--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:52:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2388/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -414.44 -417.66
2 -414.43 -417.77
--------------------------------------
TOTAL -414.44 -417.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891645 0.087389 0.366327 1.489685 0.861442 1383.64 1442.32 1.000
r(A<->C){all} 0.155596 0.017293 0.000005 0.429578 0.120317 185.88 201.00 1.001
r(A<->G){all} 0.167994 0.021375 0.000174 0.456098 0.128872 154.08 176.73 1.003
r(A<->T){all} 0.167954 0.020527 0.000042 0.457870 0.130367 210.45 252.30 1.000
r(C<->G){all} 0.167804 0.020226 0.000044 0.446710 0.129266 122.73 150.28 1.000
r(C<->T){all} 0.169179 0.020782 0.000080 0.457266 0.130392 182.28 217.18 1.002
r(G<->T){all} 0.171474 0.021983 0.000078 0.470734 0.131847 203.52 266.70 1.001
pi(A){all} 0.175522 0.000461 0.136161 0.219480 0.174877 1349.80 1365.27 1.001
pi(C){all} 0.244964 0.000588 0.197077 0.291876 0.244144 1291.60 1396.30 1.000
pi(G){all} 0.328987 0.000709 0.273454 0.377725 0.328684 1332.55 1340.50 1.000
pi(T){all} 0.250527 0.000623 0.203839 0.300627 0.250206 1038.43 1186.35 1.000
alpha{1,2} 0.414210 0.228991 0.000376 1.392937 0.237317 814.86 839.22 1.000
alpha{3} 0.460864 0.246784 0.000243 1.449607 0.302296 1167.17 1334.09 1.000
pinvar{all} 0.994579 0.000047 0.981977 0.999996 0.996641 1248.62 1374.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -394.442254
Model 2: PositiveSelection -394.442254
Model 0: one-ratio -394.442368
Model 7: beta -394.442332
Model 8: beta&w>1 -394.442319
Model 0 vs 1 2.2799999999278953E-4
Model 2 vs 1 0.0
Model 8 vs 7 2.6000000048043148E-5
>C1
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C2
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C3
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C4
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C5
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C6
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=101
C1 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C2 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C3 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C4 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C5 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C6 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
**************************************************
C1 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C2 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C3 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C4 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C5 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C6 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
**************************************************
C1 L
C2 L
C3 L
C4 L
C5 L
C6 L
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 101 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 101 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3030]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3030]--->[3030]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.626 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C2 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C3 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C4 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C5 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
C6 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
**************************************************
C1 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C2 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C3 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C4 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C5 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
C6 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
**************************************************
C1 L
C2 L
C3 L
C4 L
C5 L
C6 L
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
C2 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
C3 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
C4 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
C5 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
C6 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
**************************************************
C1 AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
C2 AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
C3 AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
C4 AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
C5 AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
C6 AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
**************************************************
C1 TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
C2 TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
C3 TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
C4 TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
C5 TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
C6 TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
**************************************************
C1 GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
C2 GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
C3 GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
C4 GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
C5 GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
C6 GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
**************************************************
C1 GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
C2 GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
C3 GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
C4 GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
C5 GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
C6 GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
**************************************************
C1 TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
C2 TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
C3 TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
C4 TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
C5 TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
C6 TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
**************************************************
C1 CTG
C2 CTG
C3 CTG
C4 CTG
C5 CTG
C6 CTG
***
>C1
GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
CTG
>C2
GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
CTG
>C3
GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
CTG
>C4
GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
CTG
>C5
GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
CTG
>C6
GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC
AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG
TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC
GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG
GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC
TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC
CTG
>C1
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C2
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C3
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C4
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C5
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
>C6
VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
L
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 303 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855861
Setting output file names to "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1039479974
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5580586718
Seed = 81335204
Swapseed = 1579855861
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -678.128523 -- -24.965149
Chain 2 -- -678.128484 -- -24.965149
Chain 3 -- -678.128523 -- -24.965149
Chain 4 -- -678.128523 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -678.128484 -- -24.965149
Chain 2 -- -678.128523 -- -24.965149
Chain 3 -- -678.128523 -- -24.965149
Chain 4 -- -678.128523 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-678.129] (-678.128) (-678.129) (-678.129) * [-678.128] (-678.129) (-678.129) (-678.129)
500 -- (-420.285) (-431.113) [-423.302] (-431.930) * (-429.260) (-424.297) [-424.083] (-422.156) -- 0:00:00
1000 -- (-430.848) [-426.338] (-426.233) (-421.638) * (-423.108) (-434.099) [-421.659] (-423.506) -- 0:00:00
1500 -- [-423.912] (-423.109) (-428.553) (-420.684) * [-424.819] (-422.109) (-425.317) (-423.208) -- 0:00:00
2000 -- [-422.598] (-422.216) (-423.847) (-430.761) * (-421.343) (-424.539) (-421.106) [-421.530] -- 0:00:00
2500 -- (-423.323) [-424.955] (-425.289) (-424.378) * [-419.395] (-421.698) (-431.763) (-418.808) -- 0:00:00
3000 -- (-426.070) [-422.426] (-429.456) (-434.049) * (-427.601) [-427.647] (-425.412) (-433.091) -- 0:00:00
3500 -- (-424.521) (-431.660) [-425.057] (-426.279) * (-420.861) [-420.343] (-428.878) (-424.230) -- 0:00:00
4000 -- (-418.155) (-424.034) (-422.474) [-421.632] * (-422.762) (-430.251) [-424.869] (-424.804) -- 0:00:00
4500 -- (-428.855) (-421.465) [-423.998] (-423.441) * (-427.028) (-422.884) [-422.363] (-425.943) -- 0:00:00
5000 -- (-423.198) [-417.485] (-422.489) (-432.948) * [-420.035] (-421.227) (-423.591) (-421.761) -- 0:00:00
Average standard deviation of split frequencies: 0.121422
5500 -- (-419.649) (-421.909) [-424.453] (-432.134) * [-424.238] (-424.841) (-421.111) (-443.437) -- 0:00:00
6000 -- (-426.398) (-425.272) [-424.006] (-425.822) * (-427.085) (-425.808) (-423.931) [-424.944] -- 0:00:00
6500 -- (-420.162) (-425.370) [-423.179] (-418.326) * (-428.944) (-426.569) (-430.402) [-424.097] -- 0:00:00
7000 -- (-434.112) (-421.634) (-422.318) [-422.165] * [-423.353] (-424.847) (-427.915) (-425.724) -- 0:00:00
7500 -- (-427.467) [-428.252] (-432.016) (-420.160) * (-426.216) (-440.323) (-425.215) [-429.528] -- 0:00:00
8000 -- [-422.764] (-427.645) (-432.550) (-432.563) * [-424.882] (-416.837) (-422.200) (-425.451) -- 0:00:00
8500 -- (-427.259) (-419.387) [-413.263] (-422.613) * (-423.070) [-421.316] (-422.060) (-424.613) -- 0:00:00
9000 -- [-421.784] (-418.710) (-413.539) (-422.852) * (-426.361) (-430.353) (-422.351) [-418.984] -- 0:00:00
9500 -- [-429.589] (-415.430) (-415.914) (-426.889) * (-432.813) (-427.728) [-424.494] (-422.431) -- 0:00:00
10000 -- (-427.527) (-414.987) (-415.352) [-430.381] * (-428.760) (-421.780) (-424.591) [-420.923] -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- (-419.577) [-414.863] (-413.883) (-429.806) * (-422.320) [-423.588] (-429.857) (-425.744) -- 0:01:34
11000 -- (-431.576) [-422.931] (-416.273) (-423.417) * [-423.185] (-425.723) (-424.946) (-434.036) -- 0:01:29
11500 -- (-418.306) (-414.242) [-414.390] (-433.030) * (-426.086) (-421.354) (-422.817) [-423.536] -- 0:01:25
12000 -- (-429.064) (-414.770) (-414.269) [-426.324] * (-424.537) [-424.850] (-433.634) (-423.951) -- 0:01:22
12500 -- (-424.456) (-415.218) [-416.832] (-437.335) * (-431.152) [-419.736] (-422.406) (-430.094) -- 0:01:19
