707) [-643.306] (-642.142) * (-643.620) [-642.781] (-643.646) (-641.288) -- 0:00:28
521500 -- (-641.617) (-642.549) (-643.282) [-640.748] * (-651.185) [-640.748] (-641.239) (-642.492) -- 0:00:28
522000 -- [-642.569] (-645.810) (-644.126) (-642.688) * (-640.607) [-642.096] (-643.188) (-641.017) -- 0:00:28
522500 -- (-644.522) (-642.427) (-644.431) [-642.347] * [-643.698] (-641.186) (-640.158) (-645.046) -- 0:00:28
523000 -- (-655.642) (-642.957) [-643.803] (-642.516) * (-642.432) (-642.238) (-644.425) [-641.597] -- 0:00:29
523500 -- (-643.852) (-646.209) (-640.810) [-642.290] * (-642.273) (-645.451) [-645.324] (-641.839) -- 0:00:29
524000 -- [-641.173] (-641.301) (-642.112) (-643.374) * (-644.048) [-640.229] (-643.920) (-647.488) -- 0:00:29
524500 -- (-644.179) (-642.262) [-640.736] (-643.369) * [-643.917] (-643.626) (-643.575) (-642.883) -- 0:00:29
525000 -- (-642.276) (-644.654) (-643.244) [-642.329] * (-645.723) [-644.108] (-643.718) (-642.501) -- 0:00:28
Average standard deviation of split frequencies: 0.008783
525500 -- (-640.358) [-642.763] (-640.427) (-643.097) * (-641.921) (-643.239) (-645.158) [-640.764] -- 0:00:28
526000 -- (-641.583) (-643.993) (-640.398) [-640.854] * (-642.375) (-646.951) (-642.119) [-641.159] -- 0:00:28
526500 -- (-644.986) (-641.378) [-640.728] (-641.816) * (-641.393) (-650.998) [-642.620] (-640.539) -- 0:00:28
527000 -- (-641.846) (-640.595) [-640.497] (-641.438) * [-641.209] (-647.693) (-652.023) (-641.986) -- 0:00:28
527500 -- (-640.873) (-642.235) (-642.323) [-642.717] * (-640.234) (-645.332) (-650.101) [-646.335] -- 0:00:28
528000 -- (-641.388) (-640.343) (-641.943) [-643.134] * [-641.292] (-643.803) (-642.105) (-646.506) -- 0:00:28
528500 -- (-639.819) [-640.122] (-642.417) (-647.393) * (-643.613) (-647.588) [-643.273] (-640.915) -- 0:00:28
529000 -- (-643.407) [-640.981] (-643.851) (-648.992) * (-641.486) (-642.022) [-640.202] (-642.407) -- 0:00:28
529500 -- (-643.169) (-646.610) (-642.899) [-641.669] * (-640.883) (-644.664) [-641.979] (-641.945) -- 0:00:28
530000 -- (-642.763) [-646.279] (-643.129) (-642.459) * (-643.617) (-640.026) (-642.195) [-647.217] -- 0:00:28
Average standard deviation of split frequencies: 0.009890
530500 -- (-641.569) [-643.604] (-644.336) (-645.831) * (-644.822) (-641.198) (-642.745) [-642.979] -- 0:00:28
531000 -- [-641.964] (-645.059) (-643.122) (-643.556) * (-643.456) (-641.704) [-640.676] (-644.623) -- 0:00:28
531500 -- (-644.434) [-642.559] (-641.574) (-643.835) * (-645.115) [-641.779] (-641.349) (-640.544) -- 0:00:28
532000 -- (-641.067) (-643.926) (-641.848) [-642.304] * [-640.969] (-642.067) (-640.844) (-641.556) -- 0:00:28
532500 -- (-641.472) (-643.283) [-643.771] (-639.976) * (-643.030) (-641.701) (-642.082) [-641.637] -- 0:00:28
533000 -- (-644.396) (-641.197) [-640.734] (-641.292) * [-642.564] (-643.867) (-640.563) (-642.492) -- 0:00:28
533500 -- (-640.172) (-644.622) [-641.580] (-642.002) * (-642.139) [-641.617] (-640.114) (-641.023) -- 0:00:27
534000 -- (-641.360) [-643.611] (-640.234) (-642.113) * (-641.145) (-641.093) (-642.068) [-641.651] -- 0:00:27
534500 -- [-645.582] (-653.581) (-642.002) (-644.756) * (-641.620) [-641.977] (-641.280) (-642.809) -- 0:00:27
535000 -- [-643.260] (-644.117) (-641.855) (-642.109) * [-640.960] (-641.464) (-646.121) (-641.831) -- 0:00:27
Average standard deviation of split frequencies: 0.010261
535500 -- (-647.110) [-641.134] (-641.051) (-641.790) * (-639.748) [-641.894] (-648.564) (-640.757) -- 0:00:27
536000 -- (-640.982) (-649.711) [-641.411] (-641.975) * (-641.065) (-642.990) [-646.095] (-641.313) -- 0:00:27
536500 -- (-642.819) (-651.173) (-642.039) [-640.694] * (-641.459) (-641.503) [-642.198] (-644.089) -- 0:00:27
537000 -- (-642.402) [-644.411] (-640.745) (-641.054) * (-641.772) (-642.824) (-643.510) [-647.572] -- 0:00:27
537500 -- (-645.298) [-641.438] (-641.291) (-642.209) * (-641.169) (-641.757) [-643.589] (-640.860) -- 0:00:27
538000 -- (-640.941) (-642.988) (-643.262) [-648.501] * (-641.878) (-643.567) (-642.280) [-640.013] -- 0:00:27
538500 -- [-641.204] (-642.587) (-647.095) (-641.400) * (-643.256) [-642.598] (-644.600) (-641.870) -- 0:00:27
539000 -- (-640.522) (-642.063) (-646.920) [-639.882] * [-642.060] (-640.586) (-644.556) (-643.067) -- 0:00:27
539500 -- (-641.965) [-641.665] (-644.765) (-643.696) * [-642.830] (-642.518) (-647.050) (-644.412) -- 0:00:28
540000 -- (-646.128) [-641.527] (-641.647) (-643.540) * (-640.847) (-641.112) [-642.265] (-648.938) -- 0:00:28
Average standard deviation of split frequencies: 0.009998
540500 -- (-643.424) [-643.100] (-644.220) (-647.548) * [-641.751] (-645.845) (-642.579) (-647.685) -- 0:00:28
541000 -- [-641.727] (-643.959) (-648.242) (-640.130) * (-642.052) [-644.360] (-647.274) (-646.972) -- 0:00:27
541500 -- (-641.850) [-640.744] (-641.279) (-641.616) * [-642.360] (-645.809) (-641.484) (-645.065) -- 0:00:27
542000 -- [-640.789] (-641.501) (-641.474) (-641.364) * [-641.788] (-640.723) (-641.750) (-642.492) -- 0:00:27
542500 -- [-641.097] (-649.349) (-644.563) (-640.868) * (-643.072) (-643.148) [-640.450] (-643.818) -- 0:00:27
543000 -- (-648.043) (-644.541) (-642.421) [-642.303] * [-640.687] (-643.138) (-643.993) (-641.820) -- 0:00:27
543500 -- [-644.597] (-640.696) (-645.935) (-644.003) * (-641.210) (-645.191) [-642.948] (-642.117) -- 0:00:27
544000 -- (-645.229) (-640.396) (-643.040) [-643.442] * [-644.069] (-640.297) (-642.875) (-643.092) -- 0:00:27
544500 -- (-646.814) [-641.193] (-641.219) (-643.007) * (-644.058) (-643.892) (-644.464) [-643.777] -- 0:00:27
545000 -- [-644.088] (-644.558) (-641.773) (-642.474) * (-643.753) (-641.282) [-641.418] (-639.974) -- 0:00:27
Average standard deviation of split frequencies: 0.009958
545500 -- (-643.902) [-644.093] (-641.459) (-644.090) * (-642.624) (-645.099) [-641.446] (-641.046) -- 0:00:27
546000 -- (-641.286) [-641.227] (-643.212) (-642.081) * (-641.644) [-644.398] (-644.368) (-641.085) -- 0:00:27
546500 -- [-643.267] (-642.112) (-644.039) (-641.229) * (-645.681) [-643.588] (-640.794) (-641.210) -- 0:00:27
547000 -- (-642.476) [-644.421] (-643.478) (-644.562) * (-641.716) (-648.551) [-640.594] (-643.884) -- 0:00:27
547500 -- (-641.085) [-642.157] (-642.084) (-641.215) * [-641.703] (-646.315) (-642.306) (-640.354) -- 0:00:27
548000 -- (-641.650) (-641.328) (-642.854) [-640.351] * (-640.872) (-641.538) (-642.381) [-640.908] -- 0:00:27
548500 -- (-640.498) (-642.343) [-642.311] (-642.483) * (-640.624) [-643.132] (-641.387) (-640.910) -- 0:00:27
549000 -- (-641.280) [-641.061] (-642.029) (-642.841) * (-643.265) (-640.554) [-641.868] (-640.950) -- 0:00:27
549500 -- (-641.870) (-641.418) (-644.623) [-641.418] * (-641.973) [-640.682] (-645.077) (-640.776) -- 0:00:27
550000 -- (-641.092) [-640.004] (-644.112) (-642.874) * (-641.593) (-643.488) [-646.398] (-640.301) -- 0:00:27
Average standard deviation of split frequencies: 0.009702
550500 -- [-641.078] (-645.166) (-646.226) (-642.612) * [-641.216] (-641.991) (-643.173) (-640.087) -- 0:00:26
551000 -- (-641.141) [-643.285] (-642.994) (-643.895) * (-641.514) [-641.068] (-643.506) (-642.061) -- 0:00:26
551500 -- (-644.334) [-641.471] (-642.472) (-643.833) * (-642.210) (-641.187) [-641.377] (-640.871) -- 0:00:26
552000 -- (-646.517) (-641.714) (-642.371) [-642.496] * [-642.221] (-641.119) (-644.533) (-641.373) -- 0:00:26
552500 -- (-641.577) (-641.772) (-640.467) [-642.369] * [-642.411] (-641.948) (-644.463) (-641.438) -- 0:00:26
553000 -- (-640.610) (-640.988) [-640.527] (-640.458) * (-642.366) (-640.341) (-642.092) [-641.022] -- 0:00:26
553500 -- (-641.612) (-642.009) [-641.832] (-641.971) * (-640.263) (-641.178) (-639.811) [-641.171] -- 0:00:26
554000 -- (-645.691) (-645.685) [-641.260] (-641.568) * (-640.528) (-642.806) [-640.903] (-641.892) -- 0:00:26
554500 -- (-646.157) [-641.485] (-641.830) (-642.470) * (-640.767) (-641.486) (-640.165) [-640.695] -- 0:00:26
555000 -- (-644.889) [-640.618] (-644.044) (-640.011) * (-642.382) (-641.940) [-640.892] (-642.330) -- 0:00:26
Average standard deviation of split frequencies: 0.009835
555500 -- (-644.973) (-642.306) (-642.927) [-641.965] * (-641.345) (-642.946) (-641.004) [-640.127] -- 0:00:26
556000 -- (-640.990) (-641.769) (-642.673) [-640.733] * (-643.222) (-646.103) (-641.499) [-640.751] -- 0:00:27
556500 -- [-643.423] (-641.692) (-648.248) (-640.437) * (-642.216) [-641.238] (-643.540) (-642.489) -- 0:00:27
557000 -- (-644.229) (-641.358) (-643.719) [-640.599] * (-641.489) [-641.058] (-642.979) (-644.626) -- 0:00:27
557500 -- (-640.249) (-644.820) (-642.457) [-642.246] * (-643.100) (-640.743) [-641.963] (-642.435) -- 0:00:26
558000 -- (-640.671) (-644.723) (-641.507) [-644.929] * [-646.640] (-644.227) (-650.156) (-642.655) -- 0:00:26
558500 -- [-646.897] (-645.031) (-641.387) (-644.932) * (-645.616) (-643.670) (-647.382) [-643.198] -- 0:00:26
559000 -- (-640.932) (-640.923) [-642.690] (-643.148) * (-645.960) (-644.287) (-645.670) [-640.068] -- 0:00:26
559500 -- [-641.886] (-642.697) (-641.650) (-645.166) * (-645.576) (-642.453) [-645.684] (-643.522) -- 0:00:26
560000 -- (-641.551) [-641.814] (-641.779) (-641.142) * [-640.998] (-643.913) (-643.774) (-646.488) -- 0:00:26
Average standard deviation of split frequencies: 0.010090
560500 -- (-642.182) (-641.424) [-641.218] (-645.517) * [-641.386] (-642.059) (-640.679) (-642.188) -- 0:00:26
561000 -- (-643.994) (-640.697) [-641.513] (-643.010) * (-640.647) [-644.351] (-640.753) (-641.717) -- 0:00:26
561500 -- (-643.942) [-642.709] (-641.600) (-641.248) * (-641.185) [-640.669] (-646.574) (-640.822) -- 0:00:26
562000 -- (-644.263) [-640.216] (-640.471) (-641.455) * (-641.583) (-642.086) [-644.240] (-645.434) -- 0:00:26
562500 -- (-646.657) (-645.293) [-640.556] (-645.737) * [-641.012] (-641.700) (-642.538) (-641.389) -- 0:00:26
563000 -- (-641.879) (-645.080) (-640.197) [-646.505] * (-642.128) (-643.634) [-641.135] (-642.120) -- 0:00:26
563500 -- (-642.288) [-643.047] (-641.330) (-646.236) * (-642.122) [-643.723] (-641.870) (-641.542) -- 0:00:26
564000 -- (-642.009) (-641.632) (-641.160) [-641.731] * [-641.059] (-641.048) (-641.397) (-641.593) -- 0:00:26
564500 -- [-642.747] (-641.462) (-641.472) (-641.394) * (-640.576) (-639.972) [-641.180] (-643.046) -- 0:00:26
565000 -- (-639.913) (-641.360) [-643.539] (-643.767) * [-640.105] (-642.049) (-641.527) (-644.721) -- 0:00:26
Average standard deviation of split frequencies: 0.010105
565500 -- (-643.053) [-642.043] (-644.952) (-641.171) * (-641.777) (-641.442) [-642.565] (-640.456) -- 0:00:26
566000 -- (-642.355) (-639.982) (-641.879) [-646.142] * [-640.070] (-644.691) (-643.485) (-640.607) -- 0:00:26
566500 -- (-642.382) [-642.040] (-643.439) (-642.543) * (-642.289) (-643.977) (-641.920) [-640.543] -- 0:00:26
567000 -- (-643.152) [-644.170] (-641.711) (-640.875) * [-641.820] (-640.697) (-641.154) (-645.004) -- 0:00:25
567500 -- [-641.806] (-644.992) (-642.458) (-640.388) * (-640.883) [-640.640] (-646.110) (-643.526) -- 0:00:25
568000 -- (-642.207) [-645.309] (-640.583) (-640.319) * (-642.460) [-641.213] (-646.935) (-641.448) -- 0:00:25
568500 -- (-642.101) [-644.445] (-644.712) (-641.630) * (-643.267) [-641.979] (-641.356) (-640.602) -- 0:00:25
569000 -- [-642.319] (-643.491) (-641.113) (-640.995) * (-642.054) (-643.310) [-640.952] (-641.651) -- 0:00:25
569500 -- [-642.619] (-642.737) (-641.017) (-643.313) * (-643.461) (-641.694) [-641.772] (-643.670) -- 0:00:25
570000 -- (-641.738) (-643.324) (-642.130) [-645.127] * [-640.719] (-640.163) (-642.977) (-642.373) -- 0:00:25
Average standard deviation of split frequencies: 0.010188
570500 -- (-640.985) [-640.881] (-640.690) (-643.093) * [-642.011] (-641.079) (-641.091) (-640.845) -- 0:00:25
571000 -- [-640.823] (-640.421) (-640.737) (-643.867) * (-640.898) [-640.563] (-642.151) (-641.836) -- 0:00:25
571500 -- (-641.618) (-641.217) (-641.181) [-644.425] * (-641.234) (-641.908) (-642.422) [-640.178] -- 0:00:25
572000 -- [-642.240] (-641.411) (-645.027) (-643.982) * (-643.009) [-640.042] (-641.617) (-642.117) -- 0:00:25
572500 -- (-645.947) [-644.002] (-644.442) (-643.243) * (-641.803) [-641.363] (-640.309) (-644.241) -- 0:00:25
573000 -- (-642.806) (-640.684) (-640.463) [-642.262] * [-641.535] (-646.091) (-641.246) (-641.617) -- 0:00:25
573500 -- (-641.423) (-643.409) (-640.537) [-642.759] * (-644.580) (-642.177) (-640.097) [-641.255] -- 0:00:26
574000 -- (-640.090) (-644.721) [-640.271] (-642.455) * (-640.778) (-642.573) (-643.211) [-640.124] -- 0:00:25
574500 -- (-644.458) (-643.722) [-640.558] (-640.671) * (-640.701) (-641.140) (-641.983) [-642.093] -- 0:00:25
575000 -- [-641.803] (-641.578) (-640.416) (-643.788) * [-641.395] (-645.571) (-643.759) (-640.015) -- 0:00:25
Average standard deviation of split frequencies: 0.010476
575500 -- (-641.683) [-641.179] (-641.743) (-642.297) * (-642.201) (-641.692) [-645.466] (-644.984) -- 0:00:25
576000 -- (-641.307) (-643.705) [-642.340] (-641.845) * [-643.930] (-642.471) (-643.128) (-648.967) -- 0:00:25
576500 -- [-641.607] (-644.254) (-643.585) (-641.320) * (-642.377) (-651.935) [-641.600] (-656.078) -- 0:00:25
577000 -- [-644.325] (-642.985) (-641.558) (-640.271) * (-646.858) [-644.755] (-643.188) (-650.496) -- 0:00:25
577500 -- (-641.865) [-640.743] (-642.386) (-643.577) * (-643.312) (-643.377) (-643.199) [-641.993] -- 0:00:25
578000 -- (-641.560) [-641.756] (-641.411) (-640.545) * [-642.465] (-641.548) (-640.383) (-643.066) -- 0:00:25
578500 -- (-641.008) [-640.306] (-641.221) (-643.947) * (-643.373) (-642.029) [-640.338] (-643.731) -- 0:00:25
579000 -- (-640.040) (-640.456) (-643.154) [-640.825] * (-641.182) (-640.781) [-640.309] (-641.955) -- 0:00:25
579500 -- (-641.442) (-644.486) (-641.830) [-640.537] * [-644.083] (-640.705) (-642.264) (-640.958) -- 0:00:25
580000 -- [-639.674] (-642.061) (-643.214) (-641.878) * (-640.904) (-640.936) [-642.223] (-643.079) -- 0:00:25
Average standard deviation of split frequencies: 0.011149
580500 -- (-641.320) (-642.764) (-642.423) [-642.872] * [-642.507] (-640.326) (-641.742) (-642.492) -- 0:00:25
581000 -- [-640.380] (-644.574) (-641.361) (-645.482) * [-640.065] (-641.409) (-644.293) (-644.571) -- 0:00:25
581500 -- [-641.674] (-648.962) (-641.418) (-646.473) * [-642.873] (-642.766) (-641.423) (-640.891) -- 0:00:25
582000 -- (-645.267) [-641.530] (-640.957) (-643.128) * (-642.873) (-643.512) (-645.167) [-640.887] -- 0:00:25
582500 -- (-643.820) [-642.076] (-644.008) (-642.793) * (-641.917) (-643.598) [-642.847] (-641.693) -- 0:00:25
583000 -- (-646.868) (-640.213) (-641.766) [-643.689] * (-641.941) (-640.247) (-642.076) [-640.595] -- 0:00:25
583500 -- (-644.003) (-642.201) (-645.327) [-641.896] * (-643.404) [-641.146] (-647.318) (-640.845) -- 0:00:24
584000 -- (-642.635) (-645.257) (-640.267) [-642.320] * (-642.423) [-642.466] (-640.987) (-643.255) -- 0:00:24
584500 -- [-642.249] (-642.645) (-642.243) (-647.762) * [-641.282] (-642.479) (-642.555) (-642.488) -- 0:00:24
585000 -- [-641.694] (-641.161) (-639.879) (-648.739) * [-641.267] (-641.693) (-642.557) (-642.401) -- 0:00:24
Average standard deviation of split frequencies: 0.011316
585500 -- [-643.686] (-640.700) (-641.555) (-641.035) * (-639.949) (-641.283) (-643.892) [-642.374] -- 0:00:24
586000 -- (-656.271) (-640.305) [-646.315] (-641.148) * (-640.549) [-641.902] (-643.152) (-641.798) -- 0:00:24
586500 -- (-646.008) (-644.695) [-647.140] (-640.502) * [-642.002] (-645.624) (-643.203) (-642.575) -- 0:00:24
587000 -- (-641.751) (-644.331) (-645.983) [-641.282] * [-643.069] (-642.401) (-641.732) (-646.029) -- 0:00:24
587500 -- (-641.709) (-641.503) [-642.261] (-640.926) * (-640.962) (-644.901) (-640.569) [-641.468] -- 0:00:24
588000 -- [-642.627] (-644.686) (-642.109) (-641.438) * (-641.041) (-642.019) [-641.840] (-642.744) -- 0:00:24
588500 -- (-641.100) (-645.463) [-640.404] (-644.869) * (-640.354) [-643.533] (-642.439) (-645.910) -- 0:00:24
589000 -- [-640.674] (-641.973) (-641.795) (-655.351) * (-641.457) (-643.811) [-641.983] (-640.851) -- 0:00:24
589500 -- (-645.789) (-641.869) (-640.395) [-639.854] * (-644.028) (-642.582) (-646.182) [-642.339] -- 0:00:24
590000 -- (-650.749) (-642.758) (-642.464) [-640.957] * (-642.811) (-643.270) (-642.389) [-641.587] -- 0:00:24
Average standard deviation of split frequencies: 0.011705
590500 -- [-642.413] (-640.383) (-642.054) (-639.858) * (-643.022) (-642.702) (-640.525) [-641.468] -- 0:00:24
591000 -- (-642.973) [-640.229] (-641.537) (-645.137) * (-641.950) [-642.427] (-642.223) (-642.248) -- 0:00:24
591500 -- (-644.178) [-641.314] (-646.515) (-642.189) * (-645.982) (-645.182) (-641.363) [-641.374] -- 0:00:24
592000 -- (-643.477) (-642.292) [-642.608] (-643.345) * (-640.957) (-645.325) (-644.238) [-642.405] -- 0:00:24
592500 -- (-644.235) [-642.148] (-644.294) (-643.824) * [-640.837] (-644.449) (-641.160) (-641.972) -- 0:00:24
593000 -- (-641.449) [-641.099] (-644.322) (-642.471) * [-641.005] (-647.115) (-644.187) (-642.376) -- 0:00:24
593500 -- (-646.903) (-642.302) (-647.845) [-641.630] * (-641.191) (-644.500) (-649.918) [-641.825] -- 0:00:24
594000 -- (-643.426) (-640.748) [-642.422] (-640.290) * (-641.389) (-641.390) [-647.521] (-645.545) -- 0:00:24
594500 -- (-642.013) (-641.664) (-641.128) [-641.582] * (-645.374) [-640.531] (-644.746) (-640.741) -- 0:00:24
595000 -- (-645.594) (-641.982) (-640.785) [-643.879] * (-644.785) (-644.246) [-642.831] (-641.660) -- 0:00:24