13000 -- (-421.495) [-415.380] (-414.191) (-430.925) * (-423.953) [-425.947] (-428.396) (-426.431) -- 0:01:15
13500 -- (-437.003) (-414.716) [-413.405] (-422.435) * (-430.305) [-424.222] (-435.656) (-426.394) -- 0:01:13
14000 -- (-425.060) [-413.801] (-415.858) (-413.285) * (-426.968) (-432.982) [-427.397] (-421.345) -- 0:01:10
14500 -- (-438.127) (-417.064) [-415.630] (-414.697) * (-423.830) (-423.488) (-427.473) [-426.139] -- 0:01:07
15000 -- [-413.629] (-414.875) (-416.518) (-416.956) * (-422.254) [-421.068] (-426.941) (-426.081) -- 0:01:05
Average standard deviation of split frequencies: 0.071552
15500 -- (-418.101) (-414.358) (-418.278) [-415.752] * (-429.545) (-430.590) [-430.665] (-428.568) -- 0:01:03
16000 -- (-416.676) (-415.087) (-414.321) [-414.226] * (-424.840) (-424.329) (-423.994) [-426.821] -- 0:01:01
16500 -- [-415.082] (-415.331) (-416.153) (-415.959) * (-419.568) (-428.442) [-431.406] (-428.651) -- 0:00:59
17000 -- (-417.537) [-418.204] (-413.435) (-414.767) * (-420.209) (-426.173) [-430.882] (-424.557) -- 0:00:57
17500 -- [-413.940] (-420.522) (-416.911) (-415.978) * (-421.074) [-414.826] (-426.410) (-437.606) -- 0:00:56
18000 -- [-413.592] (-414.917) (-415.904) (-416.169) * (-420.750) (-414.426) [-425.844] (-442.541) -- 0:00:54
18500 -- (-415.961) (-414.166) (-416.463) [-415.706] * (-429.827) (-416.933) [-420.838] (-431.403) -- 0:00:53
19000 -- (-416.310) [-415.260] (-420.420) (-422.746) * [-423.082] (-415.788) (-421.513) (-423.345) -- 0:00:51
19500 -- (-415.055) [-414.719] (-416.001) (-419.084) * [-418.081] (-414.004) (-433.166) (-426.465) -- 0:00:50
20000 -- [-414.814] (-414.858) (-415.570) (-419.444) * (-438.100) (-413.159) (-427.636) [-421.215] -- 0:00:49
Average standard deviation of split frequencies: 0.065895
20500 -- (-414.231) (-413.411) [-413.318] (-417.768) * (-420.902) (-414.429) (-426.201) [-422.519] -- 0:00:47
21000 -- (-414.304) (-417.331) (-413.468) [-417.196] * (-427.523) [-414.129] (-436.656) (-424.788) -- 0:00:46
21500 -- (-415.461) (-418.807) (-414.104) [-417.785] * (-428.845) [-414.580] (-431.383) (-416.912) -- 0:00:45
22000 -- [-417.506] (-413.798) (-413.231) (-415.830) * (-423.495) (-416.117) [-424.197] (-433.380) -- 0:00:44
22500 -- [-413.150] (-413.229) (-415.396) (-414.197) * (-419.204) [-414.336] (-438.333) (-424.534) -- 0:00:43
23000 -- (-414.824) [-414.418] (-417.050) (-415.503) * (-417.540) [-413.254] (-430.247) (-424.582) -- 0:00:42
23500 -- (-415.414) (-415.232) (-417.565) [-416.364] * (-423.909) [-414.233] (-430.553) (-424.961) -- 0:00:41
24000 -- (-415.249) [-415.847] (-416.544) (-421.882) * (-425.911) (-417.661) (-432.204) [-418.886] -- 0:00:40
24500 -- (-414.055) (-417.421) [-416.805] (-422.786) * [-423.099] (-417.051) (-428.725) (-429.924) -- 0:00:39
25000 -- (-415.890) [-416.595] (-414.984) (-418.473) * (-423.770) [-414.139] (-428.151) (-443.190) -- 0:00:39
Average standard deviation of split frequencies: 0.048954
25500 -- (-414.928) [-415.391] (-417.216) (-419.951) * [-422.376] (-414.089) (-443.889) (-436.222) -- 0:00:38
26000 -- (-415.218) (-413.581) (-417.719) [-416.189] * (-428.990) [-415.423] (-413.287) (-434.471) -- 0:00:37
26500 -- (-415.842) (-414.726) [-415.722] (-414.890) * (-430.353) [-415.487] (-416.413) (-424.271) -- 0:00:36
27000 -- (-414.112) (-414.124) [-414.404] (-415.571) * (-434.213) [-415.984] (-415.217) (-416.458) -- 0:01:12
27500 -- (-413.359) (-414.608) [-414.067] (-415.895) * [-423.784] (-414.181) (-413.493) (-415.209) -- 0:01:10
28000 -- [-414.540] (-413.682) (-414.399) (-415.453) * (-426.352) (-417.144) (-415.211) [-414.817] -- 0:01:09
28500 -- [-413.413] (-416.604) (-413.629) (-413.542) * (-420.977) [-417.062] (-413.565) (-413.720) -- 0:01:08
29000 -- [-413.102] (-415.431) (-414.991) (-415.559) * (-426.785) [-414.285] (-414.843) (-417.758) -- 0:01:06
29500 -- (-413.788) (-421.831) [-417.804] (-414.615) * (-432.441) (-414.786) (-415.228) [-416.410] -- 0:01:05
30000 -- (-415.627) (-420.619) (-414.267) [-413.504] * (-427.870) [-414.791] (-414.841) (-416.448) -- 0:01:04
Average standard deviation of split frequencies: 0.055824
30500 -- (-414.937) (-414.703) [-414.510] (-414.749) * (-420.660) (-415.201) [-414.863] (-416.837) -- 0:01:03
31000 -- [-414.592] (-415.443) (-414.474) (-414.605) * [-423.887] (-414.955) (-415.959) (-418.687) -- 0:01:02
31500 -- (-414.660) (-420.080) (-415.927) [-416.478] * (-429.324) [-415.500] (-415.518) (-417.473) -- 0:01:01
32000 -- (-413.333) (-416.415) (-417.174) [-413.737] * (-433.270) [-415.499] (-415.845) (-415.270) -- 0:01:00
32500 -- [-417.892] (-415.626) (-416.234) (-415.746) * (-429.751) (-414.616) [-416.437] (-413.541) -- 0:00:59
33000 -- (-415.525) (-415.012) (-413.475) [-413.905] * (-429.467) (-420.659) [-416.384] (-414.450) -- 0:00:58
33500 -- (-415.430) (-415.650) [-414.223] (-416.268) * (-414.420) [-413.734] (-414.357) (-414.533) -- 0:00:57
34000 -- (-414.294) [-416.306] (-419.089) (-418.702) * (-419.587) (-416.876) [-414.448] (-417.251) -- 0:00:56
34500 -- (-417.082) (-417.577) (-417.761) [-414.145] * (-413.897) (-415.466) [-416.029] (-413.825) -- 0:00:55
35000 -- (-413.459) (-417.974) (-415.350) [-416.993] * (-414.291) [-413.678] (-414.603) (-413.639) -- 0:00:55
Average standard deviation of split frequencies: 0.049622
35500 -- (-415.176) [-418.087] (-414.469) (-412.804) * [-416.824] (-415.170) (-414.741) (-413.585) -- 0:00:54
36000 -- [-415.842] (-415.019) (-415.963) (-414.244) * (-415.483) [-415.087] (-418.158) (-415.228) -- 0:00:53
36500 -- (-414.324) (-415.268) [-414.871] (-415.489) * (-416.971) (-416.317) (-424.493) [-414.250] -- 0:00:52
37000 -- (-414.629) (-416.781) [-415.945] (-414.231) * (-414.766) (-415.054) (-421.131) [-414.517] -- 0:00:52
37500 -- (-414.262) [-416.448] (-415.886) (-413.626) * (-414.022) (-414.942) [-416.209] (-414.367) -- 0:00:51
38000 -- (-418.431) (-416.841) [-416.652] (-414.688) * [-413.836] (-416.304) (-415.208) (-415.710) -- 0:00:50
38500 -- (-416.743) (-417.580) (-414.469) [-413.386] * (-415.416) (-416.407) (-414.419) [-413.635] -- 0:00:49
39000 -- [-416.900] (-416.108) (-415.320) (-417.191) * (-415.140) (-417.551) [-414.146] (-414.736) -- 0:00:49
39500 -- (-415.718) [-416.926] (-417.057) (-418.710) * [-415.856] (-415.347) (-414.438) (-414.808) -- 0:00:48
40000 -- (-414.037) [-416.749] (-414.591) (-418.997) * (-415.350) (-413.937) (-415.999) [-419.796] -- 0:00:48
Average standard deviation of split frequencies: 0.042152
40500 -- (-416.674) (-414.316) [-413.896] (-416.949) * [-414.430] (-414.531) (-415.322) (-421.211) -- 0:00:47
41000 -- (-414.677) [-416.180] (-413.273) (-414.600) * (-422.300) [-415.582] (-418.606) (-416.238) -- 0:00:46
41500 -- (-414.778) (-416.982) (-415.996) [-414.777] * (-414.432) [-414.095] (-416.558) (-415.281) -- 0:00:46
42000 -- (-414.341) (-418.506) (-414.469) [-413.883] * [-414.352] (-416.348) (-415.583) (-414.696) -- 0:00:45
42500 -- (-415.979) (-417.763) (-413.589) [-413.768] * [-416.670] (-419.519) (-413.369) (-413.224) -- 0:00:45
43000 -- (-415.923) [-414.640] (-414.182) (-417.726) * (-414.497) (-418.465) (-414.002) [-415.829] -- 0:00:44
43500 -- (-413.309) [-414.950] (-414.214) (-413.244) * (-414.666) [-415.239] (-415.591) (-414.394) -- 0:00:43
44000 -- (-414.121) (-413.462) (-414.104) [-415.380] * (-414.469) (-416.402) (-412.999) [-413.018] -- 0:01:05
44500 -- (-416.374) (-417.073) (-416.286) [-413.823] * (-416.091) [-413.698] (-413.801) (-413.634) -- 0:01:04
45000 -- (-419.959) [-414.599] (-413.995) (-413.848) * (-420.670) [-415.424] (-418.084) (-417.391) -- 0:01:03
Average standard deviation of split frequencies: 0.031189
45500 -- (-416.202) (-413.306) [-413.366] (-416.050) * (-416.778) (-416.543) [-415.265] (-417.172) -- 0:01:02
46000 -- (-416.095) [-415.335] (-418.228) (-418.055) * (-418.142) (-413.584) [-414.071] (-416.575) -- 0:01:02
46500 -- (-417.005) (-414.404) (-413.338) [-416.119] * (-414.653) (-414.471) (-416.033) [-413.852] -- 0:01:01
47000 -- (-415.715) (-414.289) [-414.052] (-420.245) * (-415.285) (-413.898) [-413.851] (-413.539) -- 0:01:00
47500 -- (-413.000) (-416.792) [-414.255] (-417.106) * (-415.672) [-413.826] (-413.581) (-417.699) -- 0:01:00
48000 -- (-414.841) [-422.302] (-414.738) (-418.292) * (-414.673) (-414.844) [-414.281] (-414.843) -- 0:00:59
48500 -- (-414.315) (-414.842) [-417.652] (-416.813) * (-413.377) [-418.503] (-415.439) (-414.572) -- 0:00:58
49000 -- [-415.314] (-415.093) (-414.782) (-416.752) * (-414.876) (-415.433) (-414.192) [-413.378] -- 0:00:58
49500 -- (-414.713) [-414.667] (-413.765) (-416.397) * [-413.804] (-415.559) (-413.614) (-413.913) -- 0:00:57
50000 -- [-415.082] (-414.808) (-414.569) (-416.428) * (-415.014) (-415.705) (-416.368) [-415.738] -- 0:00:57
Average standard deviation of split frequencies: 0.030872
50500 -- (-415.279) (-415.930) (-415.201) [-414.133] * (-415.000) (-416.075) [-414.285] (-413.319) -- 0:00:56
51000 -- [-413.923] (-414.160) (-416.246) (-414.143) * (-418.434) (-414.862) (-413.957) [-414.618] -- 0:00:55
51500 -- [-415.833] (-413.438) (-415.367) (-412.971) * (-414.211) (-414.846) [-415.732] (-416.873) -- 0:00:55
52000 -- (-413.903) (-413.912) (-414.877) [-416.847] * [-416.080] (-414.900) (-414.007) (-413.836) -- 0:00:54
52500 -- (-415.072) (-419.402) [-415.378] (-413.465) * (-415.018) (-418.260) [-415.863] (-414.668) -- 0:00:54
53000 -- [-415.344] (-413.187) (-414.567) (-416.994) * (-416.463) (-414.664) (-414.341) [-415.739] -- 0:00:53
53500 -- (-415.198) (-412.957) [-413.996] (-415.116) * (-419.221) (-416.102) (-414.507) [-416.661] -- 0:00:53
54000 -- (-414.552) (-414.478) [-415.213] (-416.836) * (-413.713) (-414.196) (-418.008) [-413.964] -- 0:00:52
54500 -- (-413.525) (-415.563) (-419.004) [-414.825] * (-417.598) (-413.773) [-414.331] (-414.393) -- 0:00:52
55000 -- (-414.221) (-414.900) (-416.645) [-413.933] * (-417.254) (-414.896) [-416.025] (-416.693) -- 0:00:51
Average standard deviation of split frequencies: 0.040219
55500 -- [-413.834] (-416.078) (-415.596) (-413.816) * [-414.755] (-415.535) (-419.422) (-418.992) -- 0:00:51
56000 -- (-417.170) [-415.594] (-414.905) (-414.089) * (-415.758) (-414.102) (-413.683) [-414.356] -- 0:00:50
56500 -- (-416.737) (-417.860) [-413.339] (-419.854) * (-414.860) (-414.535) (-414.055) [-419.199] -- 0:00:50
57000 -- [-413.647] (-416.206) (-416.632) (-416.625) * (-414.993) (-414.981) (-413.163) [-416.232] -- 0:00:49
57500 -- (-414.133) (-415.028) [-417.892] (-416.476) * (-412.974) [-414.103] (-413.459) (-417.188) -- 0:00:49
58000 -- (-418.175) (-418.721) [-413.638] (-420.435) * (-417.938) (-413.682) (-416.060) [-415.039] -- 0:00:48
58500 -- (-414.611) (-417.237) (-417.492) [-416.784] * (-417.445) [-416.809] (-414.100) (-420.083) -- 0:00:48
59000 -- [-414.707] (-419.805) (-415.159) (-415.294) * (-415.399) (-418.179) (-418.346) [-413.651] -- 0:00:47
59500 -- [-416.874] (-418.109) (-418.558) (-416.145) * (-416.345) (-416.706) [-418.737] (-418.574) -- 0:00:47
60000 -- [-413.071] (-414.550) (-418.874) (-414.240) * (-413.793) [-416.457] (-418.244) (-415.473) -- 0:00:47
Average standard deviation of split frequencies: 0.032309
60500 -- (-413.445) (-414.524) (-414.088) [-414.603] * (-413.865) (-413.670) [-415.593] (-416.577) -- 0:01:02
61000 -- (-413.573) (-417.220) (-414.987) [-414.399] * (-416.055) [-413.236] (-414.473) (-413.621) -- 0:01:01
61500 -- [-415.686] (-417.605) (-413.140) (-415.330) * (-414.940) [-413.580] (-414.278) (-416.334) -- 0:01:01
62000 -- (-415.071) (-414.359) (-413.691) [-413.919] * (-415.185) (-414.808) (-415.096) [-422.013] -- 0:01:00
62500 -- (-413.972) (-415.226) [-415.015] (-415.871) * [-414.516] (-416.689) (-414.521) (-420.812) -- 0:01:00
63000 -- [-414.064] (-416.062) (-414.003) (-417.742) * (-417.980) [-414.765] (-418.166) (-415.967) -- 0:00:59
63500 -- (-413.943) (-414.210) [-413.880] (-415.574) * (-417.030) (-413.512) (-418.384) [-416.560] -- 0:00:58
64000 -- (-415.573) (-418.087) (-417.579) [-414.922] * (-415.293) [-414.339] (-413.384) (-421.123) -- 0:00:58
64500 -- (-414.741) (-415.471) (-419.280) [-415.990] * (-416.332) (-415.151) (-413.712) [-416.386] -- 0:00:58
65000 -- (-413.660) [-413.766] (-414.268) (-416.106) * (-414.741) [-415.150] (-415.101) (-415.494) -- 0:00:57
Average standard deviation of split frequencies: 0.029284
65500 -- (-413.729) (-415.857) [-416.613] (-418.211) * (-415.498) (-413.689) [-415.009] (-416.682) -- 0:00:57
66000 -- (-413.548) (-416.881) [-414.121] (-415.947) * (-414.906) [-415.138] (-413.941) (-413.789) -- 0:00:56
66500 -- (-413.841) (-418.658) (-414.387) [-414.955] * (-414.957) (-414.306) (-420.325) [-413.917] -- 0:00:56
67000 -- [-413.419] (-414.718) (-414.706) (-414.078) * (-414.331) (-414.576) (-417.797) [-413.509] -- 0:00:55
67500 -- (-415.582) (-414.431) (-416.329) [-413.343] * (-413.642) [-418.294] (-415.660) (-414.997) -- 0:00:55
68000 -- [-416.025] (-415.755) (-416.034) (-418.352) * (-415.772) (-414.720) (-419.326) [-414.205] -- 0:00:54
68500 -- (-413.804) (-417.008) [-416.553] (-414.794) * (-416.006) [-415.250] (-417.189) (-416.163) -- 0:00:54
69000 -- [-414.990] (-413.788) (-413.789) (-415.601) * (-414.492) (-416.078) [-415.038] (-416.097) -- 0:00:53
69500 -- [-413.131] (-414.528) (-413.160) (-413.121) * (-414.419) (-416.025) (-417.976) [-417.804] -- 0:00:53
70000 -- [-414.478] (-417.105) (-413.299) (-417.033) * (-414.958) [-413.930] (-413.710) (-420.545) -- 0:00:53
Average standard deviation of split frequencies: 0.027350
70500 -- (-414.268) [-420.297] (-413.193) (-414.656) * (-417.235) [-414.591] (-414.752) (-414.829) -- 0:00:52
71000 -- (-418.260) (-413.985) [-414.520] (-415.117) * (-417.356) (-414.231) (-414.580) [-414.355] -- 0:00:52
71500 -- [-415.637] (-413.347) (-414.556) (-417.381) * (-418.024) (-415.430) [-415.720] (-414.065) -- 0:00:51
72000 -- (-414.689) [-414.652] (-414.411) (-416.074) * [-415.992] (-414.964) (-414.545) (-416.711) -- 0:00:51
72500 -- (-418.614) [-413.885] (-414.359) (-416.789) * (-414.363) [-414.394] (-416.697) (-416.904) -- 0:00:51
73000 -- (-415.225) (-415.692) (-414.446) [-414.439] * (-415.521) [-415.968] (-414.960) (-415.330) -- 0:00:50
73500 -- [-416.294] (-417.790) (-415.696) (-418.393) * (-414.415) (-414.385) [-416.102] (-416.672) -- 0:00:50
74000 -- [-415.102] (-414.723) (-418.500) (-413.116) * [-414.994] (-414.794) (-414.329) (-415.968) -- 0:00:50
74500 -- (-413.551) (-415.757) (-416.810) [-414.602] * (-414.425) [-415.671] (-414.304) (-419.223) -- 0:00:49
75000 -- (-415.883) [-414.405] (-415.109) (-415.309) * (-416.106) (-417.995) (-415.788) [-414.598] -- 0:00:49
Average standard deviation of split frequencies: 0.027764
75500 -- [-414.110] (-419.645) (-414.426) (-414.420) * (-417.826) (-418.842) [-414.035] (-414.335) -- 0:00:48
76000 -- (-413.251) (-416.248) [-413.103] (-414.842) * (-415.184) [-416.381] (-416.790) (-415.484) -- 0:00:48
76500 -- [-414.959] (-414.929) (-414.219) (-413.839) * (-415.761) [-417.290] (-413.666) (-414.190) -- 0:00:48
77000 -- (-415.164) (-415.267) [-414.325] (-415.065) * (-413.077) [-415.556] (-415.896) (-417.063) -- 0:00:47
77500 -- (-414.116) [-414.383] (-415.051) (-414.050) * (-414.434) (-413.364) [-415.323] (-413.436) -- 0:00:59
78000 -- (-415.728) (-416.592) (-415.198) [-413.241] * [-417.835] (-419.146) (-413.509) (-414.456) -- 0:00:59
78500 -- (-416.180) (-417.510) [-415.149] (-413.347) * (-418.743) [-415.608] (-415.126) (-415.669) -- 0:00:58
79000 -- [-417.459] (-417.709) (-413.738) (-414.607) * (-419.218) (-413.705) [-413.265] (-413.689) -- 0:00:58
79500 -- [-414.339] (-417.514) (-416.458) (-413.431) * (-417.427) (-415.893) [-420.354] (-413.591) -- 0:00:57
80000 -- (-415.759) (-415.634) [-416.186] (-417.258) * (-415.080) (-414.602) (-413.950) [-414.488] -- 0:00:57
Average standard deviation of split frequencies: 0.024606
80500 -- (-416.068) (-415.340) (-415.784) [-416.433] * (-415.445) [-414.808] (-414.191) (-414.204) -- 0:00:57
81000 -- (-416.597) (-417.233) [-414.032] (-416.647) * (-413.425) (-414.255) (-413.532) [-413.200] -- 0:00:56
81500 -- (-413.784) (-420.676) [-414.615] (-415.889) * (-413.334) [-416.631] (-414.144) (-415.266) -- 0:00:56
82000 -- (-414.375) [-416.057] (-416.296) (-414.945) * (-416.928) (-417.573) (-414.723) [-414.750] -- 0:00:55
82500 -- (-417.624) (-419.761) (-416.380) [-413.009] * (-413.354) [-416.427] (-413.855) (-418.147) -- 0:00:55
83000 -- (-415.613) (-419.460) [-416.088] (-414.311) * (-416.877) (-417.683) [-413.559] (-415.334) -- 0:00:55
83500 -- (-415.750) (-419.940) (-415.145) [-415.577] * (-417.531) (-415.507) (-413.914) [-415.306] -- 0:00:54
84000 -- [-414.859] (-413.849) (-415.870) (-415.826) * (-420.652) (-415.976) (-417.068) [-413.326] -- 0:00:54
84500 -- [-415.087] (-415.959) (-416.443) (-418.367) * (-415.910) (-413.572) (-415.437) [-413.421] -- 0:00:54
85000 -- (-414.525) (-414.198) [-414.947] (-416.114) * (-414.883) (-415.667) (-415.134) [-413.497] -- 0:00:53
Average standard deviation of split frequencies: 0.026830
85500 -- [-414.933] (-415.131) (-413.907) (-415.477) * (-415.258) (-417.010) (-415.983) [-413.733] -- 0:00:53
86000 -- (-415.498) (-417.192) [-414.906] (-414.967) * (-413.245) (-413.205) [-413.877] (-417.854) -- 0:00:53
86500 -- (-414.676) (-416.465) (-413.707) [-414.640] * (-413.333) (-413.981) (-414.573) [-418.655] -- 0:00:52
87000 -- [-416.231] (-414.152) (-414.952) (-415.584) * (-413.414) (-415.340) [-416.008] (-415.571) -- 0:00:52
87500 -- (-413.689) [-416.262] (-416.105) (-415.445) * (-414.260) [-414.195] (-415.507) (-416.370) -- 0:00:52
88000 -- [-413.523] (-414.188) (-414.495) (-415.332) * (-413.789) (-416.649) (-414.009) [-415.668] -- 0:00:51
88500 -- (-414.943) (-414.234) [-415.086] (-419.547) * (-413.415) [-414.234] (-420.678) (-421.405) -- 0:00:51
89000 -- (-418.899) (-413.573) [-415.958] (-415.396) * (-416.160) [-419.125] (-416.200) (-417.606) -- 0:00:51
89500 -- [-413.826] (-414.848) (-416.930) (-416.040) * (-414.929) (-417.244) [-415.037] (-413.523) -- 0:00:50
90000 -- (-414.157) [-413.931] (-414.967) (-414.982) * (-414.987) [-417.180] (-419.426) (-417.022) -- 0:00:50
Average standard deviation of split frequencies: 0.024697
90500 -- [-413.843] (-417.993) (-413.344) (-413.734) * [-415.518] (-417.064) (-418.038) (-415.070) -- 0:00:50
91000 -- (-413.399) (-417.520) [-416.202] (-414.229) * [-415.201] (-416.674) (-416.431) (-417.858) -- 0:00:49
91500 -- [-414.510] (-414.133) (-415.799) (-417.502) * (-416.334) (-414.498) (-416.126) [-416.745] -- 0:00:49
92000 -- (-416.642) (-415.937) [-414.434] (-415.064) * (-415.048) (-416.260) (-416.214) [-414.350] -- 0:00:49
92500 -- [-415.320] (-416.275) (-413.665) (-415.014) * (-416.916) (-413.409) (-414.233) [-413.355] -- 0:00:49
93000 -- (-417.082) [-417.372] (-413.477) (-414.387) * (-416.123) (-415.152) [-416.501] (-417.005) -- 0:00:48
93500 -- (-416.813) (-416.548) (-413.307) [-413.483] * (-413.891) (-414.176) (-416.807) [-412.985] -- 0:00:48
94000 -- (-416.117) [-415.165] (-414.295) (-418.447) * (-416.490) (-413.509) [-414.442] (-414.765) -- 0:00:48
94500 -- (-416.933) (-416.615) [-415.446] (-413.831) * (-416.083) [-413.021] (-415.108) (-414.853) -- 0:00:57
95000 -- (-415.117) (-414.089) (-414.531) [-414.147] * (-413.347) [-414.085] (-418.795) (-415.485) -- 0:00:57
Average standard deviation of split frequencies: 0.027137
95500 -- (-416.843) (-413.763) (-414.195) [-413.574] * (-414.005) [-413.611] (-417.442) (-415.424) -- 0:00:56
96000 -- (-413.910) (-414.320) (-420.066) [-413.671] * [-413.573] (-414.929) (-418.019) (-414.963) -- 0:00:56
96500 -- (-414.361) (-414.753) (-415.954) [-415.948] * (-414.331) [-415.155] (-419.616) (-416.809) -- 0:00:56
97000 -- [-414.804] (-416.425) (-414.642) (-417.123) * (-414.388) [-414.624] (-414.472) (-419.533) -- 0:00:55
97500 -- (-417.392) [-414.571] (-415.433) (-418.364) * (-419.099) (-418.587) [-415.922] (-414.306) -- 0:00:55
98000 -- (-415.152) (-417.157) [-415.597] (-416.811) * (-415.366) (-415.053) (-415.483) [-416.497] -- 0:00:55
98500 -- [-414.737] (-417.052) (-418.858) (-414.438) * (-415.059) [-415.545] (-418.181) (-414.884) -- 0:00:54
99000 -- [-413.537] (-415.118) (-414.008) (-413.423) * (-414.102) (-413.475) (-414.268) [-415.249] -- 0:00:54
99500 -- [-413.305] (-418.884) (-417.422) (-415.242) * (-414.956) (-415.524) [-414.591] (-415.775) -- 0:00:54
100000 -- (-415.669) (-419.441) [-415.250] (-413.764) * [-413.469] (-413.308) (-416.179) (-417.923) -- 0:00:54
Average standard deviation of split frequencies: 0.026125
100500 -- (-414.905) [-417.369] (-414.522) (-415.922) * (-413.568) [-413.518] (-413.113) (-414.403) -- 0:00:53
101000 -- (-413.916) [-414.159] (-416.397) (-413.299) * [-415.167] (-414.296) (-418.709) (-414.484) -- 0:00:53
101500 -- [-414.322] (-415.960) (-418.161) (-415.925) * (-413.688) [-416.570] (-417.088) (-414.651) -- 0:00:53
102000 -- (-414.796) (-416.497) [-415.755] (-414.739) * (-417.512) (-416.298) [-419.395] (-413.529) -- 0:00:52
102500 -- (-413.370) (-418.771) [-414.563] (-417.649) * [-415.358] (-416.269) (-418.011) (-414.730) -- 0:00:52
103000 -- [-413.462] (-416.378) (-415.627) (-415.380) * [-414.303] (-416.068) (-417.757) (-414.538) -- 0:00:52
103500 -- (-413.046) [-416.476] (-416.221) (-413.911) * (-414.403) (-415.624) [-415.380] (-417.759) -- 0:00:51
104000 -- (-417.816) [-414.501] (-414.714) (-414.384) * (-415.838) (-415.487) (-416.471) [-417.339] -- 0:00:51
104500 -- (-414.685) (-413.835) (-415.612) [-417.520] * (-417.529) (-416.267) (-415.922) [-418.033] -- 0:00:51
105000 -- [-415.504] (-420.485) (-415.171) (-414.464) * (-419.153) [-414.619] (-415.718) (-416.025) -- 0:00:51
Average standard deviation of split frequencies: 0.026260
105500 -- (-414.610) (-413.631) [-417.026] (-414.715) * (-415.518) (-414.529) [-414.255] (-414.072) -- 0:00:50
106000 -- (-418.911) (-414.477) [-415.088] (-418.507) * [-414.108] (-414.461) (-415.359) (-417.401) -- 0:00:50
106500 -- (-416.039) (-415.245) [-413.266] (-417.643) * (-415.563) (-414.657) (-414.723) [-413.591] -- 0:00:50
107000 -- (-413.867) [-417.111] (-413.734) (-415.130) * (-414.612) [-415.195] (-413.271) (-415.567) -- 0:00:50