Average standard deviation of split frequencies: 0.011073
595500 -- (-646.029) (-643.102) (-641.755) [-642.125] * [-647.776] (-641.712) (-642.194) (-643.218) -- 0:00:24
596000 -- (-639.970) [-643.120] (-641.702) (-643.096) * (-645.524) (-641.955) (-640.374) [-641.472] -- 0:00:24
596500 -- (-640.106) (-641.783) [-645.556] (-643.148) * (-640.211) (-643.155) [-642.191] (-640.274) -- 0:00:24
597000 -- [-641.034] (-643.806) (-641.736) (-640.822) * [-639.913] (-641.056) (-640.522) (-642.289) -- 0:00:24
597500 -- (-641.907) (-645.472) (-643.968) [-641.768] * (-640.383) [-641.311] (-640.439) (-640.162) -- 0:00:24
598000 -- (-644.356) (-641.009) (-641.151) [-641.746] * (-640.700) [-641.288] (-641.270) (-645.254) -- 0:00:24
598500 -- (-642.038) [-643.051] (-642.623) (-644.115) * (-642.037) (-641.757) [-641.366] (-649.440) -- 0:00:24
599000 -- (-641.423) [-642.928] (-642.247) (-645.721) * (-644.849) [-642.783] (-642.572) (-648.054) -- 0:00:24
599500 -- (-641.918) (-641.146) (-641.011) [-641.271] * (-642.227) [-643.580] (-640.404) (-642.604) -- 0:00:24
600000 -- (-640.090) (-640.550) [-640.750] (-644.229) * (-642.999) (-641.946) (-644.538) [-640.331] -- 0:00:24
Average standard deviation of split frequencies: 0.011458
600500 -- (-641.753) [-642.189] (-641.834) (-640.899) * [-644.235] (-640.043) (-643.689) (-646.721) -- 0:00:23
601000 -- (-645.532) (-642.196) (-641.982) [-643.754] * (-641.180) (-642.635) (-641.852) [-641.894] -- 0:00:23
601500 -- (-644.515) [-643.410] (-642.633) (-640.891) * (-641.818) (-643.665) [-640.739] (-645.937) -- 0:00:23
602000 -- [-644.954] (-644.064) (-640.947) (-641.363) * (-641.295) (-644.159) [-640.546] (-641.663) -- 0:00:23
602500 -- (-642.915) (-641.228) [-642.659] (-649.388) * [-641.666] (-645.729) (-641.143) (-649.929) -- 0:00:23
603000 -- [-643.778] (-641.302) (-643.312) (-641.295) * (-641.262) (-648.637) [-640.240] (-642.850) -- 0:00:23
603500 -- (-650.923) [-641.585] (-645.157) (-642.169) * (-641.567) [-639.954] (-640.826) (-640.768) -- 0:00:23
604000 -- (-644.771) (-640.528) (-641.245) [-641.832] * (-650.363) (-639.985) [-642.492] (-640.584) -- 0:00:23
604500 -- (-644.295) (-641.690) [-641.461] (-641.583) * [-642.197] (-642.189) (-643.278) (-640.929) -- 0:00:23
605000 -- (-642.078) (-639.987) (-641.467) [-641.168] * (-641.408) (-641.628) (-644.246) [-642.300] -- 0:00:23
Average standard deviation of split frequencies: 0.010579
605500 -- (-640.534) [-640.941] (-640.601) (-642.319) * (-643.066) (-641.817) [-640.904] (-641.406) -- 0:00:23
606000 -- [-642.764] (-647.724) (-644.368) (-640.436) * (-640.528) (-641.362) (-640.965) [-640.184] -- 0:00:23
606500 -- (-639.874) (-642.905) [-642.432] (-644.702) * (-639.701) (-641.727) [-641.717] (-640.176) -- 0:00:23
607000 -- (-639.688) (-652.859) (-642.977) [-640.496] * (-643.695) [-641.692] (-643.481) (-642.412) -- 0:00:23
607500 -- [-640.834] (-643.941) (-642.307) (-640.595) * (-640.769) (-644.037) (-644.229) [-647.354] -- 0:00:23
608000 -- (-641.977) (-640.906) (-643.413) [-641.262] * (-640.354) (-642.961) (-643.886) [-642.072] -- 0:00:23
608500 -- (-642.629) (-644.452) (-645.422) [-641.198] * (-641.265) (-641.840) (-640.999) [-640.737] -- 0:00:23
609000 -- (-640.142) (-641.831) (-642.451) [-640.365] * [-641.828] (-643.762) (-639.890) (-643.699) -- 0:00:23
609500 -- [-643.009] (-642.379) (-644.381) (-643.642) * [-643.475] (-644.486) (-640.685) (-641.306) -- 0:00:23
610000 -- (-642.082) (-642.784) [-641.933] (-646.183) * (-645.053) (-642.189) [-640.978] (-642.191) -- 0:00:23
Average standard deviation of split frequencies: 0.010087
610500 -- (-643.178) (-642.379) [-640.715] (-641.295) * (-647.463) [-640.747] (-645.768) (-642.616) -- 0:00:23
611000 -- (-645.321) (-640.708) (-642.925) [-640.573] * (-643.801) (-643.490) (-641.681) [-643.248] -- 0:00:23
611500 -- (-643.157) (-642.664) [-640.281] (-641.581) * (-641.321) (-645.482) (-642.946) [-639.971] -- 0:00:23
612000 -- (-641.736) (-640.093) (-640.989) [-641.872] * (-642.063) (-644.482) (-644.601) [-641.384] -- 0:00:23
612500 -- (-641.508) (-643.281) (-642.386) [-641.631] * (-641.232) (-642.038) (-643.588) [-641.615] -- 0:00:23
613000 -- (-640.978) (-641.121) (-642.077) [-642.503] * (-647.051) (-643.258) [-643.377] (-642.036) -- 0:00:23
613500 -- (-642.469) (-644.008) [-641.196] (-644.024) * [-641.728] (-644.375) (-649.845) (-641.380) -- 0:00:23
614000 -- [-640.947] (-643.060) (-644.059) (-644.716) * (-639.827) (-645.019) (-640.797) [-644.008] -- 0:00:23
614500 -- (-640.748) (-644.299) [-641.687] (-643.991) * [-642.062] (-642.515) (-642.483) (-639.706) -- 0:00:23
615000 -- (-640.375) (-641.736) (-642.240) [-639.926] * (-642.491) (-643.081) [-640.331] (-639.969) -- 0:00:23
Average standard deviation of split frequencies: 0.010051
615500 -- [-640.671] (-640.832) (-643.559) (-645.291) * (-643.844) (-643.198) [-641.421] (-640.987) -- 0:00:23
616000 -- (-642.866) (-645.036) [-643.825] (-646.132) * (-646.791) (-641.832) [-640.919] (-641.979) -- 0:00:23
616500 -- [-642.077] (-642.086) (-641.776) (-642.565) * (-644.489) [-645.416] (-640.855) (-642.139) -- 0:00:23
617000 -- (-640.780) (-640.198) [-645.744] (-647.336) * [-641.559] (-643.850) (-644.543) (-640.355) -- 0:00:22
617500 -- (-642.304) (-645.536) (-643.081) [-645.013] * [-642.218] (-643.337) (-643.226) (-642.051) -- 0:00:22
618000 -- (-640.913) (-643.384) (-643.698) [-640.931] * [-641.456] (-643.378) (-641.404) (-642.316) -- 0:00:22
618500 -- (-642.182) (-643.796) (-641.032) [-640.637] * [-642.997] (-643.318) (-640.937) (-646.487) -- 0:00:22
619000 -- [-641.566] (-647.474) (-640.064) (-641.283) * (-642.768) (-646.278) (-643.204) [-642.219] -- 0:00:22
619500 -- (-643.844) (-642.926) [-641.180] (-640.687) * [-643.266] (-640.424) (-644.974) (-640.174) -- 0:00:22
620000 -- (-647.461) [-646.491] (-646.236) (-646.355) * (-642.711) [-641.616] (-646.471) (-639.939) -- 0:00:22
Average standard deviation of split frequencies: 0.010633
620500 -- [-641.433] (-643.027) (-642.965) (-642.218) * (-642.408) [-643.520] (-645.081) (-640.939) -- 0:00:22
621000 -- (-643.522) (-647.476) [-641.229] (-649.664) * (-642.057) (-644.051) (-642.159) [-640.979] -- 0:00:22
621500 -- (-640.084) [-642.245] (-641.889) (-644.553) * (-644.900) (-642.286) [-641.671] (-641.049) -- 0:00:22
622000 -- (-642.588) (-643.279) (-641.900) [-644.013] * (-641.623) (-643.609) [-642.433] (-642.285) -- 0:00:22
622500 -- (-641.903) (-642.349) [-643.164] (-640.384) * (-643.485) (-646.085) [-640.670] (-640.042) -- 0:00:22
623000 -- (-645.294) (-643.134) (-642.236) [-640.707] * [-641.990] (-644.391) (-640.449) (-640.114) -- 0:00:22
623500 -- [-641.310] (-642.711) (-642.653) (-640.491) * (-641.639) [-643.358] (-641.005) (-645.120) -- 0:00:22
624000 -- [-640.839] (-644.628) (-642.410) (-642.215) * (-643.110) (-646.347) (-643.446) [-642.863] -- 0:00:22
624500 -- (-641.189) (-640.693) (-641.384) [-641.402] * (-645.290) (-642.132) (-641.883) [-644.325] -- 0:00:22
625000 -- (-643.097) [-641.788] (-640.833) (-643.257) * (-645.835) (-642.826) (-645.407) [-642.927] -- 0:00:22
Average standard deviation of split frequencies: 0.010392
625500 -- [-642.325] (-641.772) (-641.694) (-641.607) * (-645.603) (-642.353) [-641.961] (-641.801) -- 0:00:22
626000 -- (-642.321) (-641.570) (-642.539) [-642.044] * (-643.406) [-643.444] (-645.240) (-641.327) -- 0:00:22
626500 -- (-639.889) (-640.875) [-639.848] (-642.648) * (-642.225) [-641.898] (-640.144) (-642.082) -- 0:00:22
627000 -- (-642.196) (-646.265) [-643.383] (-643.314) * (-640.470) (-643.535) [-640.801] (-641.576) -- 0:00:22
627500 -- (-645.340) [-642.898] (-643.308) (-639.816) * (-641.567) (-640.403) [-641.323] (-640.719) -- 0:00:22
628000 -- (-642.392) [-641.554] (-645.222) (-643.036) * (-641.695) [-643.079] (-641.308) (-646.885) -- 0:00:22
628500 -- (-641.911) (-645.240) (-641.759) [-640.462] * [-641.027] (-642.723) (-640.776) (-646.118) -- 0:00:22
629000 -- (-642.794) [-644.701] (-642.949) (-641.042) * (-641.164) (-644.797) [-641.902] (-642.706) -- 0:00:22
629500 -- (-644.445) [-647.530] (-640.519) (-644.149) * (-642.871) (-643.693) [-640.948] (-644.868) -- 0:00:22
630000 -- (-643.505) (-643.438) (-644.341) [-641.637] * (-644.016) [-641.807] (-643.201) (-642.341) -- 0:00:22
Average standard deviation of split frequencies: 0.010664
630500 -- (-642.566) [-644.870] (-642.923) (-641.079) * (-641.840) (-641.307) (-641.147) [-640.327] -- 0:00:22
631000 -- (-644.651) [-643.879] (-640.532) (-643.606) * (-641.248) (-644.072) (-644.422) [-640.850] -- 0:00:22
631500 -- [-641.657] (-641.549) (-642.763) (-641.970) * (-640.061) [-645.061] (-642.207) (-643.751) -- 0:00:22
632000 -- (-642.245) (-645.130) [-641.618] (-646.503) * (-639.801) [-641.496] (-645.927) (-643.131) -- 0:00:22
632500 -- (-640.769) [-643.192] (-640.100) (-645.109) * (-644.710) (-640.786) (-644.473) [-640.061] -- 0:00:22
633000 -- (-644.833) [-641.395] (-640.038) (-646.949) * (-644.603) [-642.368] (-647.098) (-641.853) -- 0:00:22
633500 -- [-640.699] (-641.268) (-643.099) (-645.129) * (-645.080) [-640.959] (-642.791) (-641.148) -- 0:00:21
634000 -- (-640.509) (-640.822) [-643.964] (-640.268) * (-641.784) [-641.669] (-645.285) (-647.173) -- 0:00:21
634500 -- (-641.819) (-640.871) (-643.542) [-641.953] * (-643.522) (-642.858) (-641.528) [-642.287] -- 0:00:21
635000 -- (-645.289) (-641.223) (-644.755) [-641.658] * (-643.219) (-641.338) (-641.385) [-644.263] -- 0:00:21
Average standard deviation of split frequencies: 0.011019
635500 -- (-642.702) (-641.797) [-644.170] (-643.692) * [-641.415] (-641.574) (-646.431) (-641.107) -- 0:00:21
636000 -- (-640.375) [-640.797] (-644.694) (-641.780) * (-640.768) [-643.153] (-640.056) (-640.768) -- 0:00:21
636500 -- [-640.366] (-642.222) (-643.066) (-643.130) * (-640.447) (-642.414) (-643.751) [-640.738] -- 0:00:21
637000 -- (-641.512) [-641.598] (-645.050) (-644.837) * [-640.484] (-640.347) (-641.179) (-644.305) -- 0:00:21
637500 -- (-641.008) [-643.078] (-642.315) (-643.013) * (-640.743) (-640.167) (-642.772) [-643.560] -- 0:00:21
638000 -- [-640.324] (-643.077) (-640.131) (-643.456) * [-641.157] (-642.405) (-640.426) (-642.274) -- 0:00:21
638500 -- [-643.535] (-640.992) (-646.367) (-641.429) * [-641.096] (-643.782) (-641.659) (-641.098) -- 0:00:21
639000 -- [-642.016] (-643.961) (-643.633) (-642.368) * (-641.192) [-641.748] (-643.254) (-643.481) -- 0:00:21
639500 -- (-642.077) (-641.864) (-642.925) [-642.290] * (-642.704) (-641.817) [-642.835] (-643.717) -- 0:00:21
640000 -- (-646.020) (-643.474) [-640.488] (-643.210) * (-641.489) (-641.943) (-646.182) [-641.094] -- 0:00:21
Average standard deviation of split frequencies: 0.011626
640500 -- (-644.274) [-640.932] (-641.317) (-641.136) * (-642.392) (-647.476) (-641.074) [-643.518] -- 0:00:21
641000 -- (-644.522) (-645.028) [-640.103] (-641.027) * (-641.617) (-644.468) [-640.535] (-645.153) -- 0:00:21
641500 -- [-645.786] (-642.178) (-644.065) (-644.116) * (-647.269) [-642.381] (-642.728) (-640.338) -- 0:00:21
642000 -- (-641.576) (-642.327) [-641.247] (-641.819) * [-641.096] (-645.230) (-642.777) (-644.228) -- 0:00:21
642500 -- (-641.485) [-640.851] (-640.614) (-641.552) * [-641.712] (-646.613) (-641.353) (-641.436) -- 0:00:21
643000 -- [-642.911] (-642.866) (-641.552) (-644.501) * (-645.280) [-643.156] (-641.069) (-642.768) -- 0:00:21
643500 -- (-644.432) (-643.151) [-641.128] (-643.062) * [-641.270] (-642.164) (-642.996) (-640.844) -- 0:00:21
644000 -- [-641.829] (-643.532) (-640.917) (-643.095) * (-640.360) (-642.593) (-643.990) [-641.546] -- 0:00:21
644500 -- [-643.410] (-644.250) (-641.110) (-643.862) * [-640.975] (-641.045) (-640.128) (-640.365) -- 0:00:21
645000 -- (-641.980) (-642.017) [-640.404] (-643.343) * (-640.464) (-641.129) (-639.956) [-641.729] -- 0:00:21
Average standard deviation of split frequencies: 0.011870
645500 -- (-641.524) [-641.928] (-641.507) (-642.187) * (-642.247) [-642.189] (-640.148) (-641.812) -- 0:00:21
646000 -- (-642.519) [-640.156] (-642.665) (-640.049) * (-642.126) (-645.886) (-640.608) [-642.773] -- 0:00:21
646500 -- (-641.913) [-642.462] (-642.383) (-642.999) * (-644.200) (-646.074) [-645.858] (-641.996) -- 0:00:21
647000 -- (-640.478) [-641.102] (-643.348) (-640.506) * [-642.740] (-645.503) (-643.067) (-641.223) -- 0:00:21
647500 -- [-643.188] (-641.525) (-642.081) (-641.354) * (-640.948) (-644.131) (-643.652) [-643.158] -- 0:00:21
648000 -- (-639.915) (-642.144) [-642.323] (-645.415) * [-640.009] (-641.981) (-642.273) (-642.503) -- 0:00:21
648500 -- (-639.896) [-640.833] (-643.539) (-640.506) * [-640.548] (-639.805) (-642.277) (-642.441) -- 0:00:21
649000 -- [-640.781] (-642.923) (-645.331) (-643.777) * (-641.217) [-641.101] (-645.707) (-643.495) -- 0:00:21
649500 -- (-643.666) (-641.583) (-642.955) [-641.406] * (-643.141) (-641.248) [-653.059] (-643.454) -- 0:00:21
650000 -- [-645.416] (-642.634) (-643.699) (-643.840) * [-642.861] (-644.860) (-650.565) (-642.769) -- 0:00:21
Average standard deviation of split frequencies: 0.011882
650500 -- (-642.858) [-642.787] (-643.620) (-641.691) * (-643.383) (-643.678) [-641.788] (-642.780) -- 0:00:20
651000 -- (-641.874) [-640.523] (-641.827) (-640.225) * [-643.023] (-643.195) (-643.898) (-640.163) -- 0:00:20
651500 -- (-644.113) (-642.376) (-643.370) [-643.919] * (-645.874) (-641.500) [-645.438] (-641.310) -- 0:00:20
652000 -- (-640.468) (-641.333) [-642.058] (-641.985) * (-640.313) (-641.634) [-642.187] (-640.155) -- 0:00:20
652500 -- (-641.923) [-641.654] (-642.460) (-642.949) * (-640.820) [-641.067] (-642.974) (-641.154) -- 0:00:20
653000 -- [-642.509] (-642.281) (-646.237) (-642.388) * (-641.119) (-641.260) (-643.553) [-641.118] -- 0:00:20
653500 -- (-642.949) (-643.041) (-640.762) [-641.029] * [-642.684] (-641.233) (-641.897) (-643.018) -- 0:00:20
654000 -- [-642.745] (-641.241) (-640.905) (-641.431) * (-642.961) (-641.191) (-642.076) [-640.946] -- 0:00:20
654500 -- (-645.930) (-640.668) [-640.821] (-640.975) * (-644.936) (-641.578) (-641.550) [-639.993] -- 0:00:20
655000 -- [-642.446] (-641.493) (-640.174) (-642.580) * (-640.976) (-642.614) [-642.298] (-642.079) -- 0:00:20
Average standard deviation of split frequencies: 0.011833
655500 -- (-640.998) (-640.647) [-642.812] (-643.208) * (-646.146) (-643.707) (-645.856) [-642.535] -- 0:00:20
656000 -- (-641.269) (-641.183) [-641.293] (-642.395) * (-641.759) (-641.929) (-641.685) [-642.956] -- 0:00:20
656500 -- (-640.900) [-642.011] (-641.201) (-643.954) * [-646.845] (-641.815) (-640.788) (-643.976) -- 0:00:20
657000 -- [-642.967] (-643.030) (-640.827) (-643.546) * (-644.090) (-643.157) (-641.462) [-642.851] -- 0:00:20
657500 -- (-645.990) (-641.097) (-641.364) [-640.437] * (-642.264) (-642.329) [-643.087] (-640.641) -- 0:00:20
658000 -- (-640.907) [-641.771] (-641.381) (-643.705) * (-642.540) (-642.061) (-641.878) [-642.843] -- 0:00:20
658500 -- (-640.161) [-641.092] (-643.194) (-645.875) * [-642.649] (-645.495) (-640.835) (-641.674) -- 0:00:20
659000 -- (-640.157) (-640.786) [-643.740] (-641.676) * (-645.644) (-641.107) (-644.983) [-644.158] -- 0:00:20
659500 -- (-641.881) [-640.891] (-641.975) (-642.730) * [-640.439] (-641.393) (-642.560) (-640.095) -- 0:00:20
660000 -- [-640.098] (-642.273) (-642.038) (-641.159) * [-640.546] (-643.546) (-641.838) (-640.649) -- 0:00:20
Average standard deviation of split frequencies: 0.011987
660500 -- (-640.442) [-640.309] (-643.708) (-640.848) * [-642.839] (-645.661) (-641.860) (-642.028) -- 0:00:20
661000 -- (-641.075) (-639.680) [-641.961] (-640.789) * (-640.528) [-642.982] (-643.210) (-640.278) -- 0:00:20
661500 -- (-643.541) [-642.262] (-641.286) (-640.628) * [-641.489] (-643.666) (-640.047) (-641.193) -- 0:00:20
662000 -- [-642.304] (-642.185) (-640.253) (-640.655) * (-642.694) (-641.384) (-646.632) [-640.021] -- 0:00:20
662500 -- (-643.154) (-641.092) [-641.564] (-640.058) * (-643.432) [-640.049] (-648.986) (-644.001) -- 0:00:20
663000 -- (-642.369) [-641.459] (-640.796) (-641.757) * (-641.451) [-639.927] (-642.997) (-644.067) -- 0:00:20
663500 -- [-643.351] (-642.718) (-641.105) (-642.354) * (-641.768) [-640.612] (-642.684) (-641.738) -- 0:00:20
664000 -- (-648.492) [-642.513] (-643.598) (-645.189) * (-645.629) (-640.557) [-643.615] (-641.817) -- 0:00:20
664500 -- (-643.131) [-641.362] (-643.153) (-642.974) * (-643.965) [-640.178] (-645.043) (-640.646) -- 0:00:20
665000 -- (-643.474) (-643.489) (-645.502) [-640.636] * (-640.850) (-642.207) (-644.024) [-639.948] -- 0:00:20
Average standard deviation of split frequencies: 0.012222
665500 -- [-642.102] (-645.680) (-640.908) (-645.338) * (-643.911) (-642.239) (-644.639) [-641.663] -- 0:00:20
666000 -- (-640.833) (-641.282) [-644.551] (-641.488) * (-643.869) [-640.624] (-645.554) (-641.966) -- 0:00:20
666500 -- (-648.158) (-640.272) (-642.110) [-641.975] * [-641.007] (-642.488) (-643.472) (-642.063) -- 0:00:20
667000 -- (-643.520) (-641.721) [-641.664] (-640.578) * (-642.058) [-640.815] (-641.722) (-640.482) -- 0:00:19
667500 -- (-642.721) (-643.182) [-642.785] (-645.208) * (-643.329) (-642.110) [-643.073] (-640.813) -- 0:00:19
668000 -- [-641.923] (-641.227) (-641.512) (-643.564) * (-641.096) (-642.150) [-642.609] (-643.714) -- 0:00:19
668500 -- (-643.511) [-643.042] (-640.336) (-643.766) * (-642.013) (-640.887) (-643.091) [-642.049] -- 0:00:19
669000 -- (-643.354) (-640.417) (-640.913) [-643.495] * (-641.529) (-642.750) [-640.804] (-643.474) -- 0:00:19