107500 -- (-414.710) (-413.358) [-413.835] (-416.433) * (-414.090) (-416.018) (-413.637) [-417.891] -- 0:00:49
108000 -- (-417.672) (-413.167) (-415.377) [-416.753] * (-415.009) (-415.110) [-416.655] (-415.252) -- 0:00:49
108500 -- (-420.515) [-413.493] (-416.196) (-416.380) * (-413.353) (-420.077) [-417.192] (-413.908) -- 0:00:49
109000 -- (-417.013) (-412.815) [-414.136] (-417.782) * (-413.983) (-414.976) [-414.382] (-415.170) -- 0:00:49
109500 -- [-418.754] (-413.772) (-416.304) (-417.591) * [-414.346] (-415.123) (-415.212) (-416.929) -- 0:00:48
110000 -- (-418.724) [-413.921] (-415.824) (-416.280) * [-413.419] (-414.001) (-418.418) (-415.449) -- 0:00:48
Average standard deviation of split frequencies: 0.027901
110500 -- [-415.110] (-423.718) (-417.256) (-417.624) * [-413.796] (-417.155) (-414.304) (-413.734) -- 0:00:48
111000 -- [-412.837] (-421.212) (-413.674) (-416.956) * (-417.090) (-417.881) (-413.302) [-413.815] -- 0:00:56
111500 -- (-414.662) (-414.620) [-415.223] (-415.984) * [-413.933] (-414.666) (-413.425) (-417.831) -- 0:00:55
112000 -- (-413.195) (-418.533) (-416.307) [-417.771] * (-416.559) [-415.493] (-416.063) (-418.596) -- 0:00:55
112500 -- [-413.162] (-413.567) (-416.543) (-415.731) * (-414.351) (-415.534) [-414.693] (-418.128) -- 0:00:55
113000 -- (-414.581) (-416.809) (-417.028) [-413.971] * (-414.705) (-414.681) (-420.032) [-416.482] -- 0:00:54
113500 -- (-416.551) (-413.724) (-415.444) [-414.790] * (-413.776) (-413.669) (-416.674) [-416.456] -- 0:00:54
114000 -- (-414.315) (-414.950) [-414.430] (-413.537) * [-414.425] (-417.025) (-414.119) (-417.643) -- 0:00:54
114500 -- [-417.127] (-413.409) (-414.501) (-417.737) * (-414.732) (-416.426) (-414.259) [-419.324] -- 0:00:54
115000 -- (-417.725) (-413.884) (-415.132) [-416.128] * [-417.350] (-413.699) (-414.572) (-424.790) -- 0:00:53
Average standard deviation of split frequencies: 0.025602
115500 -- [-415.361] (-415.052) (-415.202) (-414.577) * (-413.835) (-418.876) [-416.110] (-417.977) -- 0:00:53
116000 -- (-414.144) (-414.739) [-414.396] (-415.173) * [-413.722] (-413.232) (-413.765) (-416.440) -- 0:00:53
116500 -- (-420.512) (-414.518) [-413.796] (-417.513) * [-415.486] (-414.738) (-415.088) (-417.277) -- 0:00:53
117000 -- (-418.490) (-415.840) [-415.448] (-418.747) * (-417.380) (-416.989) (-414.307) [-417.492] -- 0:00:52
117500 -- (-416.113) [-413.317] (-415.613) (-418.308) * (-419.973) (-416.299) [-415.163] (-421.309) -- 0:00:52
118000 -- (-414.890) [-413.879] (-416.366) (-413.377) * (-414.805) [-416.088] (-415.511) (-423.694) -- 0:00:52
118500 -- (-415.675) [-413.810] (-413.633) (-417.092) * (-414.596) (-417.945) (-417.194) [-419.052] -- 0:00:52
119000 -- (-416.566) (-415.478) (-414.276) [-418.424] * (-414.474) [-418.411] (-414.606) (-417.914) -- 0:00:51
119500 -- [-415.113] (-415.170) (-416.431) (-420.353) * (-418.365) (-414.303) [-415.951] (-422.197) -- 0:00:51
120000 -- (-414.475) (-416.050) [-415.113] (-420.335) * (-415.422) (-413.991) [-416.501] (-413.893) -- 0:00:51
Average standard deviation of split frequencies: 0.023234
120500 -- (-415.404) (-415.362) [-414.869] (-414.247) * [-415.018] (-413.699) (-420.603) (-416.403) -- 0:00:51
121000 -- (-415.773) (-416.024) (-414.672) [-415.882] * [-414.725] (-415.686) (-416.914) (-414.874) -- 0:00:50
121500 -- [-416.915] (-417.801) (-413.653) (-415.115) * (-414.863) [-413.938] (-416.253) (-414.320) -- 0:00:50
122000 -- (-417.132) (-415.514) [-414.809] (-416.722) * (-414.790) (-413.571) [-414.557] (-417.804) -- 0:00:50
122500 -- (-419.077) (-413.260) [-415.627] (-417.354) * (-417.573) (-416.228) [-416.921] (-415.037) -- 0:00:50
123000 -- (-415.574) [-418.010] (-416.111) (-419.959) * (-414.834) (-415.187) [-415.868] (-420.741) -- 0:00:49
123500 -- (-415.183) (-420.842) [-415.320] (-417.663) * (-416.302) (-415.927) [-415.191] (-419.016) -- 0:00:49
124000 -- (-413.257) (-415.112) [-413.690] (-415.078) * (-415.637) (-416.604) (-414.551) [-418.787] -- 0:00:49
124500 -- [-413.279] (-413.778) (-413.059) (-413.997) * (-415.181) (-415.140) (-416.168) [-420.141] -- 0:00:49
125000 -- [-416.142] (-415.970) (-419.035) (-415.809) * (-417.326) (-414.441) (-414.689) [-416.485] -- 0:00:49
Average standard deviation of split frequencies: 0.021463
125500 -- (-418.740) [-415.493] (-414.755) (-415.372) * (-417.942) (-413.133) [-413.309] (-417.072) -- 0:00:48
126000 -- (-413.444) [-414.446] (-415.738) (-417.196) * (-414.162) [-419.913] (-415.004) (-415.926) -- 0:00:48
126500 -- (-413.956) [-413.922] (-414.908) (-418.405) * (-416.269) (-422.127) [-413.747] (-416.110) -- 0:00:48
127000 -- (-414.536) [-414.420] (-422.768) (-414.302) * (-415.249) (-413.752) [-414.795] (-416.202) -- 0:00:48
127500 -- (-413.782) (-415.046) (-416.757) [-416.697] * (-418.214) (-413.732) (-416.823) [-414.777] -- 0:00:47
128000 -- [-417.350] (-413.616) (-414.741) (-413.641) * [-416.708] (-415.092) (-415.879) (-417.361) -- 0:00:54
128500 -- (-415.171) (-414.346) (-414.906) [-416.396] * (-418.787) (-416.264) [-414.041] (-413.920) -- 0:00:54
129000 -- (-418.042) (-414.004) [-413.320] (-413.621) * (-416.237) (-419.519) [-416.309] (-416.093) -- 0:00:54
129500 -- (-419.357) (-413.201) [-416.648] (-413.742) * [-415.285] (-414.425) (-414.316) (-413.488) -- 0:00:53
130000 -- (-415.425) (-414.342) [-414.681] (-415.641) * (-415.922) (-415.869) (-415.423) [-414.526] -- 0:00:53
Average standard deviation of split frequencies: 0.021266
130500 -- (-415.182) [-416.773] (-418.853) (-415.096) * (-417.376) (-415.330) (-413.700) [-419.759] -- 0:00:53
131000 -- (-414.924) [-413.168] (-417.227) (-413.301) * [-415.544] (-415.521) (-413.536) (-415.150) -- 0:00:53
131500 -- (-418.151) (-417.455) [-417.964] (-413.667) * (-415.959) (-414.587) (-413.578) [-415.417] -- 0:00:52
132000 -- (-418.277) (-420.721) [-415.059] (-416.643) * [-417.561] (-419.691) (-416.155) (-419.081) -- 0:00:52
132500 -- (-416.700) (-415.873) [-413.459] (-415.660) * (-414.644) (-414.889) [-413.342] (-415.908) -- 0:00:52
133000 -- (-415.965) [-414.418] (-415.083) (-415.059) * (-415.315) [-417.811] (-415.289) (-414.358) -- 0:00:52
133500 -- (-420.291) [-414.579] (-416.504) (-414.312) * (-414.570) (-415.036) (-415.115) [-416.387] -- 0:00:51
134000 -- [-414.003] (-416.134) (-414.092) (-414.805) * (-415.297) [-414.645] (-414.619) (-414.972) -- 0:00:51
134500 -- [-417.787] (-417.847) (-414.412) (-414.802) * (-415.838) (-415.253) (-414.201) [-417.353] -- 0:00:51
135000 -- (-417.945) [-420.613] (-414.333) (-414.571) * (-415.578) (-414.955) (-413.576) [-415.345] -- 0:00:51
Average standard deviation of split frequencies: 0.020980
135500 -- [-413.863] (-414.797) (-419.495) (-414.250) * [-414.448] (-416.988) (-413.162) (-418.819) -- 0:00:51
136000 -- [-414.296] (-413.776) (-413.425) (-413.861) * [-415.116] (-417.147) (-417.186) (-418.306) -- 0:00:50
136500 -- (-419.742) (-414.408) [-413.353] (-413.581) * (-414.616) [-413.902] (-413.399) (-413.939) -- 0:00:50
137000 -- (-414.893) (-414.881) (-414.623) [-413.744] * (-417.060) (-415.960) [-413.914] (-415.540) -- 0:00:50
137500 -- (-413.997) (-418.542) (-414.057) [-414.846] * [-417.198] (-415.205) (-417.583) (-418.906) -- 0:00:50
138000 -- (-414.075) (-414.032) [-413.662] (-414.878) * [-419.049] (-414.117) (-414.422) (-413.709) -- 0:00:49
138500 -- (-415.868) (-415.400) [-412.908] (-417.418) * [-414.565] (-414.963) (-417.911) (-414.978) -- 0:00:49
139000 -- (-413.689) (-415.109) [-413.177] (-417.321) * [-414.400] (-420.419) (-418.037) (-413.137) -- 0:00:49
139500 -- (-414.827) (-418.886) (-415.015) [-416.326] * (-413.975) (-416.599) (-415.312) [-413.365] -- 0:00:49
140000 -- (-416.743) [-413.261] (-414.254) (-413.988) * (-415.473) (-415.101) [-414.238] (-413.643) -- 0:00:49
Average standard deviation of split frequencies: 0.018873
140500 -- (-416.190) (-415.249) (-416.665) [-418.084] * [-414.035] (-413.983) (-420.369) (-414.841) -- 0:00:48
141000 -- (-414.027) (-413.337) [-417.221] (-420.195) * (-414.754) (-413.452) (-414.078) [-415.069] -- 0:00:48
141500 -- [-414.410] (-413.529) (-415.446) (-415.056) * [-414.644] (-414.738) (-413.875) (-415.166) -- 0:00:48
142000 -- (-415.894) (-415.677) (-416.631) [-415.778] * [-415.472] (-415.390) (-416.218) (-419.461) -- 0:00:48
142500 -- [-417.164] (-415.248) (-420.031) (-417.081) * (-415.022) [-414.265] (-413.445) (-416.747) -- 0:00:48
143000 -- [-414.533] (-416.303) (-418.149) (-422.328) * (-416.110) (-413.596) [-413.756] (-414.273) -- 0:00:47
143500 -- (-413.419) [-415.221] (-415.464) (-415.653) * [-418.280] (-415.757) (-414.776) (-414.758) -- 0:00:47
144000 -- (-415.978) (-417.168) (-413.775) [-414.103] * (-416.641) [-413.744] (-416.899) (-415.251) -- 0:00:47
144500 -- (-414.732) (-418.699) (-415.242) [-413.016] * (-415.298) (-413.202) [-415.928] (-416.575) -- 0:00:47
145000 -- (-413.728) [-413.750] (-414.514) (-414.661) * (-414.757) (-414.781) [-415.003] (-414.267) -- 0:00:53
Average standard deviation of split frequencies: 0.019713
145500 -- [-414.944] (-417.153) (-415.819) (-413.386) * [-416.443] (-413.168) (-416.700) (-417.140) -- 0:00:52
146000 -- [-427.677] (-415.806) (-415.960) (-414.386) * [-415.632] (-413.530) (-415.012) (-413.376) -- 0:00:52
146500 -- (-423.576) (-414.500) (-413.892) [-415.085] * (-414.986) (-416.949) [-413.862] (-416.551) -- 0:00:52
147000 -- (-413.547) (-418.085) (-414.468) [-416.285] * [-416.966] (-414.918) (-417.242) (-414.711) -- 0:00:52
147500 -- (-414.839) [-414.425] (-415.402) (-413.274) * (-415.825) [-413.137] (-413.702) (-414.981) -- 0:00:52
148000 -- [-414.301] (-415.980) (-413.252) (-415.097) * (-413.559) (-413.209) (-415.326) [-415.086] -- 0:00:51
148500 -- [-414.170] (-417.305) (-415.948) (-415.155) * (-413.996) (-413.227) [-415.151] (-416.128) -- 0:00:51
149000 -- (-416.711) (-413.648) [-413.594] (-416.191) * (-414.505) [-413.711] (-413.364) (-415.568) -- 0:00:51
149500 -- [-414.560] (-413.116) (-415.437) (-414.505) * (-417.302) (-415.332) [-415.547] (-416.169) -- 0:00:51
150000 -- (-414.500) [-414.518] (-414.652) (-414.738) * (-417.036) (-414.800) [-417.461] (-414.124) -- 0:00:51
Average standard deviation of split frequencies: 0.020255
150500 -- (-415.320) [-415.613] (-416.020) (-416.100) * [-414.229] (-414.962) (-415.482) (-414.025) -- 0:00:50
151000 -- (-414.901) (-417.499) (-415.441) [-415.618] * [-414.258] (-415.579) (-414.167) (-416.351) -- 0:00:50
151500 -- (-414.519) [-415.703] (-416.613) (-419.498) * (-415.884) (-414.103) (-415.282) [-413.703] -- 0:00:50
152000 -- (-415.128) [-415.832] (-415.552) (-420.058) * (-415.596) (-415.193) [-417.753] (-413.656) -- 0:00:50
152500 -- (-413.873) [-414.472] (-413.842) (-417.805) * (-416.759) (-415.515) (-419.267) [-413.070] -- 0:00:50
153000 -- (-413.154) [-413.727] (-414.303) (-418.396) * (-414.288) [-413.227] (-414.705) (-413.869) -- 0:00:49
153500 -- (-414.067) (-413.691) (-417.196) [-416.480] * (-414.501) (-415.792) [-417.933] (-414.662) -- 0:00:49
154000 -- [-415.611] (-414.113) (-417.325) (-417.520) * (-415.050) [-413.724] (-417.556) (-415.146) -- 0:00:49
154500 -- (-417.859) (-414.344) (-413.665) [-415.238] * (-414.803) (-413.882) [-413.615] (-415.867) -- 0:00:49
155000 -- (-414.685) (-413.667) (-418.183) [-415.383] * (-416.266) (-415.512) [-415.078] (-412.819) -- 0:00:49
Average standard deviation of split frequencies: 0.018449
155500 -- (-415.249) (-413.105) (-416.561) [-417.105] * [-415.083] (-413.936) (-415.738) (-415.146) -- 0:00:48
156000 -- (-414.512) (-413.687) [-416.861] (-413.230) * (-418.231) (-418.056) [-414.209] (-416.454) -- 0:00:48
156500 -- (-415.538) (-414.363) (-413.312) [-413.729] * (-416.920) (-416.328) [-413.829] (-414.338) -- 0:00:48
157000 -- (-414.359) [-414.015] (-413.830) (-417.232) * (-414.590) (-417.412) [-414.941] (-416.689) -- 0:00:48
157500 -- (-415.176) (-413.518) [-415.154] (-415.432) * (-416.883) (-414.834) (-416.509) [-418.004] -- 0:00:48
158000 -- [-414.474] (-415.362) (-424.108) (-415.762) * (-415.455) (-414.010) [-415.168] (-417.868) -- 0:00:47
158500 -- (-418.104) [-413.419] (-415.537) (-415.586) * (-416.339) [-414.850] (-417.627) (-415.570) -- 0:00:47
159000 -- (-416.130) (-414.925) (-414.273) [-414.430] * (-415.321) [-419.263] (-417.540) (-414.681) -- 0:00:47
159500 -- [-415.055] (-419.263) (-415.465) (-417.478) * (-415.592) [-415.686] (-417.519) (-413.260) -- 0:00:47
160000 -- [-413.415] (-421.270) (-417.058) (-416.784) * [-418.400] (-415.730) (-415.344) (-414.032) -- 0:00:47
Average standard deviation of split frequencies: 0.018093
160500 -- (-412.986) [-423.975] (-414.663) (-415.942) * [-413.939] (-415.804) (-415.356) (-415.637) -- 0:00:47
161000 -- [-415.663] (-420.426) (-414.597) (-415.174) * (-417.479) [-414.309] (-416.747) (-415.404) -- 0:00:46
161500 -- (-413.562) (-419.388) [-414.668] (-414.572) * (-414.242) (-415.974) [-415.081] (-413.584) -- 0:00:51
162000 -- [-415.133] (-412.902) (-414.559) (-415.316) * (-417.150) [-416.575] (-414.258) (-419.232) -- 0:00:51
162500 -- (-415.218) (-414.744) [-417.290] (-413.386) * (-416.892) (-414.169) [-415.930] (-416.571) -- 0:00:51
163000 -- [-415.484] (-413.410) (-415.545) (-414.413) * (-413.987) (-414.395) [-413.603] (-414.365) -- 0:00:51
163500 -- [-418.256] (-413.420) (-416.698) (-415.110) * (-416.749) (-413.305) (-415.128) [-413.074] -- 0:00:51
164000 -- (-414.986) [-414.567] (-414.220) (-417.026) * (-421.773) [-413.493] (-414.678) (-413.838) -- 0:00:50
164500 -- (-414.301) [-413.534] (-417.612) (-415.278) * (-416.068) (-415.034) (-414.655) [-413.746] -- 0:00:50
165000 -- [-417.629] (-413.321) (-415.247) (-414.744) * (-416.085) (-415.631) [-414.891] (-420.423) -- 0:00:50
Average standard deviation of split frequencies: 0.017196
165500 -- (-419.422) [-415.564] (-417.017) (-416.322) * (-415.512) [-414.440] (-416.224) (-414.387) -- 0:00:50
166000 -- (-416.734) (-415.812) [-413.697] (-416.853) * (-414.039) (-414.149) [-415.906] (-415.665) -- 0:00:50
166500 -- (-416.674) (-416.172) (-414.898) [-414.080] * (-413.743) [-414.771] (-417.048) (-414.538) -- 0:00:50
167000 -- (-417.617) (-418.289) [-414.302] (-413.504) * [-415.865] (-414.477) (-418.022) (-418.330) -- 0:00:49
167500 -- (-415.639) [-414.502] (-417.174) (-416.076) * (-414.044) [-416.976] (-415.405) (-417.075) -- 0:00:49
168000 -- (-414.486) (-415.691) [-416.330] (-415.238) * (-416.153) (-418.902) [-415.944] (-417.041) -- 0:00:49
168500 -- (-415.125) [-415.298] (-415.297) (-413.214) * (-414.467) (-418.537) [-413.829] (-417.428) -- 0:00:49
169000 -- (-420.562) (-417.183) [-414.276] (-420.591) * (-416.798) [-416.328] (-416.396) (-415.226) -- 0:00:49
169500 -- (-415.408) (-415.645) (-415.062) [-415.754] * [-414.361] (-414.016) (-420.758) (-413.389) -- 0:00:48
170000 -- (-416.898) (-416.995) [-414.595] (-415.010) * (-414.604) (-413.672) [-415.040] (-413.833) -- 0:00:48
Average standard deviation of split frequencies: 0.017494
170500 -- [-414.796] (-423.285) (-413.688) (-417.953) * [-413.491] (-414.049) (-415.787) (-413.348) -- 0:00:48
171000 -- (-413.677) (-416.037) [-414.017] (-416.586) * (-413.593) (-415.716) [-416.474] (-414.655) -- 0:00:48
171500 -- (-414.887) (-414.327) [-414.174] (-415.674) * [-414.770] (-417.349) (-416.196) (-414.986) -- 0:00:48
172000 -- [-414.462] (-413.894) (-414.602) (-420.602) * (-418.320) [-413.613] (-416.190) (-416.186) -- 0:00:48
172500 -- [-418.139] (-415.397) (-413.588) (-416.420) * (-413.289) (-417.736) [-417.114] (-414.452) -- 0:00:47
173000 -- [-415.838] (-413.682) (-414.878) (-415.400) * (-415.769) (-418.862) [-413.419] (-420.459) -- 0:00:47
173500 -- [-415.720] (-416.534) (-415.765) (-413.674) * (-415.370) (-416.851) [-414.350] (-419.930) -- 0:00:47
174000 -- [-418.707] (-415.773) (-415.505) (-417.755) * (-415.618) (-414.444) (-413.273) [-415.567] -- 0:00:47
174500 -- (-418.570) [-413.694] (-418.094) (-415.260) * (-415.568) (-414.626) [-420.024] (-414.557) -- 0:00:47
175000 -- [-419.045] (-415.193) (-413.689) (-416.343) * (-413.957) [-415.544] (-414.265) (-415.107) -- 0:00:47
Average standard deviation of split frequencies: 0.016775
175500 -- [-417.932] (-414.357) (-415.562) (-414.173) * (-418.905) (-416.108) [-413.839] (-415.575) -- 0:00:46
176000 -- [-415.350] (-416.989) (-417.450) (-416.010) * (-415.284) (-415.493) (-413.421) [-418.670] -- 0:00:46
176500 -- (-414.484) (-414.595) (-414.372) [-414.159] * (-420.232) [-413.478] (-413.094) (-415.826) -- 0:00:46
177000 -- (-414.137) (-417.502) [-413.918] (-413.897) * (-417.574) [-415.498] (-415.325) (-414.056) -- 0:00:46
177500 -- (-414.972) (-416.220) [-417.773] (-415.209) * [-414.173] (-414.731) (-415.347) (-413.264) -- 0:00:46
178000 -- (-414.300) [-414.229] (-415.329) (-414.138) * (-412.938) (-415.263) [-414.715] (-414.564) -- 0:00:46
178500 -- (-414.561) (-413.665) (-413.871) [-414.126] * (-413.040) (-414.594) (-416.300) [-414.542] -- 0:00:50
179000 -- (-414.959) (-417.307) (-417.002) [-414.173] * [-415.126] (-417.000) (-413.505) (-420.462) -- 0:00:50
179500 -- (-415.762) (-416.985) [-416.132] (-414.764) * [-414.532] (-419.277) (-413.674) (-415.332) -- 0:00:50
180000 -- (-415.490) (-415.551) (-416.140) [-415.269] * (-419.547) (-419.119) (-415.354) [-414.882] -- 0:00:50
Average standard deviation of split frequencies: 0.018410
180500 -- [-414.485] (-418.381) (-415.215) (-413.430) * (-419.547) [-414.212] (-414.483) (-415.789) -- 0:00:49
181000 -- (-414.577) (-414.222) [-414.918] (-413.829) * (-415.335) (-417.088) [-415.833] (-416.746) -- 0:00:49
181500 -- [-413.594] (-415.435) (-415.599) (-415.115) * (-413.726) [-416.946] (-413.575) (-416.362) -- 0:00:49
182000 -- (-414.075) (-416.555) (-415.548) [-413.320] * [-414.460] (-415.626) (-413.801) (-423.779) -- 0:00:49
182500 -- (-418.410) (-416.954) (-421.011) [-416.415] * (-413.318) [-414.378] (-415.757) (-415.428) -- 0:00:49
183000 -- (-417.207) (-419.661) (-413.396) [-416.665] * (-413.153) (-415.612) [-419.426] (-415.577) -- 0:00:49
183500 -- (-414.966) (-422.627) (-413.443) [-415.142] * (-413.193) (-417.003) [-413.930] (-416.646) -- 0:00:48
184000 -- (-416.540) [-414.639] (-418.339) (-416.166) * [-416.631] (-415.731) (-417.726) (-414.620) -- 0:00:48
184500 -- (-416.422) (-417.352) [-413.940] (-415.153) * [-416.066] (-417.393) (-416.617) (-417.630) -- 0:00:48
185000 -- (-415.171) [-416.049] (-416.360) (-414.442) * [-415.998] (-415.390) (-413.727) (-422.445) -- 0:00:48
Average standard deviation of split frequencies: 0.017874
185500 -- (-418.109) [-415.211] (-420.107) (-417.536) * [-416.628] (-418.816) (-422.744) (-415.762) -- 0:00:48
186000 -- (-417.725) (-418.555) (-416.918) [-417.050] * (-415.637) (-415.223) (-414.584) [-416.572] -- 0:00:48
186500 -- (-413.574) (-418.352) [-414.831] (-414.876) * (-416.646) (-415.922) (-413.458) [-414.243] -- 0:00:47
187000 -- (-413.408) (-418.454) (-417.906) [-413.060] * (-416.071) (-413.429) (-415.764) [-415.663] -- 0:00:47
187500 -- (-413.497) [-414.174] (-415.962) (-414.682) * [-415.441] (-414.792) (-414.022) (-419.341) -- 0:00:47
188000 -- (-416.489) [-418.247] (-418.165) (-417.533) * (-416.351) [-414.322] (-416.308) (-416.855) -- 0:00:47
188500 -- (-417.113) [-414.258] (-414.902) (-421.033) * (-414.230) [-413.209] (-414.589) (-415.009) -- 0:00:47
189000 -- (-415.739) (-413.686) [-417.219] (-415.808) * (-415.155) (-415.010) (-417.306) [-413.289] -- 0:00:47
189500 -- [-414.151] (-414.573) (-417.073) (-414.329) * (-413.608) (-414.039) [-413.880] (-415.712) -- 0:00:47
190000 -- (-415.266) [-415.150] (-413.279) (-415.450) * (-415.913) (-415.036) [-417.976] (-415.033) -- 0:00:46
Average standard deviation of split frequencies: 0.017307
190500 -- (-414.886) (-413.887) [-413.391] (-414.753) * (-413.407) (-416.636) [-413.717] (-414.560) -- 0:00:46
191000 -- (-414.813) (-416.278) [-413.744] (-415.744) * (-414.737) (-414.553) (-415.196) [-415.494] -- 0:00:46
191500 -- (-414.314) [-414.552] (-414.957) (-413.205) * (-415.812) [-414.086] (-414.737) (-414.570) -- 0:00:46
192000 -- (-415.149) (-415.323) (-414.707) [-414.239] * [-418.819] (-416.885) (-415.622) (-415.939) -- 0:00:46
192500 -- [-414.272] (-414.707) (-418.177) (-413.394) * (-414.225) [-415.847] (-417.577) (-414.475) -- 0:00:46
193000 -- [-412.895] (-414.356) (-415.584) (-418.123) * (-417.713) [-415.255] (-413.983) (-414.463) -- 0:00:45
193500 -- (-417.908) [-414.527] (-415.538) (-416.592) * (-416.026) (-415.439) (-415.893) [-413.547] -- 0:00:45
194000 -- [-415.204] (-414.610) (-415.863) (-415.676) * (-414.125) (-415.570) [-414.132] (-415.473) -- 0:00:45
194500 -- [-417.367] (-415.236) (-413.530) (-419.178) * (-414.826) (-414.761) [-414.755] (-414.421) -- 0:00:45
195000 -- (-415.491) (-413.800) [-413.928] (-418.220) * [-413.731] (-416.855) (-417.692) (-414.538) -- 0:00:45
Average standard deviation of split frequencies: 0.016969
195500 -- (-414.975) [-414.485] (-414.311) (-417.535) * (-414.164) (-416.709) [-417.030] (-416.843) -- 0:00:49
196000 -- (-415.660) (-416.272) (-413.991) [-414.553] * [-417.232] (-417.618) (-413.843) (-415.648) -- 0:00:49
196500 -- (-414.842) (-413.255) [-417.437] (-416.995) * (-415.790) [-416.309] (-416.976) (-412.939) -- 0:00:49
197000 -- (-415.576) [-413.991] (-415.209) (-414.427) * (-415.241) [-416.542] (-416.728) (-414.104) -- 0:00:48
197500 -- (-417.191) [-413.860] (-415.990) (-413.532) * (-414.238) (-419.348) [-415.390] (-416.947) -- 0:00:48
198000 -- (-416.227) (-414.671) [-414.440] (-415.033) * (-415.110) (-413.356) (-418.935) [-413.229] -- 0:00:48
198500 -- (-417.613) [-413.434] (-416.776) (-415.272) * [-413.852] (-415.722) (-415.782) (-417.909) -- 0:00:48
199000 -- (-414.032) (-413.318) (-415.213) [-413.783] * (-416.807) (-413.976) (-416.724) [-415.305] -- 0:00:48
199500 -- (-414.129) (-414.929) (-415.822) [-414.284] * (-422.719) (-416.963) [-419.362] (-413.258) -- 0:00:48
200000 -- (-413.110) [-415.100] (-415.994) (-416.276) * (-414.243) [-414.384] (-414.599) (-414.178) -- 0:00:48
Average standard deviation of split frequencies: 0.015922
200500 -- [-415.086] (-414.754) (-415.004) (-414.756) * (-415.617) (-416.976) [-418.626] (-415.545) -- 0:00:47
201000 -- (-415.956) (-421.270) [-413.745] (-417.675) * (-414.046) (-414.867) (-416.054) [-413.900] -- 0:00:47