669500 -- (-642.870) (-641.474) [-642.329] (-644.388) * [-642.552] (-644.026) (-640.902) (-643.460) -- 0:00:19
670000 -- (-647.240) (-642.925) (-644.800) [-644.326] * (-642.479) [-641.783] (-641.481) (-643.146) -- 0:00:19
Average standard deviation of split frequencies: 0.012230
670500 -- (-643.769) [-641.909] (-646.340) (-644.040) * (-644.387) [-642.731] (-639.935) (-641.568) -- 0:00:19
671000 -- (-645.021) (-645.756) [-640.696] (-645.526) * (-646.215) (-644.146) (-641.810) [-641.383] -- 0:00:19
671500 -- (-642.303) [-640.593] (-643.155) (-642.221) * (-639.967) (-645.542) (-641.012) [-645.017] -- 0:00:19
672000 -- (-643.212) [-640.572] (-643.464) (-647.470) * (-645.039) [-643.533] (-641.339) (-641.048) -- 0:00:19
672500 -- (-641.428) (-640.250) [-641.812] (-641.722) * [-644.246] (-647.482) (-643.980) (-641.504) -- 0:00:19
673000 -- [-641.105] (-640.706) (-640.628) (-646.692) * [-645.220] (-641.930) (-642.868) (-642.678) -- 0:00:19
673500 -- (-640.492) [-643.669] (-642.817) (-643.461) * (-641.594) (-644.626) (-641.256) [-640.857] -- 0:00:19
674000 -- (-640.629) (-642.000) [-641.066] (-641.624) * [-641.622] (-639.854) (-640.380) (-641.069) -- 0:00:19
674500 -- (-640.195) (-643.646) (-641.903) [-642.709] * (-642.973) (-646.751) [-640.469] (-640.758) -- 0:00:19
675000 -- (-641.424) (-642.620) (-641.944) [-642.996] * (-640.870) (-647.381) [-642.276] (-643.025) -- 0:00:19
Average standard deviation of split frequencies: 0.012041
675500 -- (-644.780) (-641.618) [-644.436] (-641.775) * [-640.825] (-643.628) (-642.330) (-645.736) -- 0:00:19
676000 -- (-642.916) (-642.391) (-644.985) [-646.857] * [-644.219] (-648.511) (-643.258) (-641.132) -- 0:00:19
676500 -- (-639.995) (-641.082) [-642.237] (-641.045) * (-641.755) (-645.286) [-640.356] (-641.902) -- 0:00:19
677000 -- [-642.140] (-643.937) (-644.669) (-641.314) * (-640.837) [-642.203] (-642.444) (-645.358) -- 0:00:19
677500 -- [-640.562] (-649.148) (-643.650) (-644.531) * (-641.996) (-640.804) (-642.840) [-640.893] -- 0:00:19
678000 -- (-641.028) [-646.876] (-644.634) (-644.917) * (-640.998) (-640.804) (-641.155) [-640.898] -- 0:00:19
678500 -- [-641.058] (-643.648) (-643.085) (-642.030) * (-645.985) [-640.416] (-641.015) (-641.319) -- 0:00:19
679000 -- (-640.348) (-643.626) [-644.260] (-640.966) * [-644.478] (-641.689) (-641.216) (-641.557) -- 0:00:19
679500 -- [-640.365] (-644.637) (-649.404) (-641.288) * (-645.294) (-642.736) (-641.865) [-643.309] -- 0:00:19
680000 -- [-640.935] (-640.411) (-640.925) (-641.452) * (-640.157) [-641.038] (-642.464) (-644.474) -- 0:00:19
Average standard deviation of split frequencies: 0.011589
680500 -- (-643.238) [-643.833] (-640.169) (-646.738) * (-641.039) (-641.057) (-640.729) [-642.175] -- 0:00:19
681000 -- [-642.571] (-640.091) (-640.719) (-644.611) * [-641.814] (-641.174) (-641.586) (-640.217) -- 0:00:19
681500 -- (-644.649) (-642.815) [-641.649] (-641.093) * (-641.793) [-642.413] (-644.285) (-645.259) -- 0:00:19
682000 -- [-642.456] (-642.758) (-642.632) (-642.056) * (-642.139) [-642.120] (-643.129) (-641.850) -- 0:00:19
682500 -- (-639.755) (-644.768) [-640.997] (-641.349) * (-641.033) (-640.713) [-641.388] (-643.719) -- 0:00:19
683000 -- [-639.718] (-645.784) (-645.181) (-642.295) * (-642.848) (-642.110) (-641.748) [-641.546] -- 0:00:19
683500 -- [-643.165] (-643.981) (-641.765) (-641.446) * (-640.957) (-641.125) [-643.134] (-642.653) -- 0:00:18
684000 -- [-642.188] (-643.179) (-641.665) (-641.919) * (-641.122) (-643.398) [-645.160] (-641.102) -- 0:00:18
684500 -- (-642.378) (-643.994) (-643.855) [-640.047] * (-640.680) (-641.953) [-643.208] (-639.827) -- 0:00:18
685000 -- (-640.271) [-642.165] (-644.215) (-641.575) * [-641.105] (-643.602) (-643.815) (-640.237) -- 0:00:18
Average standard deviation of split frequencies: 0.011636
685500 -- (-641.082) (-640.155) (-642.415) [-641.414] * (-643.362) (-646.655) [-643.718] (-640.308) -- 0:00:18
686000 -- (-641.082) (-640.666) [-643.222] (-642.763) * (-642.992) (-644.960) [-640.124] (-641.342) -- 0:00:18
686500 -- (-640.491) (-641.005) (-644.098) [-640.852] * (-641.817) [-640.706] (-641.899) (-640.640) -- 0:00:18
687000 -- (-640.165) [-641.088] (-644.289) (-639.994) * (-640.774) (-641.993) (-645.208) [-640.595] -- 0:00:18
687500 -- (-644.582) (-648.174) (-640.757) [-640.174] * [-641.241] (-641.313) (-640.620) (-641.818) -- 0:00:18
688000 -- (-641.108) [-640.564] (-643.047) (-640.453) * [-645.082] (-642.612) (-642.076) (-641.809) -- 0:00:18
688500 -- [-641.012] (-640.978) (-646.629) (-640.107) * (-643.315) [-642.180] (-641.965) (-641.913) -- 0:00:18
689000 -- (-643.223) (-640.604) [-647.257] (-642.244) * (-642.952) (-641.091) [-646.929] (-641.446) -- 0:00:18
689500 -- [-645.860] (-640.509) (-640.647) (-640.702) * (-644.742) [-641.126] (-644.120) (-640.982) -- 0:00:18
690000 -- (-640.566) [-643.140] (-640.042) (-641.448) * (-640.286) [-641.538] (-644.034) (-642.038) -- 0:00:18
Average standard deviation of split frequencies: 0.011558
690500 -- (-643.259) (-646.462) (-644.983) [-640.514] * (-644.188) (-641.642) (-648.516) [-641.881] -- 0:00:18
691000 -- (-642.039) [-641.037] (-641.698) (-641.485) * [-644.268] (-640.684) (-643.754) (-643.661) -- 0:00:18
691500 -- (-640.350) (-643.702) [-640.210] (-642.593) * [-640.481] (-642.687) (-643.035) (-642.532) -- 0:00:18
692000 -- (-643.853) (-641.193) (-646.450) [-641.001] * (-641.882) (-642.014) [-641.001] (-640.455) -- 0:00:18
692500 -- (-642.246) (-641.513) (-639.874) [-641.823] * (-644.857) (-642.253) [-642.347] (-642.680) -- 0:00:18
693000 -- [-641.805] (-641.281) (-640.742) (-640.357) * (-641.130) (-644.756) (-643.441) [-641.552] -- 0:00:18
693500 -- (-641.601) (-640.067) (-641.781) [-641.785] * (-645.754) (-643.915) (-641.601) [-641.579] -- 0:00:18
694000 -- [-644.450] (-643.362) (-639.613) (-639.949) * (-641.311) [-642.118] (-644.073) (-642.914) -- 0:00:18
694500 -- (-640.470) (-641.544) (-640.615) [-641.442] * (-644.698) (-640.739) [-641.430] (-645.515) -- 0:00:18
695000 -- (-641.618) (-645.361) (-642.212) [-640.157] * (-643.788) (-643.528) (-644.702) [-643.042] -- 0:00:18
Average standard deviation of split frequencies: 0.011695
695500 -- (-641.278) (-645.250) (-644.407) [-641.842] * (-640.029) (-645.079) [-644.059] (-641.183) -- 0:00:18
696000 -- [-647.635] (-644.656) (-639.889) (-641.264) * (-641.672) (-643.121) [-640.676] (-642.671) -- 0:00:18
696500 -- (-641.141) (-645.963) [-639.791] (-640.409) * (-643.072) [-641.257] (-641.983) (-640.859) -- 0:00:18
697000 -- (-642.248) (-646.063) [-642.137] (-646.593) * (-643.730) [-640.386] (-642.881) (-640.749) -- 0:00:18
697500 -- (-641.810) (-642.605) (-641.983) [-641.403] * (-644.082) [-644.868] (-640.554) (-641.049) -- 0:00:18
698000 -- (-643.570) (-640.781) (-642.069) [-643.330] * (-647.586) [-643.408] (-640.445) (-643.890) -- 0:00:18
698500 -- (-643.236) (-641.352) [-643.356] (-645.680) * [-646.533] (-642.928) (-642.698) (-640.203) -- 0:00:18
699000 -- (-639.764) [-640.600] (-643.408) (-643.162) * [-648.816] (-642.123) (-642.002) (-642.591) -- 0:00:18
699500 -- [-642.199] (-641.380) (-642.275) (-642.176) * (-641.660) (-641.114) [-644.688] (-641.592) -- 0:00:18
700000 -- (-640.851) [-641.182] (-641.127) (-643.519) * (-641.419) (-643.434) [-643.846] (-644.788) -- 0:00:18
Average standard deviation of split frequencies: 0.011841
700500 -- (-640.057) (-641.216) [-642.601] (-643.790) * (-644.888) (-644.872) (-642.356) [-641.373] -- 0:00:17
701000 -- (-640.993) [-640.613] (-645.947) (-642.116) * (-644.147) [-641.010] (-645.013) (-641.848) -- 0:00:17
701500 -- (-643.607) (-643.240) (-645.954) [-640.911] * [-641.120] (-645.532) (-640.496) (-640.259) -- 0:00:17
702000 -- (-640.880) [-644.552] (-648.482) (-644.648) * (-640.585) (-641.168) (-641.999) [-641.329] -- 0:00:17
702500 -- (-640.705) (-643.331) [-642.551] (-645.325) * [-642.115] (-640.261) (-641.286) (-640.547) -- 0:00:17
703000 -- [-642.806] (-640.671) (-641.979) (-646.943) * (-642.431) [-643.471] (-640.997) (-641.467) -- 0:00:17
703500 -- (-641.020) [-640.226] (-649.186) (-645.889) * (-643.754) (-641.571) [-641.877] (-640.857) -- 0:00:17
704000 -- (-650.008) [-642.639] (-643.352) (-642.282) * [-641.189] (-641.952) (-646.325) (-640.352) -- 0:00:17
704500 -- (-643.117) [-642.058] (-643.779) (-642.243) * (-640.368) (-646.218) [-641.444] (-643.311) -- 0:00:17
705000 -- (-641.848) [-641.423] (-644.670) (-641.328) * (-641.136) (-640.374) [-642.780] (-645.493) -- 0:00:17
Average standard deviation of split frequencies: 0.010995
705500 -- (-643.277) [-640.482] (-644.110) (-642.285) * [-641.827] (-642.066) (-643.532) (-644.122) -- 0:00:17
706000 -- (-644.563) (-643.613) [-642.224] (-641.660) * (-642.881) (-641.159) (-641.905) [-640.102] -- 0:00:17
706500 -- (-643.357) (-648.114) (-641.999) [-642.578] * (-641.553) (-643.154) [-641.709] (-642.205) -- 0:00:17
707000 -- (-640.901) [-640.771] (-640.516) (-641.804) * (-642.217) (-641.146) [-641.084] (-643.211) -- 0:00:17
707500 -- (-641.570) [-640.728] (-647.154) (-640.974) * (-641.390) [-641.390] (-640.923) (-641.870) -- 0:00:17
708000 -- (-642.615) [-641.938] (-643.424) (-641.063) * (-641.919) (-641.045) (-639.933) [-640.829] -- 0:00:17
708500 -- (-644.423) (-641.759) [-640.169] (-641.320) * (-640.418) (-641.494) (-640.086) [-642.149] -- 0:00:17
709000 -- (-642.043) (-640.870) (-641.624) [-641.562] * [-641.434] (-641.951) (-643.038) (-644.516) -- 0:00:17
709500 -- (-641.691) (-642.686) [-642.334] (-642.111) * [-644.874] (-644.951) (-647.287) (-643.808) -- 0:00:17
710000 -- [-640.171] (-640.906) (-641.605) (-642.454) * (-644.524) [-640.864] (-643.234) (-641.755) -- 0:00:17
Average standard deviation of split frequencies: 0.010304
710500 -- [-641.173] (-640.956) (-641.439) (-644.996) * (-646.626) (-642.020) (-642.821) [-641.994] -- 0:00:17
711000 -- (-643.741) [-640.541] (-641.635) (-642.333) * (-644.498) (-643.872) [-646.102] (-641.214) -- 0:00:17
711500 -- [-639.992] (-641.549) (-643.195) (-640.327) * (-641.513) (-640.617) (-640.823) [-642.042] -- 0:00:17
712000 -- (-642.835) (-640.813) (-642.076) [-640.334] * (-647.043) (-646.348) (-644.221) [-643.227] -- 0:00:17
712500 -- [-644.486] (-640.028) (-640.591) (-640.342) * (-642.228) (-641.768) (-642.340) [-641.998] -- 0:00:17
713000 -- (-640.542) (-640.300) (-642.801) [-641.536] * (-642.581) [-640.508] (-642.450) (-641.784) -- 0:00:17
713500 -- (-641.918) [-642.644] (-641.614) (-641.612) * (-643.692) [-642.252] (-640.389) (-642.594) -- 0:00:17
714000 -- [-641.207] (-642.803) (-641.764) (-640.741) * (-642.278) (-644.284) (-644.722) [-642.118] -- 0:00:17
714500 -- (-642.557) [-640.138] (-642.200) (-639.801) * (-647.279) (-642.357) (-643.527) [-643.327] -- 0:00:17
715000 -- (-644.434) (-646.851) (-641.507) [-640.703] * (-641.229) (-643.473) (-643.675) [-640.825] -- 0:00:17
Average standard deviation of split frequencies: 0.010051
715500 -- [-642.577] (-643.228) (-640.803) (-641.242) * (-641.717) [-640.819] (-643.736) (-646.673) -- 0:00:17
716000 -- (-642.484) [-641.590] (-641.727) (-640.019) * (-642.246) (-642.431) (-644.191) [-643.520] -- 0:00:17
716500 -- [-643.584] (-642.631) (-640.618) (-642.103) * (-640.560) [-642.505] (-641.373) (-645.668) -- 0:00:17
717000 -- (-641.088) (-643.215) [-642.371] (-642.754) * (-641.150) [-646.367] (-643.457) (-642.791) -- 0:00:16
717500 -- (-644.933) (-641.095) [-641.929] (-642.011) * (-640.491) [-641.320] (-643.520) (-642.377) -- 0:00:16
718000 -- (-641.111) (-641.676) (-642.543) [-643.653] * (-642.265) (-644.759) [-642.676] (-643.617) -- 0:00:16
718500 -- (-641.744) (-642.889) (-640.967) [-642.962] * (-641.196) [-642.246] (-643.642) (-640.552) -- 0:00:16
719000 -- (-641.988) (-642.768) [-640.094] (-640.729) * (-641.720) (-640.506) [-641.146] (-642.114) -- 0:00:16
719500 -- (-644.800) [-640.193] (-640.457) (-640.841) * (-644.865) [-643.105] (-642.142) (-640.577) -- 0:00:16
720000 -- (-643.623) (-640.960) [-642.006] (-640.547) * (-642.729) (-643.022) [-642.341] (-640.173) -- 0:00:16
Average standard deviation of split frequencies: 0.010204
720500 -- (-644.099) (-641.309) (-643.080) [-640.286] * (-642.094) (-641.952) [-640.712] (-640.940) -- 0:00:16
721000 -- [-643.604] (-640.574) (-641.619) (-639.891) * (-640.699) (-643.946) [-640.085] (-640.309) -- 0:00:16
721500 -- [-641.169] (-640.235) (-645.179) (-641.391) * [-640.473] (-645.327) (-642.661) (-640.389) -- 0:00:16
722000 -- (-642.572) [-640.599] (-643.798) (-641.858) * [-643.147] (-643.774) (-641.669) (-643.331) -- 0:00:16
722500 -- (-641.724) (-641.072) [-640.927] (-644.275) * [-641.492] (-642.584) (-641.277) (-643.720) -- 0:00:16
723000 -- (-641.429) (-644.063) (-643.160) [-639.803] * [-644.910] (-643.511) (-641.352) (-644.046) -- 0:00:16
723500 -- (-651.374) [-640.548] (-641.191) (-641.668) * (-640.905) (-640.763) (-641.211) [-639.920] -- 0:00:16
724000 -- (-642.116) [-640.977] (-640.681) (-641.219) * [-643.622] (-643.360) (-641.142) (-647.530) -- 0:00:16
724500 -- (-645.209) [-642.067] (-642.269) (-642.589) * (-640.545) [-642.197] (-642.791) (-642.990) -- 0:00:16
725000 -- (-642.439) (-644.488) [-644.615] (-641.181) * (-645.976) (-649.113) (-643.234) [-645.060] -- 0:00:16
Average standard deviation of split frequencies: 0.009956
725500 -- (-642.789) [-642.162] (-643.936) (-641.555) * (-644.322) (-653.419) [-641.687] (-641.429) -- 0:00:16
726000 -- (-644.127) (-643.975) [-642.313] (-640.494) * (-642.510) [-646.061] (-641.884) (-642.196) -- 0:00:16
726500 -- [-643.680] (-641.925) (-640.943) (-647.880) * (-641.402) (-644.229) [-640.914] (-640.714) -- 0:00:16
727000 -- (-642.966) [-640.006] (-644.993) (-641.838) * [-642.154] (-644.000) (-639.907) (-645.395) -- 0:00:16
727500 -- (-642.063) [-640.241] (-640.574) (-643.428) * [-642.127] (-640.070) (-646.911) (-645.233) -- 0:00:16
728000 -- (-641.108) (-643.938) [-640.204] (-643.331) * (-643.128) [-641.100] (-642.403) (-641.889) -- 0:00:16
728500 -- (-640.959) (-643.725) (-642.384) [-644.781] * [-643.683] (-641.948) (-641.619) (-641.323) -- 0:00:16
729000 -- (-641.097) [-640.013] (-641.205) (-643.746) * (-642.801) (-640.829) [-641.376] (-642.057) -- 0:00:16
729500 -- [-643.192] (-640.838) (-642.308) (-642.501) * (-642.028) (-645.825) [-640.467] (-643.694) -- 0:00:16
730000 -- (-641.284) (-641.263) [-643.537] (-644.888) * [-641.915] (-641.194) (-641.398) (-642.435) -- 0:00:16
Average standard deviation of split frequencies: 0.010667
730500 -- (-641.386) (-642.895) (-643.078) [-642.241] * [-642.870] (-640.160) (-642.480) (-643.446) -- 0:00:16
731000 -- [-641.801] (-644.792) (-641.518) (-641.429) * (-644.965) (-642.239) [-642.593] (-643.952) -- 0:00:16
731500 -- [-642.103] (-643.532) (-642.427) (-640.743) * (-643.088) (-643.713) [-640.117] (-642.537) -- 0:00:16
732000 -- (-641.203) (-640.298) [-641.287] (-641.300) * (-641.778) (-640.647) (-643.052) [-642.351] -- 0:00:16
732500 -- (-642.760) (-642.399) [-641.197] (-641.381) * (-643.860) (-640.345) (-640.352) [-647.186] -- 0:00:16
733000 -- [-643.290] (-640.588) (-642.079) (-642.879) * (-647.646) (-644.713) [-641.037] (-647.576) -- 0:00:16
733500 -- [-641.497] (-641.938) (-643.799) (-642.474) * (-641.336) [-641.675] (-640.102) (-640.761) -- 0:00:15
734000 -- (-641.665) (-641.085) [-646.469] (-643.611) * (-640.810) (-641.453) (-645.987) [-640.911] -- 0:00:15
734500 -- (-640.908) (-641.085) (-644.248) [-640.968] * (-641.446) (-642.283) [-641.188] (-646.396) -- 0:00:15
735000 -- (-641.972) (-644.480) [-646.433] (-643.060) * [-641.403] (-644.572) (-640.871) (-640.837) -- 0:00:15
Average standard deviation of split frequencies: 0.010034
735500 -- (-645.700) [-642.980] (-644.969) (-642.867) * (-644.075) (-640.088) (-642.973) [-641.204] -- 0:00:15
736000 -- (-642.851) [-642.414] (-645.811) (-645.846) * (-640.994) [-647.025] (-642.250) (-642.414) -- 0:00:15
736500 -- [-642.163] (-640.407) (-643.122) (-641.601) * [-640.773] (-645.345) (-641.340) (-646.372) -- 0:00:15
737000 -- [-640.029] (-641.446) (-643.335) (-641.980) * [-641.394] (-646.458) (-642.561) (-641.148) -- 0:00:15
737500 -- [-643.198] (-642.364) (-640.663) (-642.066) * (-641.622) (-642.181) [-641.812] (-643.055) -- 0:00:15
738000 -- (-642.159) (-641.994) (-646.255) [-643.633] * (-640.201) (-645.595) (-646.407) [-640.554] -- 0:00:15
738500 -- (-641.172) [-643.053] (-641.727) (-641.954) * (-640.949) (-641.037) [-643.125] (-647.049) -- 0:00:15
739000 -- (-640.247) [-644.737] (-640.764) (-640.922) * (-640.748) (-640.653) [-643.033] (-644.238) -- 0:00:15
739500 -- (-641.100) (-643.403) (-641.040) [-642.014] * (-642.878) [-641.860] (-642.125) (-641.250) -- 0:00:15
740000 -- (-640.583) [-640.133] (-640.650) (-640.638) * (-644.745) [-643.978] (-640.846) (-641.557) -- 0:00:15
Average standard deviation of split frequencies: 0.010523
740500 -- (-643.311) (-642.953) (-640.765) [-642.292] * (-643.835) [-641.427] (-640.992) (-645.694) -- 0:00:15
741000 -- (-642.319) (-643.275) [-641.065] (-642.322) * [-640.720] (-642.671) (-641.355) (-642.173) -- 0:00:15
741500 -- (-640.713) (-642.664) (-645.085) [-645.048] * (-643.563) [-641.840] (-643.580) (-643.763) -- 0:00:15
742000 -- (-641.920) [-643.588] (-644.159) (-641.783) * (-640.493) (-641.281) [-642.333] (-643.783) -- 0:00:15
742500 -- (-642.683) (-643.478) (-641.014) [-640.264] * [-640.242] (-640.400) (-642.520) (-640.876) -- 0:00:15
743000 -- [-641.000] (-641.909) (-640.273) (-641.062) * (-640.451) [-640.853] (-642.367) (-640.976) -- 0:00:15