201500 -- [-417.001] (-416.436) (-414.704) (-417.092) * (-414.519) [-416.293] (-418.564) (-417.992) -- 0:00:47
202000 -- (-421.671) (-414.857) [-417.692] (-413.544) * [-418.586] (-416.636) (-415.402) (-416.492) -- 0:00:47
202500 -- (-418.613) (-414.115) [-414.647] (-416.727) * (-413.761) (-415.801) (-413.551) [-413.084] -- 0:00:47
203000 -- (-417.518) (-419.022) (-414.811) [-415.880] * (-415.558) (-418.214) [-413.536] (-413.426) -- 0:00:47
203500 -- (-414.405) (-415.870) [-413.651] (-414.656) * (-414.027) (-419.901) (-416.267) [-414.640] -- 0:00:46
204000 -- (-413.996) (-415.521) [-413.447] (-418.489) * [-413.808] (-416.067) (-413.953) (-415.359) -- 0:00:46
204500 -- (-418.154) (-417.557) (-414.134) [-414.853] * (-413.476) (-414.761) [-415.992] (-415.227) -- 0:00:46
205000 -- (-413.445) (-414.534) [-416.616] (-413.342) * (-415.467) (-416.516) (-416.968) [-413.817] -- 0:00:46
Average standard deviation of split frequencies: 0.014366
205500 -- (-413.555) (-416.519) [-413.846] (-413.691) * (-416.499) [-414.504] (-414.356) (-417.621) -- 0:00:46
206000 -- (-414.149) (-414.071) (-414.340) [-417.554] * (-415.697) (-418.697) (-413.891) [-413.267] -- 0:00:46
206500 -- [-414.005] (-414.885) (-413.324) (-414.362) * (-413.571) (-417.845) [-414.813] (-413.716) -- 0:00:46
207000 -- [-413.494] (-414.357) (-414.186) (-413.988) * [-416.568] (-422.072) (-417.503) (-414.764) -- 0:00:45
207500 -- [-414.974] (-415.373) (-415.925) (-415.103) * (-414.471) [-420.978] (-415.261) (-415.163) -- 0:00:45
208000 -- (-415.812) [-414.808] (-417.990) (-413.164) * (-418.540) (-418.402) [-414.330] (-413.859) -- 0:00:45
208500 -- [-416.377] (-414.630) (-414.954) (-413.561) * (-413.384) [-416.428] (-414.784) (-417.314) -- 0:00:45
209000 -- [-416.155] (-414.239) (-414.314) (-413.527) * [-413.140] (-416.772) (-415.556) (-416.128) -- 0:00:45
209500 -- (-415.339) (-420.130) (-418.036) [-413.862] * (-415.812) [-415.626] (-415.099) (-413.639) -- 0:00:45
210000 -- [-413.538] (-416.539) (-421.112) (-416.346) * (-415.453) (-417.723) (-413.517) [-414.152] -- 0:00:45
Average standard deviation of split frequencies: 0.015664
210500 -- (-417.161) [-413.116] (-414.765) (-414.623) * (-415.516) (-415.021) [-414.129] (-414.306) -- 0:00:45
211000 -- (-417.303) (-415.259) (-416.751) [-413.883] * (-413.995) (-417.602) [-414.184] (-414.421) -- 0:00:44
211500 -- [-414.007] (-414.303) (-414.588) (-413.163) * [-413.615] (-417.937) (-415.676) (-419.318) -- 0:00:44
212000 -- (-415.749) (-417.564) (-417.073) [-414.175] * (-416.256) [-413.955] (-415.047) (-416.552) -- 0:00:48
212500 -- (-414.373) (-414.685) (-418.550) [-413.467] * (-416.818) (-413.969) (-414.626) [-415.419] -- 0:00:48
213000 -- (-416.736) (-415.284) [-416.904] (-416.085) * [-415.214] (-416.284) (-414.744) (-416.730) -- 0:00:48
213500 -- (-415.780) (-415.521) (-414.700) [-414.210] * (-419.593) (-414.146) [-413.346] (-415.875) -- 0:00:47
214000 -- (-417.055) [-413.463] (-419.044) (-415.159) * (-415.122) (-412.847) [-414.620] (-417.693) -- 0:00:47
214500 -- [-413.734] (-414.691) (-413.884) (-415.487) * [-412.962] (-413.948) (-414.578) (-415.194) -- 0:00:47
215000 -- [-413.891] (-414.811) (-414.535) (-414.562) * (-415.955) (-413.327) (-418.297) [-413.197] -- 0:00:47
Average standard deviation of split frequencies: 0.014671
215500 -- (-414.553) [-416.178] (-415.914) (-414.741) * (-415.365) (-413.647) [-413.522] (-416.109) -- 0:00:47
216000 -- [-417.802] (-415.556) (-421.125) (-416.190) * (-416.861) (-415.944) (-414.302) [-417.309] -- 0:00:47
216500 -- (-414.640) (-415.189) (-415.543) [-414.341] * [-414.597] (-414.252) (-419.633) (-416.006) -- 0:00:47
217000 -- (-417.461) (-415.778) (-414.582) [-414.444] * [-413.019] (-419.140) (-413.684) (-414.819) -- 0:00:46
217500 -- [-413.126] (-416.698) (-415.260) (-415.455) * (-421.273) (-417.402) (-416.679) [-412.978] -- 0:00:46
218000 -- (-417.106) [-413.135] (-416.487) (-415.698) * (-421.647) [-415.322] (-416.008) (-413.209) -- 0:00:46
218500 -- [-418.049] (-417.265) (-414.651) (-414.251) * (-417.554) [-416.159] (-414.646) (-414.768) -- 0:00:46
219000 -- (-415.575) (-415.882) (-416.643) [-414.260] * (-416.474) (-415.512) [-414.048] (-416.001) -- 0:00:46
219500 -- [-413.816] (-413.815) (-414.830) (-414.052) * (-413.359) [-420.401] (-415.940) (-414.569) -- 0:00:46
220000 -- (-413.849) (-415.406) (-415.458) [-415.104] * (-416.806) [-420.786] (-414.736) (-413.240) -- 0:00:46
Average standard deviation of split frequencies: 0.013767
220500 -- [-416.104] (-418.453) (-415.590) (-413.891) * (-414.045) (-413.750) (-414.447) [-413.583] -- 0:00:45
221000 -- (-415.436) (-414.408) (-413.404) [-413.681] * [-416.015] (-416.453) (-417.651) (-416.265) -- 0:00:45
221500 -- [-415.553] (-416.708) (-415.587) (-416.145) * (-414.118) (-415.580) (-414.502) [-415.479] -- 0:00:45
222000 -- (-414.143) [-413.472] (-415.096) (-417.443) * (-420.836) (-413.626) [-417.458] (-415.457) -- 0:00:45
222500 -- (-414.538) (-422.952) [-412.964] (-419.953) * (-415.662) [-415.154] (-418.068) (-413.734) -- 0:00:45
223000 -- (-416.567) [-418.822] (-415.506) (-413.328) * [-415.059] (-416.016) (-413.851) (-418.176) -- 0:00:45
223500 -- (-415.183) (-414.154) (-413.903) [-415.014] * (-418.197) (-415.412) [-414.783] (-415.013) -- 0:00:45
224000 -- (-413.195) [-415.071] (-417.084) (-414.018) * (-416.926) [-415.342] (-414.262) (-419.027) -- 0:00:45
224500 -- (-415.534) (-414.279) [-416.982] (-413.378) * (-416.088) (-415.892) [-414.619] (-415.697) -- 0:00:44
225000 -- (-417.324) (-416.489) (-414.309) [-413.448] * (-416.600) [-415.817] (-414.134) (-414.760) -- 0:00:44
Average standard deviation of split frequencies: 0.013674
225500 -- [-414.621] (-415.417) (-416.765) (-416.419) * (-415.190) (-413.766) [-416.337] (-418.887) -- 0:00:44
226000 -- (-417.781) (-413.698) [-413.521] (-417.516) * (-413.843) (-417.625) [-415.818] (-419.583) -- 0:00:44
226500 -- [-416.252] (-415.849) (-415.802) (-420.434) * (-414.408) (-417.449) [-414.269] (-417.396) -- 0:00:44
227000 -- (-413.919) (-415.494) [-418.296] (-414.776) * (-419.232) (-415.214) (-414.378) [-415.264] -- 0:00:44
227500 -- [-413.402] (-414.640) (-415.712) (-414.272) * (-418.539) (-413.830) [-414.030] (-417.881) -- 0:00:44
228000 -- (-415.863) (-414.983) (-414.555) [-417.672] * (-414.471) [-415.092] (-413.448) (-414.280) -- 0:00:44
228500 -- (-415.659) (-414.037) [-413.672] (-417.102) * [-414.534] (-414.002) (-415.425) (-416.173) -- 0:00:43
229000 -- [-414.544] (-414.685) (-416.773) (-417.419) * [-413.673] (-414.358) (-416.409) (-418.215) -- 0:00:43
229500 -- (-413.640) (-414.430) (-414.283) [-415.522] * (-416.740) (-414.930) [-414.990] (-417.581) -- 0:00:47
230000 -- (-415.126) (-414.592) [-416.279] (-416.868) * (-414.187) (-415.572) [-415.006] (-417.390) -- 0:00:46
Average standard deviation of split frequencies: 0.012262
230500 -- [-415.192] (-417.163) (-414.182) (-415.295) * (-415.055) (-413.480) [-415.753] (-420.008) -- 0:00:46
231000 -- (-413.895) (-415.369) [-414.790] (-415.283) * [-414.534] (-414.415) (-415.496) (-416.153) -- 0:00:46
231500 -- (-413.903) (-414.082) [-415.068] (-416.618) * [-414.388] (-415.234) (-415.175) (-415.105) -- 0:00:46
232000 -- [-416.512] (-415.239) (-414.472) (-417.870) * (-415.653) [-416.939] (-417.959) (-413.225) -- 0:00:46
232500 -- (-413.496) (-417.495) [-413.959] (-414.472) * (-414.547) [-415.386] (-417.383) (-413.549) -- 0:00:46
233000 -- (-414.518) (-415.999) (-416.715) [-415.216] * (-413.077) (-415.158) (-415.165) [-415.317] -- 0:00:46
233500 -- (-415.271) (-413.584) [-414.182] (-418.130) * (-413.180) [-418.683] (-417.325) (-419.698) -- 0:00:45
234000 -- (-414.042) [-414.114] (-416.355) (-416.006) * (-414.210) (-414.722) [-416.230] (-416.477) -- 0:00:45
234500 -- (-418.021) (-419.411) [-414.984] (-415.902) * (-414.479) [-414.081] (-416.744) (-418.669) -- 0:00:45
235000 -- (-419.279) [-418.956] (-416.039) (-419.034) * (-415.396) (-414.233) (-417.386) [-416.056] -- 0:00:45
Average standard deviation of split frequencies: 0.012572
235500 -- [-415.561] (-417.294) (-416.935) (-416.460) * [-417.700] (-416.965) (-418.748) (-416.612) -- 0:00:45
236000 -- [-417.134] (-416.541) (-416.759) (-414.389) * (-415.136) (-415.459) (-415.451) [-416.539] -- 0:00:45
236500 -- (-416.093) (-415.491) (-415.152) [-416.984] * (-415.117) (-420.682) [-414.930] (-419.081) -- 0:00:45
237000 -- (-413.648) (-416.246) (-420.807) [-420.069] * (-414.602) (-415.186) [-414.809] (-414.681) -- 0:00:45
237500 -- (-415.920) [-413.245] (-417.579) (-417.449) * (-414.132) (-418.317) [-414.336] (-414.544) -- 0:00:44
238000 -- [-412.844] (-420.165) (-415.709) (-415.867) * (-413.762) [-415.632] (-417.833) (-415.358) -- 0:00:44
238500 -- [-415.163] (-415.018) (-413.457) (-413.369) * (-414.740) [-414.681] (-419.864) (-416.408) -- 0:00:44
239000 -- [-415.797] (-418.073) (-412.960) (-414.764) * (-413.244) [-415.188] (-419.724) (-414.770) -- 0:00:44
239500 -- (-415.407) (-416.680) [-414.911] (-414.519) * [-416.340] (-413.597) (-416.284) (-414.935) -- 0:00:44
240000 -- [-416.836] (-415.942) (-413.504) (-413.791) * (-414.265) (-413.489) (-419.450) [-413.040] -- 0:00:44
Average standard deviation of split frequencies: 0.013250
240500 -- (-418.842) (-421.086) [-415.493] (-414.717) * (-417.819) [-414.569] (-416.356) (-415.965) -- 0:00:44
241000 -- (-414.557) (-415.171) [-415.397] (-414.180) * [-415.371] (-414.414) (-417.984) (-416.525) -- 0:00:44
241500 -- (-413.346) [-417.045] (-414.101) (-413.928) * (-414.864) (-416.218) (-417.509) [-413.864] -- 0:00:43
242000 -- (-417.377) (-417.106) [-414.232] (-413.098) * (-417.572) (-414.028) [-413.249] (-413.818) -- 0:00:43
242500 -- [-416.905] (-417.759) (-416.806) (-415.469) * (-416.792) [-414.260] (-415.556) (-414.889) -- 0:00:43
243000 -- (-413.459) [-414.068] (-414.737) (-417.193) * (-416.494) (-413.751) (-414.975) [-415.097] -- 0:00:43
243500 -- (-419.759) [-417.877] (-414.077) (-418.848) * (-416.107) (-417.590) (-413.954) [-414.146] -- 0:00:43
244000 -- (-415.157) (-417.805) (-413.066) [-414.359] * [-416.594] (-413.356) (-415.661) (-417.821) -- 0:00:43
244500 -- (-419.710) [-415.530] (-413.450) (-416.082) * (-418.085) (-414.599) (-417.977) [-415.538] -- 0:00:43
245000 -- (-413.822) (-420.904) [-412.921] (-417.291) * (-415.415) (-413.278) (-414.773) [-414.248] -- 0:00:43
Average standard deviation of split frequencies: 0.013301
245500 -- (-415.101) (-420.205) (-414.814) [-416.466] * (-414.921) [-416.262] (-413.785) (-415.190) -- 0:00:43
246000 -- (-415.595) (-417.820) [-417.732] (-415.269) * (-415.220) [-414.414] (-413.955) (-413.367) -- 0:00:45
246500 -- (-414.562) (-417.256) (-418.533) [-414.190] * (-416.064) (-417.451) [-413.869] (-413.819) -- 0:00:45
247000 -- (-419.045) (-414.210) [-414.935] (-414.988) * (-417.205) (-414.165) (-415.015) [-413.321] -- 0:00:45
247500 -- [-422.320] (-413.779) (-414.820) (-415.541) * (-419.336) [-416.319] (-414.043) (-414.437) -- 0:00:45
248000 -- (-416.673) [-414.134] (-414.108) (-413.546) * (-420.503) [-415.617] (-414.046) (-414.355) -- 0:00:45
248500 -- (-416.799) [-415.475] (-414.000) (-414.187) * (-416.382) [-416.993] (-414.059) (-414.464) -- 0:00:45
249000 -- (-417.645) [-414.245] (-413.768) (-415.732) * (-417.179) (-415.491) [-416.251] (-422.039) -- 0:00:45
249500 -- [-419.411] (-417.249) (-413.305) (-416.264) * (-414.421) (-413.498) [-414.863] (-414.089) -- 0:00:45
250000 -- (-414.838) [-413.723] (-417.028) (-419.919) * (-415.435) (-416.382) (-417.249) [-413.375] -- 0:00:45
Average standard deviation of split frequencies: 0.013634
250500 -- (-420.108) (-415.165) [-414.713] (-413.818) * (-415.077) (-417.451) (-417.992) [-413.977] -- 0:00:44
251000 -- (-416.417) [-413.687] (-415.776) (-415.763) * (-413.448) (-414.663) (-415.034) [-414.649] -- 0:00:44
251500 -- (-415.201) (-416.715) (-414.937) [-415.987] * [-414.091] (-415.954) (-415.188) (-413.613) -- 0:00:44
252000 -- (-416.611) (-418.365) [-416.266] (-415.367) * (-414.352) (-414.268) (-416.498) [-417.569] -- 0:00:44
252500 -- (-414.922) [-414.849] (-414.335) (-414.415) * [-415.262] (-416.226) (-416.975) (-419.342) -- 0:00:44
253000 -- (-415.431) (-416.168) (-417.686) [-414.421] * (-415.206) (-419.432) (-415.945) [-415.213] -- 0:00:44
253500 -- (-413.489) (-413.635) [-415.503] (-415.576) * (-414.534) [-414.755] (-415.296) (-413.501) -- 0:00:44
254000 -- (-414.310) (-414.175) [-416.988] (-414.678) * [-415.416] (-419.330) (-423.521) (-420.106) -- 0:00:44
254500 -- (-414.002) (-416.820) [-416.323] (-417.346) * (-418.246) (-422.758) (-415.133) [-416.818] -- 0:00:43
255000 -- [-414.072] (-416.281) (-415.545) (-415.522) * (-413.818) (-416.551) [-415.376] (-419.900) -- 0:00:43
Average standard deviation of split frequencies: 0.012132
255500 -- [-413.968] (-416.394) (-414.668) (-415.857) * (-415.225) [-415.766] (-416.610) (-419.635) -- 0:00:43
256000 -- (-418.298) (-415.196) [-413.431] (-416.236) * [-414.229] (-417.793) (-413.210) (-418.621) -- 0:00:43
256500 -- [-416.194] (-412.855) (-413.642) (-421.785) * (-415.764) (-415.104) (-414.075) [-415.370] -- 0:00:43
257000 -- [-413.708] (-413.352) (-413.970) (-416.402) * (-413.864) (-415.462) [-416.392] (-415.687) -- 0:00:43
257500 -- (-413.360) [-416.372] (-414.805) (-418.869) * [-417.272] (-414.109) (-413.185) (-416.077) -- 0:00:43
258000 -- (-415.860) (-414.279) [-414.038] (-419.336) * (-415.359) (-414.539) (-414.618) [-415.345] -- 0:00:43
258500 -- (-419.638) (-417.452) [-415.884] (-416.660) * (-422.810) (-416.735) [-416.307] (-413.865) -- 0:00:43
259000 -- (-414.117) [-415.719] (-417.119) (-417.957) * (-417.391) (-416.994) [-415.755] (-414.160) -- 0:00:42
259500 -- (-415.693) (-418.071) [-414.110] (-415.186) * [-417.648] (-418.455) (-415.820) (-415.486) -- 0:00:42
260000 -- (-414.534) [-414.371] (-418.443) (-414.207) * (-418.152) (-417.253) [-414.113] (-415.911) -- 0:00:42
Average standard deviation of split frequencies: 0.013085
260500 -- (-414.230) (-413.587) (-417.985) [-414.951] * [-415.677] (-417.931) (-413.501) (-415.810) -- 0:00:42
261000 -- (-414.705) (-417.907) (-416.127) [-415.451] * [-413.391] (-415.113) (-413.491) (-417.118) -- 0:00:42
261500 -- (-414.138) [-414.279] (-416.257) (-415.078) * (-413.704) [-418.138] (-413.652) (-413.271) -- 0:00:42
262000 -- (-417.309) [-414.964] (-417.338) (-415.773) * (-416.076) [-414.248] (-413.621) (-416.624) -- 0:00:42
262500 -- (-416.092) [-418.458] (-416.097) (-414.810) * (-418.864) [-413.445] (-413.725) (-413.790) -- 0:00:44
263000 -- (-416.078) [-413.510] (-418.031) (-413.551) * (-420.021) (-414.222) (-415.044) [-414.385] -- 0:00:44
263500 -- (-414.833) (-414.632) (-413.845) [-416.514] * (-416.345) (-418.867) (-415.516) [-417.288] -- 0:00:44
264000 -- (-413.188) (-413.484) (-413.407) [-415.069] * (-413.775) (-417.044) [-414.227] (-418.449) -- 0:00:44
264500 -- (-414.190) (-413.969) [-413.485] (-414.391) * [-417.265] (-415.050) (-414.711) (-421.044) -- 0:00:44
265000 -- (-415.009) (-415.754) [-414.314] (-414.707) * (-415.093) (-414.064) (-416.669) [-414.887] -- 0:00:44
Average standard deviation of split frequencies: 0.013469
265500 -- (-417.522) (-413.393) (-416.145) [-413.572] * [-413.737] (-418.300) (-414.898) (-413.354) -- 0:00:44
266000 -- (-414.101) (-415.846) (-414.517) [-415.250] * (-415.615) [-413.718] (-417.182) (-412.924) -- 0:00:44
266500 -- (-413.509) [-414.539] (-416.590) (-417.785) * [-415.469] (-422.018) (-415.467) (-413.991) -- 0:00:44
267000 -- [-415.958] (-418.878) (-417.417) (-414.989) * (-417.148) (-413.135) [-417.198] (-416.798) -- 0:00:43
267500 -- (-416.403) [-416.307] (-415.070) (-414.267) * [-413.434] (-414.993) (-418.023) (-413.088) -- 0:00:43
268000 -- [-414.510] (-414.435) (-414.650) (-414.559) * [-414.430] (-417.256) (-414.073) (-412.934) -- 0:00:43
268500 -- (-415.035) (-413.988) [-414.495] (-413.577) * (-416.592) (-414.472) [-414.357] (-413.202) -- 0:00:43
269000 -- [-418.317] (-414.036) (-415.714) (-413.798) * (-421.406) (-415.823) (-414.660) [-413.953] -- 0:00:43
269500 -- (-415.035) (-414.120) (-414.256) [-413.761] * [-414.746] (-415.829) (-418.337) (-414.837) -- 0:00:43
270000 -- (-416.577) (-414.041) [-414.773] (-414.382) * (-414.854) (-413.507) [-413.320] (-413.283) -- 0:00:43
Average standard deviation of split frequencies: 0.013256
270500 -- (-414.182) (-415.812) (-415.198) [-415.197] * (-413.422) (-419.348) [-415.574] (-415.137) -- 0:00:43
271000 -- (-414.200) (-416.926) (-413.786) [-417.997] * (-414.303) (-414.863) (-418.360) [-413.164] -- 0:00:43
271500 -- (-415.653) (-417.158) (-413.967) [-413.409] * [-414.266] (-415.742) (-414.951) (-415.672) -- 0:00:42
272000 -- (-415.073) [-415.027] (-415.486) (-416.222) * [-415.186] (-417.285) (-417.227) (-416.520) -- 0:00:42
272500 -- (-415.376) (-415.396) [-415.806] (-413.457) * (-414.998) (-416.966) [-419.680] (-421.101) -- 0:00:42
273000 -- (-414.024) [-414.087] (-414.559) (-413.714) * [-415.402] (-416.258) (-415.204) (-418.782) -- 0:00:42
273500 -- (-413.498) (-416.484) (-415.191) [-414.780] * (-413.857) (-413.604) (-413.633) [-415.623] -- 0:00:42
274000 -- (-414.575) (-418.464) (-414.624) [-413.540] * [-414.437] (-414.231) (-416.402) (-414.927) -- 0:00:42
274500 -- (-414.304) (-414.540) [-418.215] (-413.549) * (-416.503) (-414.654) (-415.616) [-412.994] -- 0:00:42
275000 -- (-416.241) [-415.189] (-424.370) (-413.800) * [-414.276] (-413.000) (-414.001) (-413.187) -- 0:00:42
Average standard deviation of split frequencies: 0.013474
275500 -- (-414.192) (-413.889) [-416.672] (-414.854) * [-416.703] (-413.284) (-414.723) (-416.097) -- 0:00:42
276000 -- [-418.064] (-414.548) (-416.458) (-416.253) * (-418.743) [-414.762] (-415.184) (-415.571) -- 0:00:41
276500 -- (-417.967) (-414.018) [-414.904] (-414.106) * (-414.133) (-415.999) (-415.230) [-414.456] -- 0:00:41
277000 -- (-415.352) (-414.944) [-414.762] (-417.032) * (-414.107) (-415.044) (-416.016) [-413.857] -- 0:00:41
277500 -- (-413.888) (-414.368) [-417.621] (-418.294) * (-415.284) [-415.919] (-416.454) (-414.921) -- 0:00:41
278000 -- (-414.515) [-414.920] (-417.933) (-420.440) * [-414.203] (-421.178) (-414.575) (-414.189) -- 0:00:41
278500 -- (-414.281) (-418.811) (-416.442) [-417.407] * (-415.031) (-416.589) [-416.470] (-414.055) -- 0:00:41
279000 -- (-420.879) (-415.557) (-414.632) [-415.718] * [-413.501] (-414.302) (-414.172) (-417.534) -- 0:00:43
279500 -- (-416.916) [-415.737] (-421.460) (-414.320) * (-413.229) (-416.197) [-413.570] (-414.352) -- 0:00:43
280000 -- (-415.815) [-414.303] (-416.248) (-416.805) * [-414.726] (-414.179) (-416.517) (-414.415) -- 0:00:43
Average standard deviation of split frequencies: 0.014183
280500 -- (-413.948) (-417.666) (-415.632) [-415.027] * [-416.154] (-416.887) (-416.484) (-415.967) -- 0:00:43
281000 -- [-416.602] (-414.225) (-413.147) (-414.405) * (-418.601) [-414.848] (-415.881) (-419.681) -- 0:00:43
281500 -- (-415.579) (-416.912) (-413.210) [-417.690] * (-418.505) (-420.158) (-415.671) [-419.353] -- 0:00:43
282000 -- (-416.461) (-413.663) [-414.580] (-415.822) * [-414.138] (-416.700) (-413.417) (-416.415) -- 0:00:43
282500 -- (-415.923) (-414.692) [-415.355] (-419.803) * (-413.581) (-414.313) [-413.903] (-415.527) -- 0:00:43
283000 -- (-420.242) (-413.717) [-417.586] (-416.743) * [-413.554] (-413.514) (-416.533) (-413.992) -- 0:00:43
283500 -- (-415.440) (-416.613) [-415.574] (-414.836) * [-415.025] (-413.089) (-414.779) (-414.552) -- 0:00:42
284000 -- (-412.992) [-416.200] (-415.936) (-413.944) * (-414.865) (-414.921) [-413.867] (-414.877) -- 0:00:42
284500 -- [-415.150] (-415.931) (-414.934) (-415.956) * [-414.331] (-415.652) (-416.336) (-414.894) -- 0:00:42
285000 -- [-413.187] (-415.080) (-416.227) (-417.280) * [-414.839] (-415.895) (-413.494) (-413.340) -- 0:00:42
Average standard deviation of split frequencies: 0.015181
285500 -- (-414.687) (-414.146) (-416.843) [-414.091] * [-413.614] (-416.357) (-414.445) (-414.240) -- 0:00:42
286000 -- [-414.251] (-413.406) (-414.377) (-415.412) * [-413.769] (-413.783) (-413.533) (-414.465) -- 0:00:42
286500 -- (-414.132) (-416.102) (-414.421) [-417.267] * [-414.959] (-413.587) (-415.588) (-419.403) -- 0:00:42
287000 -- (-416.099) (-417.497) [-414.495] (-418.561) * (-413.281) [-416.756] (-417.146) (-417.118) -- 0:00:42
287500 -- (-414.426) [-414.139] (-414.470) (-416.828) * (-416.817) [-413.533] (-416.426) (-415.506) -- 0:00:42
288000 -- (-419.349) (-414.726) (-415.250) [-415.527] * (-413.635) (-413.606) (-414.161) [-412.982] -- 0:00:42
288500 -- (-418.129) (-415.229) (-414.673) [-413.644] * (-413.565) (-415.639) [-414.509] (-417.385) -- 0:00:41
289000 -- (-415.115) (-416.598) (-414.556) [-415.261] * (-417.574) [-413.687] (-415.754) (-414.952) -- 0:00:41
289500 -- (-415.414) (-425.804) (-413.047) [-414.134] * (-414.239) [-414.609] (-414.587) (-418.187) -- 0:00:41
290000 -- (-415.308) (-421.013) [-413.155] (-422.490) * (-416.310) [-415.394] (-414.496) (-416.158) -- 0:00:41
Average standard deviation of split frequencies: 0.014340
290500 -- (-414.460) (-416.193) [-413.682] (-417.329) * (-413.621) [-414.040] (-414.631) (-418.610) -- 0:00:41
291000 -- (-414.584) (-414.613) [-414.148] (-414.532) * [-416.060] (-415.560) (-414.975) (-416.551) -- 0:00:41
291500 -- (-418.880) [-414.480] (-415.053) (-415.730) * (-414.307) (-415.871) [-414.987] (-416.634) -- 0:00:41
292000 -- [-419.999] (-423.655) (-413.906) (-412.875) * [-417.158] (-413.540) (-416.069) (-414.610) -- 0:00:41
292500 -- [-414.660] (-414.419) (-416.993) (-414.270) * (-414.119) (-417.314) (-415.814) [-413.956] -- 0:00:41
293000 -- (-415.439) (-413.674) [-414.523] (-416.657) * (-415.376) (-413.765) [-414.954] (-416.095) -- 0:00:41
293500 -- (-414.092) [-413.332] (-415.539) (-416.358) * [-414.634] (-413.954) (-413.440) (-414.109) -- 0:00:40
294000 -- (-417.440) (-413.798) (-416.353) [-417.711] * [-413.948] (-415.920) (-413.370) (-413.757) -- 0:00:43
294500 -- [-414.411] (-415.204) (-416.222) (-414.357) * [-413.786] (-417.710) (-413.432) (-416.220) -- 0:00:43
295000 -- (-416.888) [-416.632] (-415.647) (-414.075) * [-413.794] (-416.578) (-413.356) (-415.613) -- 0:00:43