743500 -- (-641.868) [-641.881] (-645.230) (-643.372) * [-641.786] (-642.596) (-641.339) (-641.970) -- 0:00:15
744000 -- (-642.051) [-643.671] (-641.075) (-643.667) * (-643.482) (-641.679) [-640.282] (-645.163) -- 0:00:15
744500 -- (-641.547) [-648.445] (-641.798) (-645.248) * (-640.737) [-641.117] (-641.116) (-640.625) -- 0:00:15
745000 -- [-643.382] (-643.229) (-641.452) (-641.203) * [-640.657] (-642.088) (-642.262) (-642.341) -- 0:00:15
Average standard deviation of split frequencies: 0.010387
745500 -- (-641.161) [-640.828] (-640.294) (-641.066) * (-644.805) [-642.795] (-642.773) (-642.588) -- 0:00:15
746000 -- (-642.072) (-641.357) [-643.618] (-641.102) * [-642.552] (-642.582) (-642.874) (-640.685) -- 0:00:15
746500 -- [-644.429] (-640.801) (-641.645) (-641.070) * (-640.652) (-645.505) (-643.552) [-639.684] -- 0:00:15
747000 -- (-646.383) [-652.330] (-643.408) (-643.045) * (-641.689) (-642.046) [-644.944] (-642.062) -- 0:00:15
747500 -- [-640.737] (-643.840) (-642.418) (-647.256) * (-640.794) [-641.116] (-643.986) (-642.627) -- 0:00:15
748000 -- (-642.453) (-645.737) [-640.922] (-641.399) * (-640.745) (-645.857) [-642.349] (-642.840) -- 0:00:15
748500 -- (-642.933) (-646.419) [-642.767] (-641.650) * (-642.453) (-645.042) (-640.973) [-641.818] -- 0:00:15
749000 -- [-642.126] (-643.092) (-641.687) (-641.252) * [-640.683] (-644.658) (-641.490) (-640.648) -- 0:00:15
749500 -- (-640.659) (-643.288) (-644.945) [-640.690] * (-642.489) [-644.246] (-641.490) (-641.988) -- 0:00:15
750000 -- (-644.281) [-646.077] (-643.492) (-642.176) * [-642.506] (-652.664) (-642.293) (-642.802) -- 0:00:15
Average standard deviation of split frequencies: 0.010558
750500 -- (-642.425) (-641.137) [-642.853] (-641.124) * [-642.376] (-647.225) (-643.335) (-640.394) -- 0:00:14
751000 -- (-644.317) (-642.723) [-644.943] (-641.353) * (-641.985) (-640.705) [-642.612] (-642.006) -- 0:00:14
751500 -- (-641.615) (-642.305) (-641.400) [-644.377] * (-644.756) (-643.982) [-646.435] (-641.923) -- 0:00:14
752000 -- (-646.319) [-642.750] (-642.215) (-640.407) * (-644.331) [-647.139] (-647.090) (-641.901) -- 0:00:14
752500 -- [-643.237] (-641.963) (-642.470) (-645.584) * (-642.985) [-639.873] (-641.301) (-640.387) -- 0:00:14
753000 -- (-640.398) (-644.841) (-642.934) [-641.875] * (-640.468) [-642.933] (-642.845) (-643.591) -- 0:00:14
753500 -- (-640.208) (-641.181) (-642.940) [-640.636] * (-640.935) (-643.924) [-640.833] (-643.181) -- 0:00:14
754000 -- [-640.240] (-648.894) (-644.759) (-643.632) * (-643.520) [-643.631] (-641.474) (-642.391) -- 0:00:14
754500 -- (-643.553) (-644.936) (-641.902) [-642.552] * (-645.146) [-642.995] (-640.981) (-641.926) -- 0:00:14
755000 -- (-639.980) (-641.766) (-641.539) [-639.770] * (-641.603) (-644.062) (-644.597) [-642.842] -- 0:00:14
Average standard deviation of split frequencies: 0.010444
755500 -- (-640.789) (-640.817) [-644.102] (-641.290) * [-639.919] (-649.052) (-642.978) (-642.102) -- 0:00:14
756000 -- (-640.318) (-641.735) [-641.902] (-641.096) * [-643.448] (-651.308) (-641.499) (-642.194) -- 0:00:14
756500 -- (-641.800) (-644.333) [-642.489] (-641.879) * (-641.362) (-642.466) (-643.381) [-640.565] -- 0:00:14
757000 -- (-641.153) (-644.414) [-639.973] (-641.595) * [-641.777] (-641.031) (-642.197) (-640.900) -- 0:00:14
757500 -- [-642.148] (-643.582) (-642.014) (-643.160) * (-642.674) (-641.753) (-642.162) [-642.175] -- 0:00:14
758000 -- [-640.168] (-641.881) (-642.260) (-649.288) * (-644.617) [-646.374] (-641.746) (-647.319) -- 0:00:14
758500 -- [-644.279] (-643.723) (-642.818) (-643.959) * (-640.845) (-644.478) [-640.909] (-643.814) -- 0:00:14
759000 -- (-643.264) (-641.676) [-641.443] (-641.173) * (-642.122) [-646.031] (-644.290) (-642.213) -- 0:00:14
759500 -- (-642.073) [-641.145] (-642.438) (-642.991) * [-641.034] (-647.317) (-644.767) (-647.590) -- 0:00:14
760000 -- (-642.927) (-640.401) (-641.546) [-640.688] * (-644.449) [-641.231] (-640.259) (-644.144) -- 0:00:14
Average standard deviation of split frequencies: 0.010458
760500 -- (-643.395) (-642.031) [-644.091] (-643.203) * (-647.045) (-642.716) [-640.018] (-640.493) -- 0:00:14
761000 -- (-642.038) (-642.565) (-641.655) [-642.746] * (-641.182) (-641.368) [-643.113] (-640.594) -- 0:00:14
761500 -- [-642.657] (-642.778) (-642.816) (-641.844) * (-641.068) [-640.343] (-640.801) (-639.990) -- 0:00:14
762000 -- (-645.524) (-640.817) [-641.774] (-641.595) * (-642.637) (-641.406) [-640.353] (-643.125) -- 0:00:14
762500 -- (-642.935) (-643.162) [-640.294] (-641.709) * [-644.443] (-642.816) (-640.249) (-643.903) -- 0:00:14
763000 -- [-641.882] (-641.617) (-642.804) (-643.608) * (-644.437) (-643.398) (-640.734) [-643.330] -- 0:00:14
763500 -- (-644.087) (-641.645) [-641.048] (-640.807) * (-640.835) (-644.717) (-640.553) [-641.485] -- 0:00:14
764000 -- (-642.650) (-644.805) [-644.222] (-641.189) * [-641.972] (-643.074) (-643.744) (-641.708) -- 0:00:14
764500 -- (-642.896) (-642.717) (-644.979) [-640.552] * [-641.185] (-642.069) (-641.846) (-644.889) -- 0:00:14
765000 -- (-641.624) (-639.889) [-645.785] (-642.112) * (-641.702) (-642.918) (-642.748) [-641.789] -- 0:00:14
Average standard deviation of split frequencies: 0.010616
765500 -- [-640.327] (-641.183) (-641.446) (-641.289) * (-645.089) (-641.198) [-643.134] (-644.209) -- 0:00:14
766000 -- [-646.430] (-642.569) (-641.669) (-643.657) * [-641.377] (-640.881) (-644.865) (-643.037) -- 0:00:14
766500 -- (-641.791) (-642.017) (-641.336) [-643.686] * [-640.111] (-644.101) (-642.143) (-644.509) -- 0:00:14
767000 -- [-640.937] (-641.722) (-643.250) (-642.314) * [-640.958] (-643.876) (-643.995) (-640.855) -- 0:00:13
767500 -- (-641.447) (-640.213) [-642.782] (-639.920) * [-641.885] (-644.485) (-641.155) (-642.978) -- 0:00:13
768000 -- [-643.832] (-642.347) (-644.467) (-644.355) * (-641.117) (-644.173) (-641.006) [-642.736] -- 0:00:13
768500 -- (-641.534) (-642.810) [-641.090] (-639.737) * (-642.970) (-646.306) (-640.755) [-642.129] -- 0:00:13
769000 -- (-641.313) (-643.794) (-640.458) [-641.699] * (-640.303) [-640.391] (-644.982) (-641.423) -- 0:00:13
769500 -- [-640.643] (-642.686) (-640.488) (-645.665) * (-640.588) (-643.825) (-643.601) [-642.290] -- 0:00:13
770000 -- (-641.092) (-644.197) [-641.461] (-642.064) * (-643.513) (-645.099) (-641.590) [-641.641] -- 0:00:13
Average standard deviation of split frequencies: 0.009596
770500 -- [-640.489] (-641.765) (-640.563) (-641.709) * (-644.443) (-642.212) [-642.742] (-640.066) -- 0:00:13
771000 -- (-640.885) (-643.246) [-640.398] (-640.510) * (-648.747) (-640.545) [-642.810] (-641.096) -- 0:00:13
771500 -- (-641.384) [-640.633] (-640.204) (-644.396) * (-641.093) (-640.243) (-642.048) [-645.348] -- 0:00:13
772000 -- [-641.684] (-643.708) (-640.887) (-646.400) * (-641.397) (-641.156) [-643.174] (-641.346) -- 0:00:13
772500 -- (-640.103) (-642.514) (-643.820) [-641.130] * (-642.314) (-641.544) (-643.358) [-640.164] -- 0:00:13
773000 -- [-644.462] (-642.841) (-642.990) (-641.841) * (-644.574) (-640.825) [-642.918] (-640.824) -- 0:00:13
773500 -- (-644.848) (-643.974) (-641.819) [-643.537] * [-642.959] (-642.042) (-642.158) (-643.718) -- 0:00:13
774000 -- (-642.240) (-641.551) [-643.723] (-639.773) * [-646.031] (-642.225) (-642.077) (-640.787) -- 0:00:13
774500 -- [-641.171] (-641.660) (-642.815) (-642.031) * [-641.962] (-641.402) (-640.876) (-640.070) -- 0:00:13
775000 -- (-640.604) [-641.077] (-642.311) (-641.488) * (-641.975) (-641.134) [-640.119] (-645.736) -- 0:00:13
Average standard deviation of split frequencies: 0.009720
775500 -- (-640.987) (-642.817) [-641.340] (-642.618) * (-642.531) [-640.839] (-642.265) (-640.363) -- 0:00:13
776000 -- (-643.052) (-642.026) [-641.857] (-643.551) * [-641.853] (-644.612) (-642.558) (-641.380) -- 0:00:13
776500 -- [-641.743] (-640.772) (-642.856) (-642.333) * (-640.702) (-642.814) [-641.597] (-641.050) -- 0:00:13
777000 -- (-642.566) (-641.431) (-641.993) [-640.417] * (-641.859) (-643.000) [-645.019] (-640.758) -- 0:00:13
777500 -- (-640.544) [-646.900] (-641.446) (-640.817) * (-641.632) (-641.578) (-646.015) [-643.144] -- 0:00:13
778000 -- [-640.295] (-640.735) (-649.466) (-641.457) * [-642.349] (-641.285) (-644.175) (-641.980) -- 0:00:13
778500 -- (-643.362) [-641.802] (-650.726) (-644.832) * (-646.067) [-642.157] (-642.203) (-640.810) -- 0:00:13
779000 -- (-642.867) [-641.717] (-648.045) (-643.574) * (-642.258) [-644.234] (-641.789) (-643.774) -- 0:00:13
779500 -- (-644.334) (-642.761) (-642.793) [-641.266] * (-643.757) [-644.131] (-643.007) (-641.007) -- 0:00:13
780000 -- (-644.244) (-641.203) [-640.341] (-640.459) * (-645.361) (-641.035) (-642.979) [-642.983] -- 0:00:13
Average standard deviation of split frequencies: 0.009541
780500 -- [-643.177] (-644.102) (-641.687) (-644.467) * (-642.672) (-639.935) [-642.281] (-641.536) -- 0:00:13
781000 -- (-641.992) (-642.537) (-647.306) [-643.548] * [-644.772] (-640.908) (-641.860) (-643.121) -- 0:00:13
781500 -- (-640.258) [-642.967] (-644.681) (-642.991) * [-641.106] (-641.865) (-644.358) (-643.084) -- 0:00:13
782000 -- (-640.684) [-640.735] (-640.328) (-645.772) * (-641.854) (-642.638) [-642.067] (-642.962) -- 0:00:13
782500 -- [-640.884] (-645.601) (-640.245) (-640.955) * (-643.424) [-642.608] (-640.678) (-642.843) -- 0:00:13
783000 -- (-641.169) (-645.395) (-640.419) [-648.687] * (-644.452) (-640.774) (-642.651) [-645.591] -- 0:00:13
783500 -- (-643.384) (-646.179) (-641.764) [-643.628] * (-640.967) [-640.774] (-641.553) (-642.353) -- 0:00:12
784000 -- [-642.248] (-642.231) (-641.077) (-646.164) * [-642.248] (-642.875) (-642.427) (-642.291) -- 0:00:12
784500 -- (-642.456) [-639.888] (-640.880) (-646.110) * (-643.396) (-641.991) [-642.633] (-641.370) -- 0:00:12
785000 -- (-642.940) [-640.023] (-646.750) (-642.192) * (-643.213) (-641.792) [-642.439] (-642.156) -- 0:00:12
Average standard deviation of split frequencies: 0.009559
785500 -- [-644.448] (-642.425) (-642.322) (-642.590) * (-642.685) (-644.899) [-643.443] (-641.512) -- 0:00:12
786000 -- (-644.265) (-643.275) [-640.584] (-641.515) * [-642.093] (-641.641) (-645.085) (-641.388) -- 0:00:12
786500 -- (-639.891) (-641.803) (-640.441) [-644.068] * [-640.487] (-644.284) (-642.050) (-642.063) -- 0:00:12
787000 -- (-643.661) [-642.072] (-640.538) (-639.971) * (-642.183) (-643.042) (-641.704) [-640.753] -- 0:00:12
787500 -- (-644.145) [-641.687] (-643.551) (-642.784) * (-643.077) (-642.304) (-641.067) [-644.837] -- 0:00:12
788000 -- (-643.724) (-644.285) [-641.866] (-642.438) * [-643.939] (-641.799) (-642.206) (-641.929) -- 0:00:12
788500 -- [-641.909] (-643.628) (-643.577) (-648.534) * (-643.355) (-644.729) (-641.764) [-645.449] -- 0:00:12
789000 -- [-639.806] (-642.901) (-641.869) (-645.455) * (-643.076) (-642.193) (-644.884) [-645.236] -- 0:00:12
789500 -- [-640.115] (-643.083) (-641.093) (-642.882) * (-643.445) (-643.029) [-646.559] (-642.047) -- 0:00:12
790000 -- [-641.720] (-640.809) (-641.100) (-641.648) * (-642.927) (-642.790) (-644.503) [-641.327] -- 0:00:12
Average standard deviation of split frequencies: 0.009301
790500 -- (-639.742) (-642.183) [-640.973] (-643.383) * [-640.251] (-643.036) (-644.761) (-642.188) -- 0:00:12
791000 -- (-642.789) [-640.668] (-642.470) (-644.438) * (-642.984) (-642.206) [-643.139] (-642.827) -- 0:00:12
791500 -- (-639.901) (-643.953) [-642.325] (-641.275) * [-641.949] (-643.387) (-642.212) (-641.738) -- 0:00:12
792000 -- (-641.272) (-643.595) [-643.035] (-640.286) * (-641.964) (-641.188) [-645.186] (-640.111) -- 0:00:12
792500 -- (-640.766) [-645.045] (-646.110) (-643.283) * (-642.255) [-641.490] (-644.564) (-642.830) -- 0:00:12
793000 -- [-641.890] (-645.181) (-643.270) (-642.999) * (-643.931) [-641.105] (-640.740) (-643.749) -- 0:00:12
793500 -- [-640.833] (-647.473) (-640.980) (-642.608) * (-643.680) (-646.113) [-641.187] (-645.213) -- 0:00:12
794000 -- (-641.000) (-645.747) [-644.462] (-642.315) * (-643.390) (-643.444) [-640.984] (-642.272) -- 0:00:12
794500 -- [-643.951] (-643.039) (-641.514) (-641.952) * (-640.833) (-644.963) (-645.845) [-642.827] -- 0:00:12
795000 -- (-644.722) [-642.217] (-640.621) (-641.818) * [-643.050] (-642.657) (-647.845) (-647.437) -- 0:00:12
Average standard deviation of split frequencies: 0.009673
795500 -- (-643.971) (-641.787) [-643.529] (-641.623) * [-641.229] (-642.751) (-642.365) (-647.228) -- 0:00:12
796000 -- [-640.498] (-645.329) (-643.683) (-644.900) * [-641.359] (-641.964) (-642.547) (-642.717) -- 0:00:12
796500 -- [-644.127] (-640.411) (-644.833) (-640.834) * (-642.853) (-640.781) [-642.428] (-640.855) -- 0:00:12
797000 -- (-640.254) [-640.368] (-644.792) (-640.844) * [-641.186] (-641.991) (-643.484) (-643.834) -- 0:00:12
797500 -- [-640.844] (-643.140) (-646.476) (-645.190) * (-640.130) (-644.080) (-641.536) [-642.294] -- 0:00:12
798000 -- [-642.738] (-644.597) (-644.795) (-642.017) * (-643.723) (-640.511) (-641.510) [-641.448] -- 0:00:12
798500 -- (-645.798) (-646.232) (-645.848) [-639.913] * (-640.525) [-641.705] (-643.364) (-641.021) -- 0:00:12
799000 -- [-647.955] (-640.774) (-645.442) (-642.661) * (-643.695) (-641.360) (-641.086) [-642.412] -- 0:00:12
799500 -- (-644.190) [-640.718] (-645.146) (-642.999) * (-640.015) (-641.390) (-641.685) [-642.544] -- 0:00:12
800000 -- [-643.033] (-643.009) (-640.486) (-641.170) * [-639.968] (-641.347) (-642.563) (-644.384) -- 0:00:12
Average standard deviation of split frequencies: 0.009185
800500 -- (-641.422) [-642.592] (-645.420) (-647.943) * [-640.501] (-641.854) (-640.812) (-640.295) -- 0:00:11
801000 -- (-643.633) [-641.902] (-642.661) (-640.047) * (-641.342) (-642.887) (-642.059) [-640.859] -- 0:00:11
801500 -- (-648.365) [-642.157] (-641.191) (-640.368) * (-641.515) (-642.586) [-640.933] (-641.062) -- 0:00:11
802000 -- (-642.661) (-644.734) (-642.815) [-642.884] * (-640.932) (-640.985) [-642.102] (-640.148) -- 0:00:11
802500 -- (-642.615) [-639.920] (-642.144) (-643.059) * (-640.503) [-641.571] (-641.627) (-641.273) -- 0:00:11
803000 -- (-641.960) (-639.958) (-644.406) [-642.064] * [-640.877] (-642.520) (-641.599) (-642.553) -- 0:00:11
803500 -- (-641.173) [-642.242] (-643.943) (-641.887) * (-644.030) (-643.279) [-642.367] (-642.870) -- 0:00:11
804000 -- [-641.628] (-640.610) (-642.321) (-641.015) * (-642.318) (-642.061) [-641.855] (-649.374) -- 0:00:11
804500 -- (-643.589) (-642.386) (-641.463) [-644.229] * (-641.956) [-640.892] (-640.716) (-644.743) -- 0:00:11
805000 -- (-641.600) (-643.009) (-642.914) [-641.246] * (-646.796) (-643.766) (-641.332) [-643.602] -- 0:00:11
Average standard deviation of split frequencies: 0.009046
805500 -- (-639.976) (-643.343) (-641.592) [-640.605] * (-643.857) [-642.174] (-641.659) (-643.228) -- 0:00:11
806000 -- (-642.694) [-640.450] (-642.455) (-640.690) * (-642.220) (-640.643) (-642.862) [-642.199] -- 0:00:11
806500 -- (-642.421) (-643.375) [-640.519] (-644.275) * [-641.479] (-640.414) (-641.177) (-642.206) -- 0:00:11
807000 -- (-642.365) [-641.361] (-640.625) (-641.807) * [-640.218] (-643.301) (-641.006) (-642.654) -- 0:00:11
807500 -- (-645.617) (-644.351) (-640.781) [-643.790] * (-644.743) (-642.674) [-642.759] (-643.987) -- 0:00:11
808000 -- (-648.458) (-644.105) [-640.303] (-641.743) * (-641.630) [-644.405] (-640.974) (-642.083) -- 0:00:11
808500 -- (-641.080) (-645.697) (-641.023) [-642.712] * (-644.190) (-644.572) [-641.193] (-643.656) -- 0:00:11
809000 -- (-639.885) (-644.065) [-642.855] (-640.897) * (-642.600) (-643.003) [-643.289] (-640.376) -- 0:00:11
809500 -- (-643.627) [-645.019] (-645.259) (-643.657) * (-644.012) (-645.100) (-646.126) [-642.118] -- 0:00:11
810000 -- [-641.144] (-642.996) (-640.762) (-641.320) * [-640.417] (-642.117) (-641.473) (-641.007) -- 0:00:11
Average standard deviation of split frequencies: 0.009149
810500 -- (-642.898) (-641.764) [-641.222] (-645.334) * (-641.476) (-642.750) [-641.141] (-644.918) -- 0:00:11
811000 -- [-641.091] (-645.910) (-642.238) (-642.094) * (-642.381) (-642.599) (-644.587) [-641.542] -- 0:00:11
811500 -- [-640.793] (-641.945) (-642.212) (-642.929) * [-644.581] (-642.204) (-643.491) (-640.744) -- 0:00:11
812000 -- [-640.782] (-640.572) (-644.624) (-641.148) * (-639.972) [-640.375] (-642.260) (-641.655) -- 0:00:11
812500 -- (-644.362) [-641.742] (-642.967) (-643.258) * (-646.230) (-641.433) [-641.057] (-640.070) -- 0:00:11
813000 -- (-643.921) (-642.624) [-643.758] (-649.291) * (-640.350) [-643.303] (-642.142) (-640.193) -- 0:00:11
813500 -- (-648.186) (-643.651) [-641.175] (-647.569) * (-642.761) (-644.762) (-641.807) [-641.937] -- 0:00:11
814000 -- [-642.023] (-650.924) (-647.048) (-641.572) * (-642.689) [-642.342] (-644.703) (-644.293) -- 0:00:11
814500 -- (-643.633) (-646.638) [-644.045] (-641.492) * [-641.811] (-640.184) (-643.277) (-642.113) -- 0:00:11
815000 -- (-643.888) (-642.628) [-640.569] (-640.570) * [-640.576] (-644.279) (-642.174) (-640.402) -- 0:00:11
Average standard deviation of split frequencies: 0.009359
815500 -- (-643.558) (-642.263) [-640.861] (-643.864) * (-643.631) [-643.372] (-644.335) (-641.756) -- 0:00:11
816000 -- (-641.632) (-643.399) [-639.954] (-646.127) * [-641.864] (-641.453) (-640.940) (-640.902) -- 0:00:11
816500 -- (-643.700) (-642.988) (-640.067) [-643.442] * (-643.937) [-642.550] (-642.305) (-643.321) -- 0:00:11
817000 -- [-645.914] (-641.416) (-641.727) (-640.220) * (-641.565) (-641.160) (-642.122) [-640.959] -- 0:00:10
817500 -- (-645.229) [-645.569] (-640.440) (-640.870) * [-640.195] (-641.967) (-640.243) (-641.814) -- 0:00:10
818000 -- (-646.118) (-643.819) (-642.551) [-642.102] * (-642.681) [-641.087] (-641.896) (-642.830) -- 0:00:10
818500 -- (-642.726) (-644.664) (-641.657) [-640.618] * (-646.172) (-640.211) [-641.398] (-644.336) -- 0:00:10
819000 -- (-644.789) [-642.302] (-641.874) (-640.585) * (-644.840) [-640.779] (-641.758) (-641.948) -- 0:00:10
819500 -- (-641.510) (-644.576) (-640.253) [-644.247] * (-642.294) (-642.312) (-642.552) [-647.491] -- 0:00:10
820000 -- [-640.574] (-641.204) (-641.485) (-643.789) * (-643.919) [-640.396] (-644.450) (-641.582) -- 0:00:10
Average standard deviation of split frequencies: 0.009037
820500 -- (-640.349) [-640.749] (-642.342) (-642.929) * (-641.032) [-642.752] (-640.657) (-640.396) -- 0:00:10
821000 -- (-639.948) [-640.082] (-642.214) (-640.328) * (-641.377) [-641.040] (-640.657) (-641.315) -- 0:00:10
821500 -- (-640.099) (-641.749) [-643.642] (-641.634) * (-642.374) (-642.101) [-641.804] (-643.165) -- 0:00:10
822000 -- (-640.510) (-646.812) (-642.195) [-644.329] * [-644.839] (-641.572) (-642.240) (-641.632) -- 0:00:10
822500 -- (-643.545) (-643.335) (-640.867) [-645.094] * (-640.954) [-641.942] (-641.606) (-643.160) -- 0:00:10
823000 -- [-640.929] (-640.782) (-644.262) (-646.128) * (-640.205) (-645.664) (-644.351) [-640.497] -- 0:00:10
823500 -- [-641.184] (-641.862) (-645.368) (-642.186) * (-640.323) [-643.829] (-640.499) (-641.147) -- 0:00:10
824000 -- (-641.400) (-641.872) (-646.564) [-642.793] * (-642.239) (-641.955) (-646.974) [-640.822] -- 0:00:10
824500 -- (-642.132) (-643.569) (-641.579) [-641.647] * (-643.757) (-643.565) [-651.800] (-640.835) -- 0:00:10
825000 -- (-641.332) (-643.815) [-642.506] (-642.133) * (-640.801) (-644.093) (-641.647) [-642.518] -- 0:00:10
Average standard deviation of split frequencies: 0.009360
825500 -- (-643.974) (-647.051) [-641.704] (-643.939) * (-643.363) [-642.641] (-642.028) (-644.620) -- 0:00:10
826000 -- (-644.969) [-643.113] (-640.641) (-640.485) * (-643.879) (-643.610) [-641.279] (-647.874) -- 0:00:10
826500 -- (-642.695) [-640.868] (-640.963) (-643.988) * [-642.987] (-642.915) (-641.586) (-642.561) -- 0:00:10
827000 -- (-643.361) (-644.761) (-642.370) [-643.908] * (-641.324) (-642.756) [-640.347] (-642.771) -- 0:00:10
827500 -- [-642.134] (-644.496) (-642.829) (-644.478) * (-644.862) [-642.480] (-641.188) (-641.571) -- 0:00:10
828000 -- (-642.773) (-642.583) [-640.364] (-644.016) * (-646.407) [-640.782] (-646.717) (-641.377) -- 0:00:10
828500 -- [-640.933] (-641.938) (-641.292) (-641.023) * [-641.377] (-641.065) (-641.316) (-642.788) -- 0:00:10
829000 -- [-641.256] (-640.889) (-642.257) (-641.810) * (-640.749) (-640.671) [-640.391] (-640.623) -- 0:00:10
829500 -- (-642.426) (-640.732) (-642.595) [-642.214] * (-644.344) (-644.248) [-640.204] (-641.704) -- 0:00:10
830000 -- (-642.672) (-641.982) [-641.317] (-646.304) * (-644.322) (-646.964) [-640.749] (-644.389) -- 0:00:10
Average standard deviation of split frequencies: 0.009685
830500 -- (-642.642) (-641.108) [-641.393] (-642.332) * (-645.639) (-642.087) (-640.875) [-641.893] -- 0:00:10
831000 -- (-648.646) [-640.618] (-642.460) (-640.918) * (-641.068) (-640.557) (-651.176) [-642.852] -- 0:00:10
831500 -- (-642.540) (-640.113) [-641.111] (-641.598) * (-643.987) (-641.696) (-643.453) [-645.855] -- 0:00:10
832000 -- (-642.210) (-640.011) [-640.234] (-641.216) * (-646.321) (-642.670) [-643.298] (-640.109) -- 0:00:10
832500 -- (-641.208) (-644.437) (-640.107) [-640.804] * (-640.709) (-644.782) (-640.540) [-641.170] -- 0:00:10
833000 -- (-642.551) (-644.357) [-641.706] (-642.493) * (-640.877) (-644.711) [-641.083] (-641.196) -- 0:00:10
833500 -- (-644.410) (-640.548) (-640.384) [-642.912] * (-644.065) (-643.077) (-643.340) [-642.130] -- 0:00:09
834000 -- (-644.569) (-643.674) [-640.806] (-644.755) * (-643.846) (-640.440) (-641.972) [-641.413] -- 0:00:09
834500 -- (-640.030) (-642.958) [-640.787] (-644.140) * (-643.727) (-640.680) [-643.341] (-642.203) -- 0:00:09
835000 -- (-640.414) (-641.051) (-641.976) [-642.844] * (-642.079) [-644.833] (-646.053) (-640.588) -- 0:00:09
Average standard deviation of split frequencies: 0.009586
835500 -- (-641.821) (-640.980) [-641.440] (-643.133) * (-640.761) (-644.510) (-642.508) [-640.045] -- 0:00:09
836000 -- (-640.941) (-640.846) (-640.395) [-642.519] * (-640.668) (-641.277) (-640.641) [-640.658] -- 0:00:09
836500 -- (-640.773) [-641.796] (-641.377) (-640.344) * (-641.538) (-647.648) [-640.078] (-641.532) -- 0:00:09
837000 -- (-642.144) (-641.241) (-640.915) [-640.652] * (-643.350) (-643.546) [-640.393] (-642.247) -- 0:00:09
837500 -- (-642.764) (-641.777) (-644.809) [-642.459] * (-643.771) [-645.228] (-640.397) (-647.605) -- 0:00:09
838000 -- (-640.597) (-642.647) (-648.359) [-641.745] * (-641.992) [-641.467] (-643.211) (-642.366) -- 0:00:09
838500 -- [-642.066] (-647.208) (-641.717) (-641.685) * [-640.151] (-644.529) (-640.218) (-642.752) -- 0:00:09
839000 -- (-640.233) (-644.440) (-646.337) [-640.200] * (-642.732) (-645.149) [-640.319] (-639.947) -- 0:00:09
839500 -- (-642.327) (-644.996) (-643.683) [-641.600] * (-641.981) (-647.065) [-645.299] (-642.757) -- 0:00:09
840000 -- [-641.247] (-643.140) (-642.527) (-646.174) * (-642.348) (-641.283) [-644.141] (-642.472) -- 0:00:09
Average standard deviation of split frequencies: 0.009495
840500 -- (-642.008) (-649.984) (-640.422) [-640.985] * (-644.783) [-640.735] (-644.598) (-641.912) -- 0:00:09
841000 -- (-641.507) (-644.546) (-640.040) [-642.805] * [-641.838] (-644.820) (-647.837) (-641.023) -- 0:00:09
841500 -- (-644.004) (-643.344) [-645.487] (-642.461) * (-643.730) (-641.174) [-640.901] (-639.876) -- 0:00:09
842000 -- (-642.167) (-641.707) [-646.876] (-641.622) * (-640.861) (-641.093) [-640.623] (-640.602) -- 0:00:09
842500 -- (-640.866) (-641.666) [-642.127] (-642.956) * [-644.823] (-645.530) (-641.030) (-641.932) -- 0:00:09
843000 -- (-645.981) (-640.829) [-644.439] (-640.763) * (-640.915) (-641.247) (-640.844) [-642.825] -- 0:00:09
843500 -- [-642.670] (-641.206) (-640.903) (-642.707) * (-645.369) (-642.280) [-641.964] (-639.911) -- 0:00:09
844000 -- (-642.489) (-642.324) [-642.712] (-642.260) * (-645.994) [-643.363] (-644.770) (-640.580) -- 0:00:09
844500 -- (-640.659) (-641.455) (-644.671) [-640.985] * [-645.721] (-642.823) (-644.853) (-640.347) -- 0:00:09
845000 -- [-642.536] (-640.471) (-647.560) (-642.459) * (-640.288) (-640.351) (-642.705) [-642.270] -- 0:00:09
Average standard deviation of split frequencies: 0.009361
845500 -- (-642.519) [-643.785] (-649.093) (-643.928) * (-640.879) [-641.060] (-641.699) (-641.222) -- 0:00:09
846000 -- (-640.536) [-647.878] (-642.320) (-642.137) * [-644.389] (-642.525) (-642.735) (-646.360) -- 0:00:09
846500 -- (-646.653) (-640.775) (-642.143) [-641.665] * (-643.046) (-642.736) (-641.352) [-642.101] -- 0:00:09
847000 -- (-642.987) (-640.990) (-641.461) [-641.072] * (-642.847) [-643.142] (-643.624) (-644.577) -- 0:00:09
847500 -- [-645.346] (-642.831) (-641.258) (-641.641) * (-644.642) (-640.046) (-645.304) [-643.428] -- 0:00:09
848000 -- (-642.170) (-641.312) (-644.308) [-642.685] * (-642.347) [-641.730] (-643.229) (-642.188) -- 0:00:09
848500 -- (-645.384) (-640.030) [-641.763] (-644.265) * [-641.486] (-642.722) (-646.138) (-643.118) -- 0:00:09
849000 -- [-643.639] (-640.182) (-641.228) (-641.676) * (-641.192) [-640.558] (-643.629) (-644.260) -- 0:00:09
849500 -- (-641.002) (-641.528) (-640.754) [-642.655] * (-640.672) [-641.810] (-641.428) (-642.809) -- 0:00:09
850000 -- (-643.248) (-641.446) (-643.253) [-642.250] * [-643.046] (-642.103) (-640.486) (-642.028) -- 0:00:09
Average standard deviation of split frequencies: 0.009310
850500 -- (-643.890) [-639.755] (-640.962) (-642.306) * (-643.272) (-645.863) [-642.173] (-645.578) -- 0:00:08
851000 -- (-643.387) (-640.547) [-639.928] (-641.717) * (-643.658) (-643.852) [-643.267] (-640.813) -- 0:00:08
851500 -- (-642.787) (-641.065) (-640.431) [-642.203] * [-642.716] (-642.593) (-642.585) (-640.593) -- 0:00:08
852000 -- (-642.315) (-641.663) (-641.934) [-642.767] * (-643.387) (-644.411) (-641.546) [-640.925] -- 0:00:08
852500 -- [-642.517] (-643.666) (-643.605) (-640.490) * (-643.096) [-641.677] (-640.296) (-643.265) -- 0:00:08
853000 -- (-644.695) [-641.882] (-642.847) (-644.203) * (-646.936) (-641.474) [-640.450] (-643.323) -- 0:00:08
853500 -- (-647.206) [-642.983] (-643.715) (-642.493) * (-644.143) [-640.442] (-640.955) (-640.110) -- 0:00:08
854000 -- (-642.134) [-642.803] (-643.752) (-643.537) * (-640.785) (-640.913) [-642.161] (-642.032) -- 0:00:08
854500 -- [-642.132] (-640.843) (-644.528) (-642.367) * [-641.165] (-642.710) (-641.519) (-640.640) -- 0:00:08
855000 -- [-640.621] (-642.030) (-640.408) (-643.107) * [-640.793] (-645.483) (-643.363) (-640.448) -- 0:00:08
Average standard deviation of split frequencies: 0.008995
855500 -- [-645.481] (-644.378) (-640.050) (-643.180) * [-641.414] (-641.545) (-642.086) (-642.144) -- 0:00:08
856000 -- [-640.706] (-642.792) (-640.927) (-643.070) * (-641.350) (-639.987) (-646.450) [-641.603] -- 0:00:08
856500 -- (-641.705) (-641.849) [-640.974] (-645.718) * (-644.424) [-642.857] (-643.572) (-647.283) -- 0:00:08
857000 -- (-641.279) [-641.517] (-642.506) (-641.894) * (-641.567) (-642.889) [-643.278] (-645.289) -- 0:00:08
857500 -- [-640.643] (-643.947) (-642.420) (-641.258) * (-642.498) (-645.433) [-644.875] (-641.390) -- 0:00:08
858000 -- [-641.243] (-642.132) (-642.513) (-642.394) * [-641.660] (-640.653) (-643.623) (-642.492) -- 0:00:08
858500 -- (-643.680) (-642.023) [-644.235] (-641.763) * (-643.296) [-641.381] (-642.210) (-646.941) -- 0:00:08
859000 -- (-641.084) (-640.414) (-643.254) [-643.186] * (-646.137) (-645.858) (-643.791) [-642.191] -- 0:00:08
859500 -- (-640.800) (-640.009) [-646.446] (-643.760) * (-644.653) (-643.841) [-642.385] (-643.263) -- 0:00:08
860000 -- [-642.095] (-643.700) (-644.634) (-641.479) * (-647.729) (-642.556) (-640.414) [-642.261] -- 0:00:08
Average standard deviation of split frequencies: 0.009585
860500 -- [-642.718] (-643.645) (-640.983) (-643.009) * [-647.786] (-641.600) (-641.078) (-641.601) -- 0:00:08
861000 -- (-644.340) (-642.187) (-642.547) [-641.959] * [-640.249] (-643.856) (-641.623) (-643.288) -- 0:00:08
861500 -- [-641.402] (-646.776) (-640.703) (-641.526) * (-641.345) [-639.845] (-644.935) (-642.050) -- 0:00:08
862000 -- (-644.073) (-647.918) [-640.608] (-643.328) * [-641.572] (-643.662) (-644.722) (-640.870) -- 0:00:08
862500 -- (-640.278) [-641.539] (-642.571) (-642.715) * (-645.963) [-641.320] (-641.324) (-643.082) -- 0:00:08
863000 -- [-640.306] (-642.866) (-641.168) (-644.128) * (-648.134) [-641.216] (-643.784) (-643.186) -- 0:00:08
863500 -- [-641.838] (-640.885) (-642.713) (-643.879) * (-641.768) (-640.695) (-646.196) [-641.340] -- 0:00:08
864000 -- (-643.600) [-642.029] (-641.839) (-642.737) * (-641.769) [-640.292] (-641.971) (-641.420) -- 0:00:08
864500 -- (-643.166) (-643.002) (-644.577) [-640.692] * (-642.260) [-640.452] (-642.121) (-641.178) -- 0:00:08
865000 -- (-641.547) (-646.648) [-641.401] (-647.612) * (-643.032) (-642.369) (-641.087) [-641.247] -- 0:00:08
Average standard deviation of split frequencies: 0.009560
865500 -- [-640.675] (-641.516) (-640.596) (-646.726) * (-641.978) (-643.513) (-643.133) [-642.435] -- 0:00:08
866000 -- (-644.712) [-640.338] (-642.437) (-643.738) * (-640.762) (-643.235) [-644.851] (-642.092) -- 0:00:08
866500 -- (-640.511) (-643.467) (-640.790) [-643.349] * (-640.577) (-642.054) (-640.583) [-643.907] -- 0:00:08
867000 -- (-641.483) (-643.337) [-640.135] (-645.830) * [-640.275] (-643.245) (-643.992) (-643.660) -- 0:00:07
867500 -- (-642.590) (-641.156) [-641.306] (-640.966) * [-640.183] (-642.781) (-643.765) (-642.679) -- 0:00:07
868000 -- [-641.871] (-643.008) (-642.359) (-641.835) * (-640.717) (-644.335) [-640.642] (-640.816) -- 0:00:07
868500 -- (-640.980) (-643.613) (-646.234) [-644.190] * [-641.331] (-641.450) (-640.780) (-641.493) -- 0:00:07
869000 -- (-643.102) (-642.249) [-641.385] (-643.295) * (-643.215) (-645.685) [-642.708] (-640.453) -- 0:00:07
869500 -- (-642.861) (-641.295) [-641.879] (-645.574) * [-640.147] (-645.369) (-640.157) (-642.051) -- 0:00:07
870000 -- (-641.402) (-641.074) (-642.116) [-640.346] * (-640.728) [-641.718] (-643.526) (-647.135) -- 0:00:07
Average standard deviation of split frequencies: 0.009475
870500 -- (-642.737) [-642.469] (-641.798) (-641.784) * [-646.916] (-640.502) (-641.259) (-642.455) -- 0:00:07
871000 -- (-641.161) [-645.624] (-640.557) (-641.137) * (-642.608) [-640.066] (-640.734) (-646.130) -- 0:00:07
871500 -- (-641.853) (-641.383) (-640.449) [-640.237] * [-640.650] (-642.161) (-642.764) (-641.022) -- 0:00:07
872000 -- (-640.360) (-641.865) [-641.331] (-640.412) * (-641.995) [-643.558] (-641.856) (-641.135) -- 0:00:07
872500 -- (-642.037) [-641.503] (-647.637) (-641.500) * (-642.325) (-640.733) (-641.572) [-642.223] -- 0:00:07
873000 -- (-642.466) (-641.708) (-649.484) [-641.613] * [-640.788] (-640.251) (-643.840) (-640.824) -- 0:00:07
873500 -- [-643.437] (-642.319) (-642.414) (-642.895) * (-641.887) [-641.000] (-642.530) (-647.101) -- 0:00:07
874000 -- (-642.078) (-642.457) [-642.166] (-643.199) * (-641.367) (-643.419) (-641.395) [-640.959] -- 0:00:07
874500 -- [-642.760] (-641.227) (-641.874) (-644.500) * [-642.715] (-643.879) (-642.779) (-641.123) -- 0:00:07
875000 -- (-641.995) [-641.370] (-643.566) (-643.104) * (-642.474) (-641.473) [-643.080] (-642.299) -- 0:00:07
Average standard deviation of split frequencies: 0.009256
875500 -- (-642.675) (-640.989) [-641.068] (-643.503) * (-651.038) (-647.412) [-642.923] (-641.817) -- 0:00:07
876000 -- (-642.411) (-645.291) (-641.667) [-641.708] * (-641.657) (-642.747) [-640.911] (-646.983) -- 0:00:07
876500 -- (-644.348) [-640.124] (-643.928) (-641.067) * (-641.313) (-640.364) [-643.359] (-644.408) -- 0:00:07
877000 -- [-641.541] (-640.831) (-642.756) (-641.965) * (-640.854) (-642.586) [-642.288] (-639.955) -- 0:00:07
877500 -- (-646.081) (-640.612) (-644.095) [-641.633] * [-641.794] (-641.255) (-643.832) (-640.798) -- 0:00:07
878000 -- [-640.367] (-643.090) (-642.248) (-641.823) * (-643.989) (-642.273) [-643.006] (-639.963) -- 0:00:07
878500 -- (-644.294) (-642.874) [-643.050] (-643.719) * (-645.637) [-643.787] (-646.121) (-641.529) -- 0:00:07
879000 -- (-642.615) (-649.621) (-642.040) [-645.930] * (-642.540) (-642.535) (-642.815) [-643.703] -- 0:00:07
879500 -- (-642.261) [-641.362] (-642.435) (-646.241) * [-642.929] (-644.767) (-641.874) (-640.893) -- 0:00:07
880000 -- (-643.801) [-643.948] (-642.359) (-642.569) * (-642.275) (-641.215) (-643.588) [-640.664] -- 0:00:07
Average standard deviation of split frequencies: 0.009769
880500 -- (-644.656) (-643.323) (-645.096) [-640.597] * (-640.111) [-644.494] (-640.376) (-644.614) -- 0:00:07
881000 -- (-646.473) (-644.038) [-641.172] (-641.684) * (-640.440) (-642.469) (-640.079) [-641.762] -- 0:00:07
881500 -- (-642.026) [-646.122] (-640.786) (-642.334) * (-642.443) (-641.180) [-640.185] (-642.151) -- 0:00:07
882000 -- [-641.174] (-642.329) (-642.815) (-642.292) * (-640.264) (-640.983) [-640.386] (-642.116) -- 0:00:07
882500 -- (-640.879) [-641.788] (-643.520) (-641.910) * [-643.600] (-641.767) (-641.530) (-646.266) -- 0:00:07
883000 -- (-641.275) [-643.262] (-642.058) (-641.913) * (-640.384) (-641.650) (-645.495) [-642.174] -- 0:00:07
883500 -- (-641.098) (-641.908) (-642.143) [-645.640] * [-640.236] (-641.457) (-648.296) (-641.049) -- 0:00:06
884000 -- (-641.456) [-644.340] (-640.471) (-644.062) * [-641.605] (-640.165) (-641.576) (-641.841) -- 0:00:06
884500 -- (-641.922) (-641.117) (-641.329) [-640.968] * [-640.947] (-641.546) (-642.679) (-648.609) -- 0:00:06
885000 -- (-642.264) [-640.459] (-646.124) (-642.621) * [-650.189] (-643.802) (-641.084) (-643.851) -- 0:00:06
Average standard deviation of split frequencies: 0.009810
885500 -- (-642.001) (-641.147) (-642.743) [-640.975] * (-644.155) (-641.735) (-642.839) [-644.663] -- 0:00:06
886000 -- (-640.895) (-643.649) (-642.768) [-646.428] * (-640.328) [-643.721] (-643.721) (-642.275) -- 0:00:06
886500 -- (-644.994) [-641.366] (-642.472) (-646.087) * (-640.737) (-640.041) (-641.466) [-642.600] -- 0:00:06
887000 -- (-643.592) (-640.388) (-640.910) [-642.548] * (-643.292) [-641.940] (-644.114) (-641.476) -- 0:00:06
887500 -- (-643.291) [-642.174] (-641.112) (-641.223) * (-645.982) [-643.763] (-643.053) (-640.637) -- 0:00:06
888000 -- (-640.345) (-644.808) (-643.775) [-642.683] * (-643.770) [-644.825] (-643.346) (-641.153) -- 0:00:06
888500 -- (-642.121) [-640.969] (-644.915) (-646.600) * (-642.475) (-643.377) [-641.553] (-643.236) -- 0:00:06
889000 -- [-643.235] (-642.863) (-645.137) (-640.571) * (-647.780) (-640.617) [-640.496] (-641.532) -- 0:00:06
889500 -- (-640.902) (-644.029) (-640.617) [-640.227] * (-643.699) [-640.369] (-643.052) (-644.740) -- 0:00:06
890000 -- (-640.488) (-640.730) (-641.752) [-641.552] * (-645.112) (-643.404) [-640.544] (-641.373) -- 0:00:06
Average standard deviation of split frequencies: 0.009659
890500 -- (-642.701) (-645.842) [-642.664] (-641.929) * (-644.349) (-642.821) (-641.737) [-646.169] -- 0:00:06
891000 -- (-643.775) (-643.553) (-642.597) [-644.797] * (-644.647) [-641.839] (-642.191) (-643.017) -- 0:00:06
891500 -- (-644.063) [-643.473] (-641.598) (-642.986) * (-645.107) (-643.374) (-643.530) [-641.978] -- 0:00:06
892000 -- (-642.232) (-643.184) [-641.081] (-643.602) * (-642.895) [-645.536] (-646.114) (-640.645) -- 0:00:06
892500 -- [-641.987] (-643.965) (-642.924) (-644.130) * (-644.621) (-643.024) (-643.419) [-643.966] -- 0:00:06
893000 -- [-640.064] (-642.760) (-641.582) (-646.249) * (-641.455) (-644.581) [-641.812] (-640.916) -- 0:00:06
893500 -- (-643.223) [-640.295] (-641.565) (-644.418) * (-641.602) (-646.445) [-642.652] (-642.497) -- 0:00:06
894000 -- (-640.662) (-648.123) [-641.096] (-646.827) * (-644.866) (-643.598) (-644.963) [-640.891] -- 0:00:06
894500 -- [-640.547] (-647.361) (-640.677) (-640.674) * (-645.807) (-648.597) [-646.217] (-641.847) -- 0:00:06
895000 -- (-640.661) (-641.892) [-641.258] (-640.391) * (-642.536) (-643.039) (-641.810) [-639.993] -- 0:00:06
Average standard deviation of split frequencies: 0.009700
895500 -- [-641.594] (-643.646) (-642.890) (-640.090) * (-644.569) (-641.153) (-641.723) [-644.818] -- 0:00:06
896000 -- (-642.693) (-641.609) (-641.368) [-640.652] * (-642.253) (-644.189) [-642.838] (-645.747) -- 0:00:06
896500 -- (-644.294) (-641.561) [-641.896] (-641.209) * [-640.732] (-645.266) (-643.728) (-643.485) -- 0:00:06
897000 -- (-644.791) (-641.339) [-643.703] (-643.131) * (-641.931) (-643.529) (-640.921) [-641.418] -- 0:00:06
897500 -- (-641.150) (-641.088) [-641.545] (-643.917) * (-642.195) [-641.381] (-643.700) (-641.020) -- 0:00:06
898000 -- [-645.292] (-640.713) (-641.663) (-643.510) * [-641.574] (-640.355) (-644.038) (-643.909) -- 0:00:06
898500 -- (-644.061) (-641.236) [-642.988] (-643.390) * [-642.038] (-642.474) (-640.705) (-642.497) -- 0:00:06
899000 -- (-646.001) [-641.556] (-643.143) (-642.066) * (-643.628) (-640.916) (-641.190) [-640.672] -- 0:00:06
899500 -- (-642.215) (-642.390) [-640.057] (-640.634) * (-643.580) [-641.410] (-640.846) (-641.591) -- 0:00:06
900000 -- (-641.153) (-641.441) (-642.437) [-640.517] * (-642.913) (-641.331) (-640.520) [-640.450] -- 0:00:06
Average standard deviation of split frequencies: 0.009388
900500 -- (-643.347) (-645.607) [-643.193] (-640.433) * (-641.623) (-640.715) [-641.330] (-642.162) -- 0:00:05
901000 -- (-642.241) (-643.561) (-641.983) [-644.211] * (-641.761) [-644.354] (-641.745) (-641.761) -- 0:00:05
901500 -- (-641.364) (-642.264) [-641.751] (-642.425) * (-641.798) [-640.822] (-643.014) (-640.747) -- 0:00:05
902000 -- (-644.741) (-642.699) [-642.188] (-648.941) * [-644.277] (-642.770) (-642.806) (-641.813) -- 0:00:05
902500 -- (-641.246) (-643.697) (-643.930) [-646.483] * (-643.606) [-642.216] (-642.587) (-643.268) -- 0:00:05
903000 -- [-643.388] (-641.735) (-645.620) (-640.877) * (-643.254) (-646.269) (-643.339) [-640.193] -- 0:00:05
903500 -- [-641.698] (-643.778) (-644.654) (-641.140) * (-642.987) (-643.928) (-643.215) [-640.927] -- 0:00:05
904000 -- (-646.003) (-644.099) (-642.277) [-643.633] * (-640.510) (-643.940) (-642.610) [-640.150] -- 0:00:05
904500 -- (-641.709) [-641.232] (-643.224) (-645.003) * (-640.781) [-643.767] (-646.964) (-640.521) -- 0:00:05
905000 -- (-641.181) (-641.123) [-643.343] (-642.911) * [-640.162] (-641.080) (-643.679) (-640.893) -- 0:00:05
Average standard deviation of split frequencies: 0.009333
905500 -- (-643.308) (-642.363) [-642.184] (-642.059) * (-640.834) (-642.081) [-644.433] (-641.884) -- 0:00:05
906000 -- (-644.150) [-642.936] (-641.986) (-642.243) * (-640.204) (-645.118) (-644.793) [-640.632] -- 0:00:05
906500 -- (-644.533) (-643.800) [-641.898] (-641.876) * (-640.204) (-646.081) (-640.983) [-640.375] -- 0:00:05
907000 -- (-644.321) [-640.787] (-643.408) (-644.054) * (-643.240) [-640.068] (-642.064) (-639.953) -- 0:00:05
907500 -- (-647.625) [-640.772] (-642.506) (-643.698) * (-641.177) (-642.825) (-642.087) [-641.476] -- 0:00:05
908000 -- (-640.252) (-640.507) (-643.754) [-646.578] * (-646.043) (-641.879) [-642.571] (-646.256) -- 0:00:05
908500 -- [-641.509] (-639.882) (-641.529) (-643.948) * (-641.442) (-642.533) [-641.287] (-643.269) -- 0:00:05
909000 -- (-641.759) (-641.905) [-644.299] (-640.133) * [-640.429] (-643.282) (-642.149) (-641.459) -- 0:00:05
909500 -- [-645.224] (-641.214) (-640.918) (-641.409) * (-641.867) (-641.055) (-643.495) [-640.643] -- 0:00:05
910000 -- (-641.050) [-641.279] (-639.894) (-641.157) * (-641.538) [-642.092] (-641.312) (-643.331) -- 0:00:05
Average standard deviation of split frequencies: 0.009091
910500 -- (-643.741) (-641.358) (-640.094) [-642.411] * [-640.973] (-643.150) (-641.412) (-644.444) -- 0:00:05
911000 -- (-643.783) [-640.842] (-643.093) (-645.201) * (-641.140) [-645.747] (-642.265) (-640.083) -- 0:00:05
911500 -- (-642.477) (-641.796) [-643.965] (-645.263) * (-641.694) (-643.608) (-640.759) [-642.460] -- 0:00:05
912000 -- (-641.631) (-641.970) (-642.269) [-647.116] * (-640.124) (-640.929) (-642.847) [-642.714] -- 0:00:05
912500 -- (-640.904) (-641.484) [-641.228] (-641.256) * (-647.199) [-640.235] (-644.875) (-644.848) -- 0:00:05
913000 -- (-646.830) [-641.335] (-642.922) (-642.080) * [-641.262] (-643.667) (-642.440) (-642.042) -- 0:00:05
913500 -- [-641.571] (-644.377) (-643.679) (-640.940) * [-641.261] (-644.362) (-650.518) (-642.404) -- 0:00:05
914000 -- (-642.700) (-640.564) [-644.972] (-641.156) * [-643.007] (-644.696) (-652.368) (-643.345) -- 0:00:05
914500 -- (-644.194) [-642.776] (-641.769) (-640.696) * (-641.899) (-642.698) [-640.367] (-641.209) -- 0:00:05
915000 -- (-641.588) [-640.512] (-644.025) (-641.186) * [-641.043] (-642.898) (-641.269) (-642.228) -- 0:00:05
Average standard deviation of split frequencies: 0.009585
915500 -- [-640.277] (-640.378) (-642.629) (-641.238) * (-641.068) (-641.912) (-641.503) [-640.519] -- 0:00:05
916000 -- (-643.696) (-640.585) (-640.587) [-643.000] * [-642.815] (-640.808) (-641.406) (-645.252) -- 0:00:05
916500 -- (-642.013) (-647.728) (-641.786) [-642.941] * (-644.562) (-640.930) [-641.278] (-644.082) -- 0:00:05
917000 -- (-642.407) (-644.524) (-641.491) [-644.301] * (-644.905) (-641.041) (-643.631) [-643.311] -- 0:00:04
917500 -- (-639.893) (-641.125) [-640.890] (-644.162) * [-642.284] (-643.956) (-640.387) (-643.028) -- 0:00:04
918000 -- [-640.843] (-645.981) (-641.676) (-640.062) * (-643.520) (-641.688) [-641.950] (-639.927) -- 0:00:04
918500 -- [-641.910] (-641.182) (-644.737) (-643.945) * (-650.811) (-641.401) (-640.466) [-641.929] -- 0:00:04
919000 -- (-641.430) (-641.219) (-640.600) [-641.662] * [-642.232] (-642.288) (-641.182) (-641.936) -- 0:00:04
919500 -- [-640.255] (-646.096) (-641.093) (-645.194) * (-640.573) [-640.830] (-640.645) (-640.421) -- 0:00:04
920000 -- [-639.985] (-642.260) (-642.117) (-642.653) * [-641.164] (-642.962) (-643.510) (-641.729) -- 0:00:04
Average standard deviation of split frequencies: 0.009696
920500 -- [-640.996] (-641.841) (-643.824) (-641.209) * [-641.912] (-642.925) (-639.947) (-640.086) -- 0:00:04
921000 -- (-640.967) (-642.816) [-642.836] (-640.469) * (-641.218) (-641.391) [-643.981] (-639.724) -- 0:00:04
921500 -- (-640.621) (-641.393) (-642.919) [-642.169] * (-641.288) (-642.545) (-642.465) [-640.436] -- 0:00:04
922000 -- (-642.429) (-641.383) [-641.184] (-642.805) * (-642.729) (-640.731) (-639.964) [-640.435] -- 0:00:04
922500 -- [-641.140] (-644.640) (-642.960) (-641.566) * (-640.948) [-641.724] (-646.214) (-640.212) -- 0:00:04
923000 -- (-643.644) (-642.292) [-642.054] (-642.180) * [-641.932] (-641.544) (-645.726) (-641.174) -- 0:00:04
923500 -- [-641.438] (-643.626) (-643.134) (-642.469) * (-645.236) (-643.605) [-643.008] (-643.097) -- 0:00:04
924000 -- (-644.157) [-643.313] (-643.390) (-642.245) * [-643.128] (-645.170) (-643.004) (-640.837) -- 0:00:04
924500 -- [-644.320] (-642.094) (-641.073) (-640.972) * (-639.925) [-641.141] (-641.380) (-641.223) -- 0:00:04
925000 -- (-643.767) (-643.001) [-641.183] (-641.246) * (-642.518) [-641.889] (-641.016) (-645.387) -- 0:00:04
Average standard deviation of split frequencies: 0.009672
925500 -- [-644.068] (-641.480) (-640.014) (-640.679) * [-641.718] (-641.474) (-644.723) (-639.989) -- 0:00:04
926000 -- [-641.115] (-642.058) (-645.058) (-641.454) * (-641.245) (-640.778) [-641.236] (-639.947) -- 0:00:04
926500 -- (-641.252) [-649.746] (-643.588) (-644.750) * [-641.855] (-643.816) (-641.775) (-643.438) -- 0:00:04
927000 -- (-640.740) (-641.656) (-642.042) [-644.010] * (-645.128) [-643.472] (-642.816) (-641.598) -- 0:00:04
927500 -- (-641.472) [-641.038] (-644.749) (-644.017) * [-645.150] (-644.036) (-640.934) (-643.072) -- 0:00:04
928000 -- [-640.125] (-640.728) (-644.432) (-642.723) * [-642.801] (-640.665) (-643.166) (-642.028) -- 0:00:04
928500 -- (-640.412) (-642.343) (-645.772) [-642.170] * [-641.875] (-640.613) (-643.052) (-642.145) -- 0:00:04
929000 -- [-641.164] (-641.657) (-641.907) (-643.493) * [-640.480] (-640.964) (-641.281) (-642.451) -- 0:00:04
929500 -- (-645.989) (-640.423) [-640.010] (-642.726) * [-641.124] (-643.163) (-640.753) (-640.500) -- 0:00:04
930000 -- (-644.439) (-643.508) (-641.795) [-640.716] * [-641.820] (-642.077) (-641.034) (-644.106) -- 0:00:04
Average standard deviation of split frequencies: 0.009751
930500 -- [-640.967] (-642.094) (-641.581) (-641.773) * (-641.987) (-642.120) [-642.610] (-641.114) -- 0:00:04
931000 -- (-643.112) (-642.065) [-641.001] (-639.974) * [-640.532] (-639.845) (-644.445) (-642.345) -- 0:00:04
931500 -- (-640.610) (-640.856) [-642.442] (-640.879) * (-643.824) [-641.531] (-643.853) (-642.671) -- 0:00:04
932000 -- (-642.207) [-643.907] (-641.689) (-644.233) * (-642.844) (-640.080) (-645.818) [-641.559] -- 0:00:04
932500 -- (-643.105) [-642.337] (-642.228) (-643.198) * (-642.746) (-641.677) (-640.932) [-640.988] -- 0:00:04
933000 -- (-640.930) [-641.160] (-642.596) (-643.453) * (-641.854) (-643.664) [-643.427] (-642.202) -- 0:00:04
933500 -- (-640.930) [-641.135] (-642.271) (-641.132) * [-642.814] (-644.835) (-645.804) (-641.709) -- 0:00:03
934000 -- [-641.636] (-646.297) (-641.493) (-643.522) * [-640.074] (-640.506) (-642.614) (-646.625) -- 0:00:03
934500 -- (-642.150) (-642.695) [-643.903] (-640.658) * (-648.142) [-640.512] (-642.427) (-642.340) -- 0:00:03
935000 -- (-642.224) (-642.338) (-642.982) [-640.806] * (-645.775) [-641.956] (-643.072) (-646.000) -- 0:00:03
Average standard deviation of split frequencies: 0.009368
935500 -- (-640.375) (-644.135) (-640.330) [-640.764] * (-643.401) [-642.046] (-644.699) (-642.802) -- 0:00:03
936000 -- (-646.825) (-643.812) (-641.283) [-642.094] * (-642.393) (-645.246) (-641.375) [-641.304] -- 0:00:03
936500 -- (-645.114) [-643.573] (-641.975) (-641.915) * [-641.812] (-643.544) (-647.841) (-641.674) -- 0:00:03
937000 -- (-645.432) (-643.164) [-641.808] (-641.710) * (-642.153) [-641.892] (-644.250) (-640.590) -- 0:00:03
937500 -- (-640.824) [-643.232] (-643.715) (-643.205) * [-640.692] (-643.306) (-643.081) (-644.353) -- 0:00:03
938000 -- [-643.835] (-643.083) (-644.402) (-644.927) * [-642.250] (-647.481) (-641.934) (-643.629) -- 0:00:03
938500 -- (-646.512) [-640.789] (-642.220) (-643.340) * (-642.425) (-642.883) (-644.284) [-642.224] -- 0:00:03
939000 -- [-646.937] (-642.896) (-641.202) (-642.090) * [-642.356] (-645.432) (-646.314) (-641.437) -- 0:00:03
939500 -- (-647.305) [-645.467] (-641.775) (-640.603) * (-640.803) [-640.208] (-645.932) (-642.887) -- 0:00:03
940000 -- (-643.221) (-641.209) [-643.097] (-641.159) * (-642.016) [-640.410] (-642.318) (-647.307) -- 0:00:03
Average standard deviation of split frequencies: 0.008820
940500 -- (-643.201) [-643.967] (-642.171) (-640.396) * [-642.231] (-641.151) (-641.047) (-641.089) -- 0:00:03
941000 -- (-640.197) (-641.219) [-641.941] (-641.712) * (-645.856) [-640.402] (-640.921) (-640.677) -- 0:00:03
941500 -- (-641.267) (-645.127) (-641.210) [-642.462] * (-644.369) [-640.932] (-640.788) (-644.975) -- 0:00:03
942000 -- (-643.793) (-644.516) (-640.976) [-641.345] * (-641.612) [-643.980] (-639.883) (-643.423) -- 0:00:03
942500 -- (-643.352) (-640.606) [-640.698] (-640.941) * (-643.177) [-643.472] (-641.735) (-642.814) -- 0:00:03
943000 -- (-642.154) (-641.367) (-641.254) [-642.784] * (-646.973) (-640.633) (-642.734) [-644.605] -- 0:00:03
943500 -- (-642.050) [-643.541] (-640.023) (-642.598) * (-647.037) [-642.631] (-644.178) (-644.920) -- 0:00:03
944000 -- [-643.044] (-643.926) (-642.163) (-642.143) * (-641.160) [-645.396] (-645.038) (-644.597) -- 0:00:03
944500 -- (-643.030) (-649.040) (-642.163) [-641.528] * (-643.689) [-640.781] (-647.054) (-640.991) -- 0:00:03
945000 -- [-640.870] (-643.094) (-640.308) (-643.777) * (-641.132) [-640.385] (-645.281) (-641.907) -- 0:00:03
Average standard deviation of split frequencies: 0.009368
945500 -- (-641.134) (-643.316) [-642.341] (-644.568) * (-641.627) (-640.357) (-641.171) [-641.149] -- 0:00:03
946000 -- [-643.147] (-640.417) (-640.164) (-641.736) * [-644.192] (-641.119) (-641.072) (-642.690) -- 0:00:03
946500 -- (-640.263) [-641.258] (-640.268) (-642.711) * (-643.518) (-644.946) [-641.140] (-641.433) -- 0:00:03
947000 -- (-642.147) (-640.123) (-641.729) [-641.346] * (-640.563) (-643.508) [-640.404] (-642.650) -- 0:00:03
947500 -- (-641.639) (-640.349) (-641.453) [-642.573] * [-640.541] (-642.165) (-640.543) (-640.894) -- 0:00:03
948000 -- (-643.590) (-640.026) (-645.869) [-644.904] * (-642.504) (-640.681) (-640.665) [-643.277] -- 0:00:03
948500 -- (-643.594) [-641.795] (-641.638) (-642.244) * (-643.298) (-642.924) (-642.367) [-642.888] -- 0:00:03
949000 -- (-649.573) (-651.415) (-641.069) [-643.323] * (-641.272) [-642.173] (-643.742) (-640.971) -- 0:00:03
949500 -- (-643.422) (-646.675) (-647.224) [-640.255] * [-643.219] (-640.160) (-642.647) (-643.810) -- 0:00:03
950000 -- [-644.387] (-642.108) (-640.865) (-640.899) * (-642.084) [-641.535] (-643.078) (-645.334) -- 0:00:03
Average standard deviation of split frequencies: 0.009388
950500 -- (-640.352) [-640.959] (-645.817) (-644.746) * [-643.638] (-642.354) (-641.486) (-642.103) -- 0:00:02
951000 -- (-640.409) [-641.688] (-644.811) (-643.121) * (-644.818) [-645.604] (-641.324) (-641.253) -- 0:00:02
951500 -- (-641.350) [-640.748] (-641.634) (-643.218) * [-643.417] (-642.035) (-641.508) (-640.070) -- 0:00:02
952000 -- (-645.869) (-641.397) (-645.254) [-644.223] * (-643.078) [-642.266] (-644.129) (-640.255) -- 0:00:02
952500 -- [-641.296] (-641.563) (-643.060) (-643.514) * (-643.401) [-642.974] (-644.035) (-641.718) -- 0:00:02
953000 -- (-641.310) (-640.821) (-642.682) [-642.433] * (-640.643) (-639.988) (-641.026) [-647.007] -- 0:00:02
953500 -- [-642.494] (-642.830) (-641.587) (-641.534) * (-641.062) (-640.715) [-642.670] (-640.126) -- 0:00:02
954000 -- (-644.055) (-643.554) [-641.532] (-641.019) * (-643.356) [-641.408] (-642.492) (-641.330) -- 0:00:02
954500 -- (-640.845) (-641.867) [-640.874] (-644.101) * (-644.364) (-643.016) [-641.625] (-642.339) -- 0:00:02
955000 -- [-641.332] (-643.379) (-642.312) (-644.717) * (-646.375) (-640.751) [-642.046] (-648.523) -- 0:00:02
Average standard deviation of split frequencies: 0.009139
955500 -- [-642.470] (-646.055) (-643.243) (-640.469) * [-641.845] (-641.014) (-642.143) (-641.023) -- 0:00:02
956000 -- (-642.055) (-641.019) [-640.754] (-643.396) * (-644.243) [-642.416] (-641.942) (-646.189) -- 0:00:02
956500 -- (-644.036) (-640.244) [-641.357] (-640.743) * (-643.882) [-641.606] (-644.401) (-640.362) -- 0:00:02
957000 -- (-641.442) [-640.593] (-640.185) (-642.424) * [-641.521] (-643.594) (-643.036) (-641.765) -- 0:00:02
957500 -- [-640.667] (-640.386) (-643.094) (-641.057) * (-640.780) (-644.502) (-644.665) [-643.620] -- 0:00:02
958000 -- (-642.603) (-641.496) (-644.469) [-641.732] * [-643.475] (-640.592) (-642.825) (-641.690) -- 0:00:02
958500 -- (-646.443) [-643.355] (-643.952) (-642.560) * [-641.453] (-642.760) (-641.945) (-641.448) -- 0:00:02
959000 -- (-646.354) [-641.674] (-643.414) (-643.078) * [-640.128] (-644.852) (-641.360) (-644.474) -- 0:00:02
959500 -- (-643.310) (-639.972) [-639.996] (-640.983) * (-640.319) [-642.305] (-640.928) (-641.561) -- 0:00:02
960000 -- [-639.977] (-642.228) (-640.762) (-642.340) * (-642.602) (-642.759) [-641.875] (-642.781) -- 0:00:02
Average standard deviation of split frequencies: 0.009291
960500 -- (-642.305) (-641.448) [-640.603] (-642.806) * (-643.271) [-642.303] (-643.489) (-640.660) -- 0:00:02
961000 -- (-645.641) (-640.358) (-643.344) [-640.751] * (-645.332) [-642.877] (-641.376) (-640.013) -- 0:00:02
961500 -- (-641.346) (-643.992) (-642.338) [-640.701] * (-644.842) (-641.105) [-641.010] (-640.262) -- 0:00:02
962000 -- [-640.659] (-641.431) (-642.679) (-643.246) * (-641.900) (-641.207) (-640.286) [-641.967] -- 0:00:02
962500 -- (-640.617) (-642.186) (-639.705) [-643.775] * [-641.381] (-640.746) (-640.501) (-641.170) -- 0:00:02
963000 -- [-641.154] (-641.677) (-640.233) (-645.253) * (-640.611) (-640.709) (-641.271) [-640.723] -- 0:00:02
963500 -- (-640.621) (-642.197) [-640.277] (-643.437) * (-641.302) (-640.890) (-641.270) [-640.105] -- 0:00:02
964000 -- [-642.809] (-641.700) (-640.125) (-644.846) * [-640.281] (-640.850) (-642.329) (-640.596) -- 0:00:02
964500 -- (-641.041) (-639.945) [-641.635] (-647.227) * [-640.188] (-641.338) (-640.165) (-644.246) -- 0:00:02
965000 -- (-643.052) [-640.133] (-640.572) (-646.617) * (-641.352) (-643.736) (-641.734) [-642.580] -- 0:00:02
Average standard deviation of split frequencies: 0.009109
965500 -- [-640.535] (-641.262) (-639.733) (-643.490) * (-642.052) (-641.866) [-647.196] (-641.667) -- 0:00:02
966000 -- [-641.106] (-641.875) (-640.582) (-642.512) * (-640.715) (-643.467) [-646.903] (-640.833) -- 0:00:02
966500 -- (-643.048) (-642.301) [-640.596] (-640.530) * (-640.840) (-641.613) (-641.658) [-639.756] -- 0:00:02
967000 -- (-642.501) (-642.271) (-640.214) [-639.837] * (-640.027) [-641.591] (-647.049) (-639.756) -- 0:00:01
967500 -- [-641.752] (-641.610) (-640.931) (-644.550) * [-640.621] (-645.228) (-642.828) (-639.756) -- 0:00:01
968000 -- (-642.415) (-640.574) [-640.883] (-641.157) * [-644.180] (-646.542) (-643.045) (-642.347) -- 0:00:01
968500 -- (-647.750) (-640.787) [-644.141] (-643.969) * (-640.850) (-644.471) (-647.392) [-641.715] -- 0:00:01
969000 -- [-641.793] (-640.376) (-643.741) (-642.486) * (-640.544) (-646.036) (-642.508) [-641.874] -- 0:00:01
969500 -- (-641.195) [-640.742] (-641.751) (-641.631) * (-641.503) (-645.704) [-642.702] (-641.249) -- 0:00:01
970000 -- (-642.840) (-640.978) [-640.315] (-642.228) * (-640.610) (-641.569) (-640.869) [-642.812] -- 0:00:01
Average standard deviation of split frequencies: 0.009098
970500 -- [-642.920] (-646.219) (-641.088) (-642.909) * (-641.544) [-640.783] (-643.419) (-645.107) -- 0:00:01
971000 -- (-642.118) (-643.183) [-641.576] (-640.010) * (-645.222) (-651.815) [-645.831] (-645.597) -- 0:00:01
971500 -- [-642.588] (-641.260) (-640.567) (-640.681) * (-642.845) [-641.271] (-642.243) (-643.014) -- 0:00:01
972000 -- (-641.967) [-643.068] (-640.606) (-640.052) * (-641.636) (-642.186) (-642.029) [-642.897] -- 0:00:01
972500 -- (-642.912) (-645.174) [-645.391] (-642.181) * (-640.721) (-645.124) [-644.618] (-645.211) -- 0:00:01
973000 -- (-644.055) (-641.973) [-641.146] (-642.940) * [-640.478] (-642.693) (-643.314) (-641.547) -- 0:00:01
973500 -- (-641.568) (-641.989) [-641.380] (-644.412) * (-641.902) (-641.005) [-641.670] (-641.725) -- 0:00:01
974000 -- (-640.383) (-641.295) (-643.112) [-645.540] * (-642.714) (-641.597) (-646.861) [-643.619] -- 0:00:01
974500 -- [-643.211] (-640.617) (-641.694) (-643.241) * (-641.013) [-641.990] (-641.095) (-643.212) -- 0:00:01
975000 -- (-641.110) (-643.846) [-645.454] (-641.228) * (-639.995) [-644.085] (-643.538) (-642.546) -- 0:00:01
Average standard deviation of split frequencies: 0.009241
975500 -- (-641.460) [-641.981] (-641.988) (-642.314) * (-640.391) [-643.584] (-642.921) (-643.643) -- 0:00:01
976000 -- (-643.258) (-642.941) [-641.702] (-641.690) * (-640.586) [-641.413] (-641.540) (-641.812) -- 0:00:01
976500 -- (-641.260) [-642.030] (-641.303) (-641.790) * (-640.149) (-641.450) [-642.071] (-641.070) -- 0:00:01
977000 -- [-640.082] (-644.540) (-644.913) (-642.564) * [-640.487] (-641.450) (-640.692) (-645.995) -- 0:00:01
977500 -- [-642.415] (-645.302) (-640.764) (-640.229) * [-640.559] (-643.515) (-641.367) (-644.334) -- 0:00:01
978000 -- [-640.359] (-642.049) (-640.598) (-642.360) * (-640.086) (-642.747) [-641.844] (-640.366) -- 0:00:01
978500 -- (-642.497) [-641.700] (-642.464) (-639.999) * (-641.928) (-642.057) (-640.804) [-641.651] -- 0:00:01
979000 -- (-642.817) (-641.177) (-640.971) [-639.999] * (-641.310) [-641.841] (-642.471) (-640.400) -- 0:00:01
979500 -- (-640.697) (-642.381) [-641.739] (-641.746) * (-641.038) (-640.502) [-641.396] (-640.924) -- 0:00:01
980000 -- (-642.287) [-640.974] (-642.343) (-646.781) * (-643.848) [-640.532] (-645.443) (-642.874) -- 0:00:01
Average standard deviation of split frequencies: 0.008973
980500 -- (-640.378) (-641.929) (-643.669) [-646.383] * [-641.934] (-640.611) (-640.654) (-640.987) -- 0:00:01
981000 -- (-642.282) [-642.152] (-641.613) (-642.553) * (-640.364) [-640.487] (-645.100) (-642.826) -- 0:00:01
981500 -- [-641.846] (-640.495) (-643.088) (-641.276) * [-640.409] (-641.801) (-640.498) (-641.028) -- 0:00:01
982000 -- [-644.227] (-642.379) (-641.255) (-643.538) * (-643.207) (-642.945) (-643.335) [-641.042] -- 0:00:01
982500 -- [-643.803] (-642.536) (-642.215) (-643.698) * (-645.541) (-647.228) [-641.271] (-640.567) -- 0:00:01
983000 -- (-643.690) (-642.776) (-642.883) [-643.181] * (-642.781) [-642.901] (-646.419) (-646.013) -- 0:00:01
983500 -- (-641.994) [-644.201] (-640.370) (-641.826) * (-641.217) (-643.394) [-643.338] (-644.101) -- 0:00:00
984000 -- (-642.590) [-645.208] (-643.930) (-643.152) * (-640.663) (-642.786) [-643.751] (-643.107) -- 0:00:00
984500 -- (-641.998) [-640.906] (-641.425) (-641.496) * (-644.712) [-642.296] (-642.209) (-642.552) -- 0:00:00
985000 -- [-641.130] (-641.073) (-643.385) (-642.915) * (-643.458) (-640.332) (-642.031) [-641.325] -- 0:00:00
Average standard deviation of split frequencies: 0.008924
985500 -- (-641.263) (-640.341) (-641.780) [-642.061] * (-642.325) [-640.077] (-647.462) (-641.565) -- 0:00:00
986000 -- (-642.274) [-642.753] (-640.343) (-641.104) * (-642.617) (-639.871) (-645.778) [-642.483] -- 0:00:00
986500 -- [-639.826] (-644.664) (-640.320) (-644.572) * [-644.255] (-640.277) (-644.415) (-640.318) -- 0:00:00
987000 -- [-639.767] (-644.592) (-641.729) (-642.126) * [-641.807] (-640.953) (-641.351) (-641.166) -- 0:00:00
987500 -- (-641.623) (-641.338) (-640.213) [-640.182] * (-642.875) [-641.359] (-641.877) (-641.174) -- 0:00:00
988000 -- (-640.965) (-640.476) [-642.240] (-641.224) * [-641.574] (-641.544) (-640.500) (-643.524) -- 0:00:00
988500 -- (-645.503) (-640.262) (-640.134) [-644.677] * (-641.627) [-641.074] (-642.651) (-641.394) -- 0:00:00
989000 -- (-642.277) [-640.511] (-641.375) (-643.557) * (-642.192) [-642.206] (-642.508) (-642.836) -- 0:00:00
989500 -- (-647.156) (-639.860) [-639.858] (-642.640) * (-640.204) (-644.509) [-641.682] (-640.738) -- 0:00:00
990000 -- [-642.898] (-639.979) (-641.184) (-642.758) * (-642.173) (-641.295) (-642.540) [-641.332] -- 0:00:00
Average standard deviation of split frequencies: 0.008724
990500 -- (-646.303) (-643.176) (-640.555) [-641.787] * [-641.241] (-641.487) (-645.214) (-643.766) -- 0:00:00
991000 -- [-642.310] (-642.161) (-642.408) (-640.915) * [-641.045] (-645.856) (-641.772) (-641.808) -- 0:00:00
991500 -- (-640.025) [-643.887] (-643.185) (-643.030) * (-641.558) (-641.459) [-642.139] (-640.200) -- 0:00:00
992000 -- [-643.859] (-640.665) (-642.888) (-642.008) * (-641.727) [-646.137] (-640.279) (-640.951) -- 0:00:00
992500 -- (-641.481) (-645.962) [-642.838] (-643.072) * [-640.589] (-643.775) (-640.020) (-643.472) -- 0:00:00
993000 -- (-642.409) (-641.687) (-642.643) [-644.621] * [-643.818] (-640.396) (-640.018) (-642.869) -- 0:00:00
993500 -- [-641.415] (-642.257) (-644.253) (-641.196) * (-644.414) [-641.565] (-641.520) (-643.754) -- 0:00:00
994000 -- (-641.462) [-641.364] (-642.657) (-642.660) * (-640.206) [-641.930] (-644.029) (-642.045) -- 0:00:00
994500 -- (-643.876) [-640.892] (-647.919) (-642.289) * (-640.179) (-643.280) [-641.904] (-640.660) -- 0:00:00
995000 -- (-643.764) [-640.898] (-641.834) (-643.891) * (-640.692) (-643.294) (-642.236) [-641.729] -- 0:00:00
Average standard deviation of split frequencies: 0.008362
995500 -- (-641.189) (-642.057) [-645.911] (-645.030) * (-641.312) (-641.697) [-641.094] (-643.313) -- 0:00:00
996000 -- (-641.967) [-645.517] (-642.978) (-640.529) * [-644.690] (-640.105) (-643.946) (-641.267) -- 0:00:00
996500 -- (-641.895) (-641.402) (-643.094) [-640.467] * [-641.052] (-641.000) (-644.008) (-644.696) -- 0:00:00
997000 -- (-641.935) [-643.629] (-642.087) (-642.724) * (-642.401) (-640.838) (-641.033) [-641.981] -- 0:00:00
997500 -- (-644.559) (-643.142) [-642.149] (-644.046) * (-643.466) (-642.087) (-642.704) [-642.153] -- 0:00:00
998000 -- [-643.221] (-640.789) (-641.875) (-644.945) * [-641.005] (-644.087) (-641.285) (-640.165) -- 0:00:00
998500 -- (-644.253) [-641.319] (-641.486) (-645.453) * [-642.007] (-642.892) (-642.762) (-643.192) -- 0:00:00
999000 -- (-643.213) (-644.552) (-641.855) [-640.865] * (-640.748) [-639.915] (-646.267) (-643.960) -- 0:00:00
999500 -- (-643.947) [-640.840] (-640.792) (-640.488) * (-641.132) (-642.555) (-647.324) [-641.845] -- 0:00:00
1000000 -- [-641.906] (-641.873) (-646.503) (-640.413) * (-640.842) [-641.490] (-642.640) (-644.275) -- 0:00:00
Average standard deviation of split frequencies: 0.008134
Analysis completed in 60 seconds
Analysis used 59.09 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -639.61
Likelihood of best state for "cold" chain of run 2 was -639.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 58 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.0 % ( 26 %) Dirichlet(Pi{all})
33.5 % ( 30 %) Slider(Pi{all})
78.8 % ( 49 %) Multiplier(Alpha{1,2})
77.4 % ( 48 %) Multiplier(Alpha{3})
23.4 % ( 36 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
31.0 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.9 % ( 27 %) Dirichlet(Pi{all})
33.4 % ( 28 %) Slider(Pi{all})
79.5 % ( 56 %) Multiplier(Alpha{1,2})
78.3 % ( 58 %) Multiplier(Alpha{3})
23.7 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.0 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 85 %) ParsSPR(Tau{all},V{all})
28.3 % ( 15 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.6 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166774 0.82 0.67
3 | 167099 166811 0.84
4 | 166452 166084 166780
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167104 0.82 0.67
3 | 166480 166197 0.84
4 | 166323 166745 167151
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -641.19
| 2 |
| 2 |
| 2 1 1 |
| 1 1 1 |
| 1 1 11 2 1 2 2 * 22 |
|2 12 1 2 2 2 1 1 12 22|
|12 2 2* 11 * 11 1 1 1 2 2 1 |
| 21 11 2 2 * 1 1 2 1 1 * 12 |
| 1 212 2 2 2 2 1 1 1 |
| 2 21 11 21 2 1 * 12 * 12 2 1|
| 1 1 1 2 2 2 2 2 2 2 |
| 2 2 2 2 1 |
| 2 2 |
| 1 2 1 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -643.03
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -641.33 -645.79
2 -641.36 -646.37
--------------------------------------
TOTAL -641.34 -646.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887382 0.085127 0.388408 1.474868 0.856500 1501.00 1501.00 1.001
r(A<->C){all} 0.158963 0.018968 0.000040 0.440975 0.121233 212.94 253.56 1.006
r(A<->G){all} 0.178710 0.020705 0.000009 0.463247 0.142934 178.53 201.86 1.003
r(A<->T){all} 0.179480 0.022315 0.000155 0.480718 0.142456 221.40 264.49 1.000
r(C<->G){all} 0.163263 0.018718 0.000044 0.437491 0.127268 171.07 189.05 1.000
r(C<->T){all} 0.165458 0.019005 0.000024 0.440975 0.131414 268.43 286.16 1.001
r(G<->T){all} 0.154126 0.017912 0.000050 0.424091 0.115229 185.46 195.91 1.000
pi(A){all} 0.231647 0.000376 0.193003 0.268748 0.231430 1276.45 1291.02 1.000
pi(C){all} 0.261872 0.000424 0.219948 0.299672 0.261400 1455.60 1478.04 1.000
pi(G){all} 0.268577 0.000422 0.229442 0.309203 0.268035 1293.83 1397.41 1.000
pi(T){all} 0.237904 0.000381 0.200484 0.276467 0.237600 1165.30 1333.15 1.000
alpha{1,2} 0.420192 0.234951 0.000242 1.368362 0.240797 1155.20 1211.95 1.000
alpha{3} 0.456656 0.247916 0.000626 1.472271 0.289040 1321.20 1363.62 1.000
pinvar{all} 0.996534 0.000016 0.988563 1.000000 0.997914 1192.89 1293.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .**...
9 -- .*.*..
10 -- .***.*
11 -- ....**
12 -- .**.**
13 -- ...**.
14 -- ..****
15 -- ..**..
16 -- ...*.*
17 -- .*.***
18 -- .****.
19 -- .*..*.
20 -- ..*.*.
21 -- .*...*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 466 0.155230 0.017901 0.142572 0.167888 2
8 458 0.152565 0.013191 0.143238 0.161892 2
9 449 0.149567 0.012719 0.140573 0.158561 2
10 448 0.149234 0.012248 0.140573 0.157895 2
11 435 0.144903 0.003298 0.142572 0.147235 2
12 432 0.143904 0.004711 0.140573 0.147235 2
13 431 0.143571 0.008951 0.137242 0.149900 2
14 431 0.143571 0.004240 0.140573 0.146569 2
15 430 0.143238 0.005653 0.139241 0.147235 2
16 424 0.141239 0.002827 0.139241 0.143238 2
17 414 0.137908 0.007537 0.132578 0.143238 2
18 413 0.137575 0.007066 0.132578 0.142572 2
19 406 0.135243 0.003769 0.132578 0.137908 2
20 397 0.132245 0.004240 0.129247 0.135243 2
21 395 0.131579 0.013662 0.121919 0.141239 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097715 0.009385 0.000096 0.297855 0.068797 1.000 2
length{all}[2] 0.099642 0.010040 0.000011 0.307259 0.070163 1.000 2
length{all}[3] 0.099683 0.009870 0.000001 0.294990 0.069739 1.000 2
length{all}[4] 0.098287 0.009958 0.000020 0.295255 0.068178 1.000 2
length{all}[5] 0.095576 0.009519 0.000003 0.286771 0.063409 1.000 2
length{all}[6] 0.096830 0.009081 0.000030 0.283372 0.068735 1.000 2
length{all}[7] 0.102880 0.010479 0.000228 0.304069 0.072640 0.998 2
length{all}[8] 0.096081 0.008791 0.000403 0.288356 0.068888 0.999 2
length{all}[9] 0.103748 0.009275 0.000417 0.287388 0.075112 1.000 2
length{all}[10] 0.103549 0.010824 0.000258 0.304217 0.068927 1.000 2
length{all}[11] 0.098169 0.008684 0.000006 0.295511 0.071340 1.001 2
length{all}[12] 0.092570 0.009777 0.000181 0.298708 0.059490 1.001 2
length{all}[13] 0.096913 0.010301 0.000172 0.296094 0.064529 0.998 2
length{all}[14] 0.093162 0.008199 0.000108 0.265951 0.069315 0.999 2
length{all}[15] 0.100564 0.009297 0.000130 0.305428 0.072673 1.010 2
length{all}[16] 0.107200 0.012208 0.000488 0.307044 0.075053 0.998 2
length{all}[17] 0.095838 0.009155 0.000034 0.271943 0.070901 1.000 2
length{all}[18] 0.099800 0.011143 0.000040 0.315778 0.061833 0.999 2
length{all}[19] 0.096767 0.009459 0.000057 0.277576 0.071990 0.998 2
length{all}[20] 0.105014 0.009399 0.000242 0.301575 0.071913 1.004 2
length{all}[21] 0.094672 0.009978 0.000400 0.298835 0.064608 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008134
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 462
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 154 / 154 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 154 / 154 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106595 0.021552 0.085142 0.066007 0.066356 0.058998 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -680.382462
Iterating by ming2
Initial: fx= 680.382462
x= 0.10659 0.02155 0.08514 0.06601 0.06636 0.05900 0.30000 1.30000
1 h-m-p 0.0000 0.0001 367.7282 ++ 661.086145 m 0.0001 13 | 1/8
2 h-m-p 0.0022 0.0231 21.4110 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 336.3712 +++ 632.815817 m 0.0002 46 | 2/8
4 h-m-p 0.0050 0.1301 14.8951 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 302.5090 ++ 628.541831 m 0.0000 78 | 3/8
6 h-m-p 0.0154 7.6794 12.8662 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 262.0667 ++ 628.382273 m 0.0000 111 | 4/8
8 h-m-p 0.0160 8.0000 10.1316 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 213.6386 ++ 622.644987 m 0.0001 144 | 5/8
10 h-m-p 0.0160 8.0000 7.0260 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 151.2666 ++ 619.347597 m 0.0001 177 | 6/8
12 h-m-p 0.5772 8.0000 0.0000 ++ 619.347597 m 8.0000 188 | 6/8
13 h-m-p 0.2472 8.0000 0.0001 --C 619.347597 0 0.0039 203 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 --C 619.347597 0 0.0004 218 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 +++++ 619.347597 m 8.0000 234 | 6/8
16 h-m-p 0.0024 1.1889 1.4401 +++Y 619.347597 0 0.0955 250 | 6/8
17 h-m-p 1.6000 8.0000 0.0146 -Y 619.347597 0 0.0687 262 | 6/8
18 h-m-p 1.6000 8.0000 0.0000 +Y 619.347597 0 6.4000 276 | 6/8
19 h-m-p 1.6000 8.0000 0.0001 --Y 619.347597 0 0.0135 291 | 6/8
20 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 6/8
21 h-m-p 0.0160 8.0000 0.0000 +++++ 619.347597 m 8.0000 334 | 6/8
22 h-m-p 0.0160 8.0000 0.6089 +++++ 619.347558 m 8.0000 350 | 6/8
23 h-m-p 1.5942 8.0000 3.0554 ++ 619.347527 m 8.0000 363 | 6/8
24 h-m-p 1.6000 8.0000 1.6814 ++ 619.347524 m 8.0000 374 | 6/8
25 h-m-p 0.5116 8.0000 26.2939 ++ 619.347517 m 8.0000 385 | 6/8
26 h-m-p 1.6000 8.0000 3.2187 ---------Y 619.347517 0 0.0000 405 | 6/8
27 h-m-p 0.7517 8.0000 0.0000 -------------C 619.347517 0 0.0000 429
Out..
lnL = -619.347517
430 lfun, 430 eigenQcodon, 2580 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068154 0.067687 0.076239 0.090378 0.056247 0.060543 192.480321 0.853483 0.480033
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.135371
np = 9
lnL0 = -681.849903
Iterating by ming2
Initial: fx= 681.849903
x= 0.06815 0.06769 0.07624 0.09038 0.05625 0.06054 192.48032 0.85348 0.48003
1 h-m-p 0.0000 0.0004 357.3706 +++ 632.044525 m 0.0004 15 | 1/9
2 h-m-p 0.0001 0.0004 97.3610 ++ 628.616731 m 0.0004 27 | 2/9
3 h-m-p 0.0001 0.0003 418.8491 ++ 623.997361 m 0.0003 39 | 3/9
4 h-m-p 0.0000 0.0000 59407.4516 ++ 623.777183 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 4999.6697 ++ 621.375678 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 11561.1077 ++ 619.347597 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0004 ++ 619.347597 m 8.0000 87 | 6/9
8 h-m-p 0.0144 3.1950 0.2412 ------------N 619.347597 0 0.0000 114 | 6/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 619.347597 m 8.0000 132 | 6/9
10 h-m-p 0.0090 4.5176 0.1993 ---------C 619.347597 0 0.0000 156 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 619.347597 m 8.0000 174 | 6/9
12 h-m-p 0.0091 4.5724 0.2040 ----------Y 619.347597 0 0.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 619.347597 m 8.0000 217 | 6/9
14 h-m-p 0.0021 1.0727 0.8287 +++++ 619.347585 m 1.0727 235 | 7/9
15 h-m-p 1.6000 8.0000 0.0002 ++ 619.347585 m 8.0000 250 | 7/9
16 h-m-p 0.1404 8.0000 0.0132 +++ 619.347585 m 8.0000 265 | 7/9
17 h-m-p 0.3139 8.0000 0.3376 +++ 619.347585 m 8.0000 280 | 7/9
18 h-m-p 0.1838 0.9192 5.3359 ------Y 619.347585 0 0.0000 300 | 7/9
19 h-m-p 1.1232 8.0000 0.0001 ------Y 619.347585 0 0.0001 318 | 7/9
20 h-m-p 1.6000 8.0000 0.0000 -------Y 619.347585 0 0.0000 339
Out..
lnL = -619.347585
340 lfun, 1020 eigenQcodon, 4080 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106749 0.052634 0.068867 0.101445 0.031127 0.101259 196.058340 1.543781 0.197496 0.445297 174.467537
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.005057
np = 11
lnL0 = -642.680519
Iterating by ming2
Initial: fx= 642.680519
x= 0.10675 0.05263 0.06887 0.10145 0.03113 0.10126 196.05834 1.54378 0.19750 0.44530 174.46754
1 h-m-p 0.0000 0.0017 41.2898 ++++ 638.825366 m 0.0017 18 | 1/11
2 h-m-p 0.0038 0.0503 17.2409 ++ 626.924582 m 0.0503 32 | 2/11
3 h-m-p 0.0000 0.0000 97046.0844 ++ 626.358036 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0000 1221.1238 ++ 626.341427 m 0.0000 60 | 4/11
5 h-m-p 0.0000 0.0007 2022.7521 ++++ 624.184369 m 0.0007 76 | 5/11
6 h-m-p 0.0002 0.0009 227.9441 ++ 623.796844 m 0.0009 90 | 6/11
7 h-m-p 0.0861 0.4306 0.9058 ++ 619.347539 m 0.4306 104 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 619.347539 m 8.0000 123 | 7/11
9 h-m-p 0.0160 8.0000 1.1680 ----------Y 619.347539 0 0.0000 151 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 619.347539 m 8.0000 168 | 7/11
11 h-m-p 0.0160 8.0000 0.0381 +++++ 619.347538 m 8.0000 189 | 7/11
12 h-m-p 0.0652 8.0000 4.6769 ++++ 619.347517 m 8.0000 209 | 7/11
13 h-m-p 1.6000 8.0000 0.1072 -----C 619.347517 0 0.0005 228 | 7/11
14 h-m-p 1.6000 8.0000 0.0000 ++ 619.347517 m 8.0000 246 | 7/11
15 h-m-p 0.0160 8.0000 0.0291 --------Y 619.347517 0 0.0000 272 | 7/11
16 h-m-p 0.0160 8.0000 0.0002 -----Y 619.347517 0 0.0000 295 | 7/11
17 h-m-p 0.0160 8.0000 0.0000 ---------Y 619.347517 0 0.0000 322
Out..
lnL = -619.347517
323 lfun, 1292 eigenQcodon, 5814 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -619.344021 S = -619.343965 -0.000021
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:03
did 20 / 51 patterns 0:03
did 30 / 51 patterns 0:03
did 40 / 51 patterns 0:03
did 50 / 51 patterns 0:03
did 51 / 51 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035014 0.036490 0.077953 0.083654 0.013351 0.068745 205.926467 0.925292 1.206430
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.144380
np = 9
lnL0 = -665.993152
Iterating by ming2
Initial: fx= 665.993152
x= 0.03501 0.03649 0.07795 0.08365 0.01335 0.06875 205.92647 0.92529 1.20643
1 h-m-p 0.0000 0.0001 352.6218 ++ 654.604948 m 0.0001 14 | 1/9
2 h-m-p 0.0019 0.0610 15.5523 ------------.. | 1/9
3 h-m-p 0.0000 0.0001 325.5334 ++ 638.753743 m 0.0001 48 | 2/9
4 h-m-p 0.0049 0.1174 8.7289 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 296.9388 ++ 637.874732 m 0.0000 82 | 3/9
6 h-m-p 0.0005 0.2514 5.1367 -----------.. | 3/9
7 h-m-p 0.0000 0.0002 256.1528 +++ 623.154933 m 0.0002 116 | 4/9
8 h-m-p 0.0138 0.4129 3.3555 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 214.5752 ++ 620.254586 m 0.0001 151 | 5/9
10 h-m-p 0.0023 0.4360 4.1770 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 152.5647 ++ 619.347629 m 0.0000 185 | 6/9
12 h-m-p 0.3369 8.0000 0.0000 +++ 619.347629 m 8.0000 198 | 6/9
13 h-m-p 0.2350 8.0000 0.0000 +++ 619.347629 m 8.0000 214 | 6/9
14 h-m-p 0.0077 3.8346 0.3824 -------Y 619.347629 0 0.0000 236 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 619.347629 m 8.0000 254 | 6/9
16 h-m-p 0.0160 8.0000 0.1532 +++++ 619.347628 m 8.0000 272 | 6/9
17 h-m-p 1.6000 8.0000 0.5826 ++ 619.347628 m 8.0000 287 | 6/9
18 h-m-p 1.6000 8.0000 0.8046 ++ 619.347627 m 8.0000 302 | 6/9
19 h-m-p 1.6000 8.0000 2.5507 ++ 619.347627 m 8.0000 317 | 6/9
20 h-m-p 0.1815 0.9073 37.6872 -------Y 619.347627 0 0.0000 336 | 6/9
21 h-m-p 1.6000 8.0000 0.0001 C 619.347627 0 0.4000 348 | 6/9
22 h-m-p 1.6000 8.0000 0.0000 --------------N 619.347627 0 0.0000 377
Out..
lnL = -619.347627
378 lfun, 4158 eigenQcodon, 22680 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104191 0.090235 0.030935 0.101122 0.034779 0.087305 206.086634 0.900000 0.803083 1.344298 166.025864
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.007257
np = 11
lnL0 = -637.346312
Iterating by ming2
Initial: fx= 637.346312
x= 0.10419 0.09023 0.03094 0.10112 0.03478 0.08730 206.08663 0.90000 0.80308 1.34430 166.02586
1 h-m-p 0.0000 0.0010 108.6969 +++YYYCCC 632.236932 5 0.0006 26 | 0/11
2 h-m-p 0.0002 0.0011 49.9600 ++ 629.623245 m 0.0011 40 | 1/11
3 h-m-p 0.0089 0.0664 5.6834 ++ 627.473104 m 0.0664 54 | 2/11
4 h-m-p 0.0013 0.0065 23.3787 ++ 624.716461 m 0.0065 68 | 3/11
5 h-m-p 0.0004 0.0021 59.2154 ++ 622.285898 m 0.0021 82 | 4/11
6 h-m-p 0.0008 0.0042 16.8311 ++ 621.620482 m 0.0042 96 | 5/11
7 h-m-p 0.0002 0.0012 269.7332 ++ 619.347527 m 0.0012 110 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ----N 619.347527 0 0.0016 128 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 619.347527 m 8.0000 150 | 6/11
10 h-m-p 0.0142 7.0854 0.1851 +++++ 619.347518 m 7.0854 172
QuantileBeta(0.85, 0.75454, 0.00494) = 1.000000e+00 2000 rounds
| 6/11
11 h-m-p -0.0000 -0.0000 0.0251
h-m-p: -8.90736235e-16 -4.45368118e-15 2.51388302e-02 619.347518
..
QuantileBeta(0.85, 0.75454, 0.00494) = 1.000000e+00 2000 rounds
| 6/11
12 h-m-p 0.0160 8.0000 0.0000 ---Y 619.347518 0 0.0001 210
QuantileBeta(0.85, 0.75454, 0.00494) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 0.0160 8.0000 0.0000 ----N 619.347518 0 0.0000 233
Out..
lnL = -619.347518
234 lfun, 2808 eigenQcodon, 15444 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -619.344166 S = -619.343983 -0.000080
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:13
did 20 / 51 patterns 0:13
did 30 / 51 patterns 0:14
did 40 / 51 patterns 0:14
did 50 / 51 patterns 0:14
did 51 / 51 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=154
NC_011896_1_WP_010908860_1_2545_MLBR_RS12125 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
NC_002677_1_NP_302540_1_1412_ML2377 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES
**************************************************
NC_011896_1_WP_010908860_1_2545_MLBR_RS12125 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
NC_002677_1_NP_302540_1_1412_ML2377 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415 YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW
**************************************************
NC_011896_1_WP_010908860_1_2545_MLBR_RS12125 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
NC_002677_1_NP_302540_1_1412_ML2377 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415 SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL
**************************************************
NC_011896_1_WP_010908860_1_2545_MLBR_RS12125 VKSA
NC_002677_1_NP_302540_1_1412_ML2377 VKSA
NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895 VKSA
NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550 VKSA
NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095 VKSA
NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415 VKSA
****
>NC_011896_1_WP_010908860_1_2545_MLBR_RS12125 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG GTGAAGTCCGCG >NC_002677_1_NP_302540_1_1412_ML2377 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG GTGAAGTCCGCG >NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG GTGAAGTCCGCG >NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG GTGAAGTCCGCG >NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG GTGAAGTCCGCG >NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415 ATGTCCAAACGCCAACGGGGTAAGGGGATTTCAATTTTCAAGCTGTTGTC ACGAATTTGGATTCCACTTGTCATCCTTGTGGTGCTCGTGGTTGGGGGAT TCGTAGTGTACCGTGTCCACAGTTATTTCGCCTCCGAGAAACGCGAATCC TACGCAGATAGCAACCTGGGAAGCAGCAAGCCGTTCAACCCCAAGCAGAT TGTTTACGAGGTCTTCGGCCCACCCGGAACGGTTGCAGATATCAGCTATT TCGATGCTAATTCCGACCCCCAGCGAATCGATGGGGCACAATTGCCATGG TCGTTACTTATGACCACGACCTTGGCCGCAGTGATGGGAAACCTCGTGGC TCAGGGCAATACTGATAGTATCGGCTGCCGGATCATCGTGGACGGCGTAG TCAAAGCTGAGCGAGTTTCCAACGAAGTCAACGCCTACACCTACTGCCTG GTGAAGTCCGCG
>NC_011896_1_WP_010908860_1_2545_MLBR_RS12125 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL VKSA >NC_002677_1_NP_302540_1_1412_ML2377 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL VKSA >NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL VKSA >NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL VKSA >NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL VKSA >NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415 MSKRQRGKGISIFKLLSRIWIPLVILVVLVVGGFVVYRVHSYFASEKRES YADSNLGSSKPFNPKQIVYEVFGPPGTVADISYFDANSDPQRIDGAQLPW SLLMTTTLAAVMGNLVAQGNTDSIGCRIIVDGVVKAERVSNEVNAYTYCL VKSA
#NEXUS
[ID: 5043938471]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908860_1_2545_MLBR_RS12125
NC_002677_1_NP_302540_1_1412_ML2377
NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895
NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550
NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095
NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908860_1_2545_MLBR_RS12125,
2 NC_002677_1_NP_302540_1_1412_ML2377,
3 NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895,
4 NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550,
5 NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095,
6 NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06879738,2:0.07016339,3:0.06973882,4:0.06817782,5:0.06340873,6:0.06873537);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06879738,2:0.07016339,3:0.06973882,4:0.06817782,5:0.06340873,6:0.06873537);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -641.33 -645.79
2 -641.36 -646.37
--------------------------------------
TOTAL -641.34 -646.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2377/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887382 0.085127 0.388408 1.474868 0.856500 1501.00 1501.00 1.001
r(A<->C){all} 0.158963 0.018968 0.000040 0.440975 0.121233 212.94 253.56 1.006
r(A<->G){all} 0.178710 0.020705 0.000009 0.463247 0.142934 178.53 201.86 1.003
r(A<->T){all} 0.179480 0.022315 0.000155 0.480718 0.142456 221.40 264.49 1.000
r(C<->G){all} 0.163263 0.018718 0.000044 0.437491 0.127268 171.07 189.05 1.000
r(C<->T){all} 0.165458 0.019005 0.000024 0.440975 0.131414 268.43 286.16 1.001
r(G<->T){all} 0.154126 0.017912 0.000050 0.424091 0.115229 185.46 195.91 1.000
pi(A){all} 0.231647 0.000376 0.193003 0.268748 0.231430 1276.45 1291.02 1.000
pi(C){all} 0.261872 0.000424 0.219948 0.299672 0.261400 1455.60 1478.04 1.000
pi(G){all} 0.268577 0.000422 0.229442 0.309203 0.268035 1293.83 1397.41 1.000
pi(T){all} 0.237904 0.000381 0.200484 0.276467 0.237600 1165.30 1333.15 1.000
alpha{1,2} 0.420192 0.234951 0.000242 1.368362 0.240797 1155.20 1211.95 1.000
alpha{3} 0.456656 0.247916 0.000626 1.472271 0.289040 1321.20 1363.62 1.000
pinvar{all} 0.996534 0.000016 0.988563 1.000000 0.997914 1192.89 1293.30 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2377/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 154
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 6 6 6 6 6 6 | TCC 6 6 6 6 6 6 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 3 3 3 3 3 3 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 3 3 3 3 3 3 | CCG 1 1 1 1 1 1 | CAG 3 3 3 3 3 3 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 2 2 2 2 2 2
ATC 6 6 6 6 6 6 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 1 1 1 1 1 1
GTC 5 5 5 5 5 5 | GCC 3 3 3 3 3 3 | GAC 2 2 2 2 2 2 | GGC 4 4 4 4 4 4
GTA 2 2 2 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 2 2 2 2 2 2 | GGA 4 4 4 4 4 4
GTG 8 8 8 8 8 8 | GCG 1 1 1 1 1 1 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908860_1_2545_MLBR_RS12125
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
#2: NC_002677_1_NP_302540_1_1412_ML2377
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
#3: NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
#4: NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
#5: NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
#6: NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 36 | TCC 36 | TAC 30 | TGC 12
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 12 | CCC 18 | CAC 6 | CGC 12
CTA 0 | CCA 18 | Gln Q CAA 12 | CGA 18
CTG 18 | CCG 6 | CAG 18 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 12
ATC 36 | ACC 18 | AAC 30 | AGC 24
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 6
GTC 30 | GCC 18 | GAC 12 | GGC 24
GTA 12 | GCA 24 | Glu E GAA 12 | GGA 24
GTG 48 | GCG 6 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19481 C:0.18831 A:0.26623 G:0.35065
position 2: T:0.33117 C:0.21429 A:0.25974 G:0.19481
position 3: T:0.18831 C:0.38312 A:0.16883 G:0.25974
Average T:0.23810 C:0.26190 A:0.23160 G:0.26840
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -619.347517 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 192.480321 166.025864
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908860_1_2545_MLBR_RS12125: 0.000004, NC_002677_1_NP_302540_1_1412_ML2377: 0.000004, NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895: 0.000004, NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550: 0.000004, NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095: 0.000004, NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 192.48032
omega (dN/dS) = 166.02586
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.7 141.3 166.0259 0.0000 0.0000 0.0 0.0
7..2 0.000 320.7 141.3 166.0259 0.0000 0.0000 0.0 0.0
7..3 0.000 320.7 141.3 166.0259 0.0000 0.0000 0.0 0.0
7..4 0.000 320.7 141.3 166.0259 0.0000 0.0000 0.0 0.0
7..5 0.000 320.7 141.3 166.0259 0.0000 0.0000 0.0 0.0
7..6 0.000 320.7 141.3 166.0259 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -619.347585 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 196.058340 0.000010 0.968019
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908860_1_2545_MLBR_RS12125: 0.000004, NC_002677_1_NP_302540_1_1412_ML2377: 0.000004, NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895: 0.000004, NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550: 0.000004, NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095: 0.000004, NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 196.05834
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.96802 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.7 141.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 320.7 141.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 320.7 141.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 320.7 141.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 320.7 141.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 320.7 141.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -619.347517 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 205.926467 0.106494 0.000000 0.000001 176.814935
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908860_1_2545_MLBR_RS12125: 0.000004, NC_002677_1_NP_302540_1_1412_ML2377: 0.000004, NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895: 0.000004, NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550: 0.000004, NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095: 0.000004, NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 205.92647
MLEs of dN/dS (w) for site classes (K=3)
p: 0.10649 0.00000 0.89351
w: 0.00000 1.00000 176.81494
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.7 141.3 157.9852 0.0000 0.0000 0.0 0.0
7..2 0.000 320.7 141.3 157.9852 0.0000 0.0000 0.0 0.0
7..3 0.000 320.7 141.3 157.9852 0.0000 0.0000 0.0 0.0
7..4 0.000 320.7 141.3 157.9852 0.0000 0.0000 0.0 0.0
7..5 0.000 320.7 141.3 157.9852 0.0000 0.0000 0.0 0.0
7..6 0.000 320.7 141.3 157.9852 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908860_1_2545_MLBR_RS12125)
Pr(w>1) post mean +- SE for w
1 M 0.894 157.984
2 S 0.894 157.985
3 K 0.894 157.985
4 R 0.894 157.985
5 Q 0.894 157.985
6 R 0.894 157.985
7 G 0.894 157.985
8 K 0.894 157.985
9 G 0.894 157.985
10 I 0.894 157.985
11 S 0.894 157.985
12 I 0.894 157.985
13 F 0.894 157.985
14 K 0.894 157.985
15 L 0.894 157.985
16 L 0.894 157.985
17 S 0.894 157.985
18 R 0.894 157.985
19 I 0.894 157.985
20 W 0.894 157.985
21 I 0.894 157.985
22 P 0.894 157.985
23 L 0.894 157.985
24 V 0.894 157.984
25 I 0.894 157.984
26 L 0.894 157.985
27 V 0.894 157.985
28 V 0.894 157.985
29 L 0.894 157.985
30 V 0.894 157.985
31 V 0.894 157.985
32 G 0.894 157.985
33 G 0.894 157.985
34 F 0.894 157.985
35 V 0.894 157.985
36 V 0.894 157.985
37 Y 0.894 157.985
38 R 0.894 157.985
39 V 0.894 157.984
40 H 0.894 157.985
41 S 0.894 157.985
42 Y 0.894 157.985
43 F 0.894 157.985
44 A 0.894 157.984
45 S 0.894 157.985
46 E 0.894 157.985
47 K 0.894 157.985
48 R 0.894 157.985
49 E 0.894 157.985
50 S 0.894 157.985
51 Y 0.894 157.985
52 A 0.894 157.985
53 D 0.894 157.985
54 S 0.894 157.985
55 N 0.894 157.985
56 L 0.894 157.985
57 G 0.894 157.985
58 S 0.894 157.985
59 S 0.894 157.985
60 K 0.894 157.985
61 P 0.894 157.985
62 F 0.894 157.985
63 N 0.894 157.985
64 P 0.894 157.985
65 K 0.894 157.985
66 Q 0.894 157.985
67 I 0.894 157.985
68 V 0.894 157.985
69 Y 0.894 157.985
70 E 0.894 157.985
71 V 0.894 157.984
72 F 0.894 157.985
73 G 0.894 157.985
74 P 0.894 157.985
75 P 0.894 157.985
76 G 0.894 157.985
77 T 0.894 157.985
78 V 0.894 157.985
79 A 0.894 157.985
80 D 0.894 157.985
81 I 0.894 157.984
82 S 0.894 157.985
83 Y 0.894 157.985
84 F 0.894 157.985
85 D 0.894 157.985
86 A 0.894 157.985
87 N 0.894 157.985
88 S 0.894 157.985
89 D 0.894 157.985
90 P 0.894 157.985
91 Q 0.894 157.985
92 R 0.894 157.985
93 I 0.894 157.984
94 D 0.894 157.985
95 G 0.894 157.985
96 A 0.894 157.985
97 Q 0.894 157.985
98 L 0.894 157.985
99 P 0.894 157.985
100 W 0.894 157.985
101 S 0.894 157.985
102 L 0.894 157.985
103 L 0.894 157.985
104 M 0.894 157.984
105 T 0.894 157.984
106 T 0.894 157.985
107 T 0.894 157.984
108 L 0.894 157.985
109 A 0.894 157.984
110 A 0.894 157.985
111 V 0.894 157.985
112 M 0.894 157.984
113 G 0.894 157.985
114 N 0.894 157.985
115 L 0.894 157.985
116 V 0.894 157.985
117 A 0.894 157.985
118 Q 0.894 157.985
119 G 0.894 157.985
120 N 0.894 157.985
121 T 0.894 157.985
122 D 0.894 157.985
123 S 0.894 157.985
124 I 0.894 157.984
125 G 0.894 157.985
126 C 0.894 157.985
127 R 0.894 157.985
128 I 0.894 157.984
129 I 0.894 157.984
130 V 0.894 157.985
131 D 0.894 157.985
132 G 0.894 157.985
133 V 0.894 157.985
134 V 0.894 157.984
135 K 0.894 157.985
136 A 0.894 157.985
137 E 0.894 157.985
138 R 0.894 157.985
139 V 0.894 157.985
140 S 0.894 157.985
141 N 0.894 157.985
142 E 0.894 157.985
143 V 0.894 157.984
144 N 0.894 157.985
145 A 0.894 157.984
146 Y 0.894 157.985
147 T 0.894 157.984
148 Y 0.894 157.985
149 C 0.894 157.985
150 L 0.894 157.985
151 V 0.894 157.985
152 K 0.894 157.985
153 S 0.894 157.985
154 A 0.894 157.985
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908860_1_2545_MLBR_RS12125)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -619.347627 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 206.086634 21.471448 26.682692
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908860_1_2545_MLBR_RS12125: 0.000004, NC_002677_1_NP_302540_1_1412_ML2377: 0.000004, NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895: 0.000004, NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550: 0.000004, NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095: 0.000004, NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 206.08663
Parameters in M7 (beta):
p = 21.47145 q = 26.68269
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.33043 0.37176 0.39704 0.41753 0.43610 0.45419 0.47297 0.49392 0.52015 0.56394
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.7 141.3 0.4458 0.0000 0.0000 0.0 0.0
7..2 0.000 320.7 141.3 0.4458 0.0000 0.0000 0.0 0.0
7..3 0.000 320.7 141.3 0.4458 0.0000 0.0000 0.0 0.0
7..4 0.000 320.7 141.3 0.4458 0.0000 0.0000 0.0 0.0
7..5 0.000 320.7 141.3 0.4458 0.0000 0.0000 0.0 0.0
7..6 0.000 320.7 141.3 0.4458 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -619.347518 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 206.065472 0.629815 0.754543 0.005000 165.873110
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908860_1_2545_MLBR_RS12125: 0.000004, NC_002677_1_NP_302540_1_1412_ML2377: 0.000004, NZ_LVXE01000088_1_WP_010908860_1_2822_A3216_RS13895: 0.000004, NZ_LYPH01000089_1_WP_010908860_1_2809_A8144_RS13550: 0.000004, NZ_CP029543_1_WP_010908860_1_2570_DIJ64_RS13095: 0.000004, NZ_AP014567_1_WP_010908860_1_2634_JK2ML_RS13415: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 206.06547
Parameters in M8 (beta&w>1):
p0 = 0.62981 p = 0.75454 q = 0.00500
(p1 = 0.37019) w = 165.87311
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06298 0.06298 0.06298 0.06298 0.06298 0.06298 0.06298 0.06298 0.06298 0.06298 0.37019
w: 0.99994 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 165.87311
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.7 141.3 62.0336 0.0000 0.0000 0.0 0.0
7..2 0.000 320.7 141.3 62.0336 0.0000 0.0000 0.0 0.0
7..3 0.000 320.7 141.3 62.0336 0.0000 0.0000 0.0 0.0
7..4 0.000 320.7 141.3 62.0336 0.0000 0.0000 0.0 0.0
7..5 0.000 320.7 141.3 62.0336 0.0000 0.0000 0.0 0.0
7..6 0.000 320.7 141.3 62.0336 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908860_1_2545_MLBR_RS12125)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908860_1_2545_MLBR_RS12125)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -619.347585 Model 2: PositiveSelection -619.347517 Model 0: one-ratio -619.347517 Model 7: beta -619.347627 Model 8: beta&w>1 -619.347518 Model 0 vs 1 1.3599999988400668E-4 Model 2 vs 1 1.3599999988400668E-4 Model 8 vs 7 2.1799999990435026E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