Average standard deviation of split frequencies: 0.014333
295500 -- (-415.017) (-417.727) [-413.172] (-414.473) * (-414.267) (-414.980) (-414.714) [-416.316] -- 0:00:42
296000 -- (-416.282) (-415.781) (-413.599) [-413.876] * [-413.655] (-418.372) (-414.890) (-414.298) -- 0:00:42
296500 -- (-415.598) [-415.632] (-414.126) (-413.796) * [-415.482] (-416.248) (-413.038) (-414.735) -- 0:00:42
297000 -- (-414.516) (-414.998) [-413.810] (-414.451) * (-415.798) [-415.712] (-416.105) (-413.502) -- 0:00:42
297500 -- (-419.960) [-413.656] (-414.147) (-414.177) * (-413.758) (-415.123) (-414.007) [-414.935] -- 0:00:42
298000 -- (-415.038) [-414.362] (-413.383) (-414.126) * (-413.711) [-413.332] (-420.503) (-416.554) -- 0:00:42
298500 -- (-414.863) [-413.758] (-415.879) (-414.918) * (-415.931) (-415.636) (-417.754) [-414.519] -- 0:00:42
299000 -- (-414.829) [-415.488] (-415.930) (-418.091) * (-420.193) [-414.274] (-418.498) (-418.502) -- 0:00:42
299500 -- (-413.931) (-414.897) (-419.330) [-413.806] * (-416.954) (-413.922) (-417.502) [-415.607] -- 0:00:42
300000 -- (-416.892) (-415.096) [-416.409] (-413.477) * (-416.739) (-413.980) [-416.979] (-413.664) -- 0:00:42
Average standard deviation of split frequencies: 0.011990
300500 -- (-415.066) (-416.772) [-418.256] (-413.981) * (-414.494) (-413.665) [-414.487] (-419.432) -- 0:00:41
301000 -- (-416.465) (-414.561) (-416.535) [-414.676] * (-414.315) [-416.416] (-416.313) (-419.904) -- 0:00:41
301500 -- (-414.354) [-415.930] (-415.810) (-415.005) * [-414.280] (-416.392) (-416.175) (-421.824) -- 0:00:41
302000 -- (-416.416) (-418.092) (-415.062) [-417.145] * (-414.788) (-417.906) [-415.807] (-414.168) -- 0:00:41
302500 -- (-413.065) (-414.850) (-413.758) [-413.336] * (-415.491) (-419.223) [-414.614] (-415.173) -- 0:00:41
303000 -- (-415.993) (-416.105) [-414.283] (-413.254) * (-415.232) (-417.346) (-414.405) [-417.926] -- 0:00:41
303500 -- (-416.231) [-418.158] (-414.520) (-414.943) * (-416.244) [-416.153] (-414.600) (-418.159) -- 0:00:41
304000 -- [-416.115] (-414.115) (-415.196) (-414.878) * (-416.216) (-415.254) [-414.255] (-417.734) -- 0:00:41
304500 -- (-413.977) (-416.711) (-416.681) [-413.348] * (-414.363) [-417.482] (-415.352) (-417.311) -- 0:00:41
305000 -- (-414.307) [-413.067] (-415.326) (-415.204) * [-415.819] (-413.899) (-416.825) (-419.037) -- 0:00:41
Average standard deviation of split frequencies: 0.012752
305500 -- (-415.387) [-413.857] (-414.947) (-415.840) * (-414.559) [-414.668] (-416.185) (-416.120) -- 0:00:40
306000 -- [-416.070] (-415.908) (-416.461) (-414.767) * (-414.562) (-413.319) (-419.940) [-423.187] -- 0:00:40
306500 -- (-415.037) (-416.615) [-414.512] (-416.036) * (-417.555) [-413.272] (-413.776) (-414.877) -- 0:00:40
307000 -- (-414.730) (-413.814) [-413.440] (-414.036) * [-413.769] (-416.467) (-419.594) (-416.552) -- 0:00:40
307500 -- (-413.855) (-415.222) [-413.087] (-414.600) * (-414.215) (-414.793) (-416.439) [-413.500] -- 0:00:40
308000 -- [-414.765] (-413.643) (-416.584) (-413.500) * (-413.779) (-417.032) [-413.491] (-413.108) -- 0:00:40
308500 -- (-416.501) (-415.318) (-418.145) [-413.989] * (-416.402) (-415.601) (-413.841) [-415.477] -- 0:00:40
309000 -- (-415.991) (-415.292) (-413.942) [-414.356] * (-419.857) (-416.243) [-414.445] (-416.079) -- 0:00:40
309500 -- (-418.101) [-415.640] (-419.263) (-414.658) * (-421.978) [-415.274] (-415.491) (-416.336) -- 0:00:40
310000 -- (-414.759) [-413.009] (-418.041) (-416.702) * (-419.294) (-412.939) [-412.897] (-416.257) -- 0:00:40
Average standard deviation of split frequencies: 0.012814
310500 -- (-414.738) (-415.902) [-415.740] (-415.517) * (-413.960) (-417.561) [-413.550] (-418.002) -- 0:00:42
311000 -- (-417.072) [-415.591] (-413.824) (-418.230) * (-415.309) [-414.754] (-414.894) (-417.619) -- 0:00:42
311500 -- (-413.849) [-414.108] (-415.482) (-416.907) * [-414.273] (-415.557) (-419.456) (-421.115) -- 0:00:41
312000 -- [-415.185] (-415.059) (-414.893) (-416.217) * (-414.468) [-414.725] (-414.963) (-423.582) -- 0:00:41
312500 -- [-414.493] (-415.151) (-415.089) (-417.804) * (-416.416) (-419.803) [-416.515] (-415.548) -- 0:00:41
313000 -- (-414.355) (-414.831) (-416.032) [-419.689] * (-414.406) [-414.951] (-415.848) (-414.973) -- 0:00:41
313500 -- [-414.806] (-416.537) (-420.591) (-419.123) * (-414.575) [-414.446] (-414.956) (-416.317) -- 0:00:41
314000 -- (-413.461) (-413.369) [-414.424] (-417.428) * (-413.571) [-414.651] (-415.534) (-414.799) -- 0:00:41
314500 -- (-414.815) [-413.599] (-414.414) (-416.069) * (-415.609) (-414.168) (-413.605) [-413.834] -- 0:00:41
315000 -- (-414.723) (-415.201) [-414.969] (-414.674) * (-415.702) (-415.518) [-414.685] (-414.013) -- 0:00:41
Average standard deviation of split frequencies: 0.012405
315500 -- (-414.364) (-413.171) (-416.220) [-413.769] * (-414.046) [-415.054] (-412.976) (-413.575) -- 0:00:41
316000 -- (-415.392) [-415.508] (-415.338) (-413.268) * (-416.667) [-416.635] (-414.566) (-415.083) -- 0:00:41
316500 -- (-414.931) (-415.059) (-416.070) [-416.474] * (-417.618) [-414.614] (-413.708) (-414.946) -- 0:00:41
317000 -- (-414.596) (-413.663) (-417.006) [-415.580] * [-413.323] (-415.660) (-415.016) (-415.029) -- 0:00:40
317500 -- [-413.444] (-417.658) (-415.398) (-419.794) * (-413.193) (-422.260) [-413.551] (-415.757) -- 0:00:40
318000 -- (-414.600) (-420.766) [-416.359] (-416.240) * (-413.414) (-417.691) (-414.044) [-414.423] -- 0:00:40
318500 -- (-414.306) [-414.545] (-413.860) (-415.684) * (-415.801) (-415.929) (-416.572) [-414.994] -- 0:00:40
319000 -- (-415.658) (-414.656) (-415.416) [-414.467] * (-413.472) [-414.569] (-414.437) (-418.770) -- 0:00:40
319500 -- (-413.293) (-415.925) [-417.704] (-414.269) * (-415.671) (-413.091) (-415.427) [-417.318] -- 0:00:40
320000 -- (-416.104) (-416.118) [-415.110] (-415.258) * (-414.068) [-416.080] (-413.652) (-417.472) -- 0:00:40
Average standard deviation of split frequencies: 0.013231
320500 -- (-416.209) (-414.463) [-415.046] (-415.249) * (-414.268) [-417.307] (-412.990) (-415.031) -- 0:00:40
321000 -- (-415.730) (-414.250) [-413.298] (-416.948) * (-415.781) (-414.391) [-419.146] (-417.528) -- 0:00:40
321500 -- (-414.257) (-415.641) [-415.137] (-416.057) * [-417.271] (-418.849) (-416.293) (-414.532) -- 0:00:40
322000 -- [-414.668] (-417.402) (-417.155) (-414.305) * [-414.417] (-416.146) (-414.055) (-415.016) -- 0:00:40
322500 -- [-416.298] (-416.197) (-418.511) (-414.172) * (-415.178) (-415.061) (-415.733) [-413.294] -- 0:00:39
323000 -- [-417.570] (-417.474) (-414.416) (-420.211) * (-415.334) (-419.192) (-415.472) [-414.117] -- 0:00:39
323500 -- (-413.718) (-413.432) (-415.557) [-414.903] * [-413.540] (-415.646) (-416.915) (-413.420) -- 0:00:39
324000 -- (-412.908) [-416.045] (-419.693) (-413.991) * (-413.886) (-413.061) (-414.069) [-413.927] -- 0:00:39
324500 -- (-415.010) (-414.020) (-416.861) [-417.121] * (-414.285) [-414.477] (-414.398) (-413.841) -- 0:00:39
325000 -- (-417.433) (-413.298) (-413.353) [-416.439] * [-419.615] (-414.604) (-420.067) (-416.827) -- 0:00:39
Average standard deviation of split frequencies: 0.014243
325500 -- (-416.141) [-414.448] (-413.628) (-420.011) * (-415.425) (-414.412) [-416.809] (-416.401) -- 0:00:39
326000 -- (-415.897) [-413.776] (-418.407) (-418.748) * (-414.825) (-414.236) (-412.937) [-414.061] -- 0:00:39
326500 -- (-416.341) [-412.917] (-416.342) (-415.074) * [-413.000] (-414.710) (-413.533) (-413.423) -- 0:00:39
327000 -- (-414.254) [-414.987] (-420.461) (-415.170) * (-419.330) [-414.333] (-413.110) (-414.548) -- 0:00:39
327500 -- (-416.227) [-415.871] (-415.824) (-416.146) * (-415.491) (-416.239) [-414.311] (-414.361) -- 0:00:41
328000 -- [-416.186] (-415.869) (-414.484) (-415.109) * (-415.247) [-416.199] (-422.929) (-415.023) -- 0:00:40
328500 -- (-414.793) [-413.983] (-416.802) (-414.443) * (-418.518) (-417.164) [-422.971] (-413.591) -- 0:00:40
329000 -- (-417.141) [-414.055] (-415.076) (-420.413) * (-414.613) (-417.022) (-416.845) [-414.753] -- 0:00:40
329500 -- (-416.164) (-417.475) [-419.667] (-415.913) * (-413.832) [-416.160] (-416.917) (-422.003) -- 0:00:40
330000 -- (-414.201) [-416.417] (-416.593) (-413.785) * (-414.754) (-417.645) (-413.533) [-417.267] -- 0:00:40
Average standard deviation of split frequencies: 0.014652
330500 -- (-415.179) (-413.454) [-416.109] (-413.658) * (-415.887) (-417.376) (-416.549) [-416.057] -- 0:00:40
331000 -- (-415.900) [-413.487] (-417.957) (-416.543) * (-417.714) [-413.192] (-414.841) (-417.052) -- 0:00:40
331500 -- (-416.375) (-422.060) [-414.035] (-416.557) * (-417.096) (-414.436) [-417.456] (-414.171) -- 0:00:40
332000 -- (-413.688) (-415.162) [-414.930] (-415.154) * (-421.176) (-415.252) (-416.022) [-414.886] -- 0:00:40
332500 -- (-413.724) (-415.972) (-413.271) [-413.940] * (-417.392) [-415.984] (-418.013) (-415.225) -- 0:00:40
333000 -- (-416.445) [-414.165] (-416.949) (-416.057) * (-417.643) [-414.364] (-417.091) (-413.104) -- 0:00:40
333500 -- (-414.711) (-413.194) (-415.848) [-416.655] * (-415.416) (-414.710) (-413.322) [-413.679] -- 0:00:39
334000 -- (-420.820) [-414.036] (-414.514) (-418.706) * [-415.320] (-415.118) (-415.114) (-415.891) -- 0:00:39
334500 -- (-413.873) [-416.444] (-413.467) (-415.692) * [-414.205] (-415.237) (-417.474) (-417.420) -- 0:00:39
335000 -- (-414.185) [-414.750] (-415.490) (-417.159) * (-416.181) (-416.493) (-414.751) [-414.153] -- 0:00:39
Average standard deviation of split frequencies: 0.012874
335500 -- [-415.795] (-415.802) (-414.996) (-417.371) * (-420.335) (-418.365) [-418.814] (-416.894) -- 0:00:39
336000 -- (-413.888) (-414.696) (-414.248) [-415.040] * (-414.113) [-413.543] (-421.104) (-420.556) -- 0:00:39
336500 -- (-415.868) [-413.185] (-413.370) (-414.272) * [-415.376] (-415.007) (-415.950) (-417.169) -- 0:00:39
337000 -- [-415.156] (-413.230) (-414.309) (-415.879) * [-413.477] (-414.420) (-415.970) (-414.021) -- 0:00:39
337500 -- [-417.753] (-416.661) (-413.594) (-416.917) * (-413.669) [-413.530] (-414.772) (-414.332) -- 0:00:39
338000 -- [-417.154] (-414.172) (-415.152) (-414.781) * [-418.564] (-415.312) (-418.404) (-415.602) -- 0:00:39
338500 -- (-414.805) (-416.005) [-413.463] (-415.639) * (-414.962) (-415.278) (-419.921) [-413.436] -- 0:00:39
339000 -- (-415.370) (-415.357) (-413.109) [-414.406] * (-413.708) (-421.620) [-416.130] (-414.296) -- 0:00:38
339500 -- (-415.761) (-414.584) (-414.358) [-413.830] * (-415.060) (-415.953) [-415.162] (-414.441) -- 0:00:38
340000 -- (-414.636) (-417.639) (-415.415) [-417.794] * (-415.572) [-418.788] (-413.876) (-414.896) -- 0:00:38
Average standard deviation of split frequencies: 0.012698
340500 -- [-414.248] (-414.928) (-414.060) (-414.573) * (-417.621) (-415.928) (-414.118) [-415.150] -- 0:00:38
341000 -- (-416.418) [-414.186] (-415.313) (-416.586) * (-416.710) [-413.664] (-416.060) (-418.351) -- 0:00:38
341500 -- (-414.776) (-415.581) [-417.837] (-413.433) * (-418.473) (-413.442) [-415.768] (-416.612) -- 0:00:38
342000 -- (-415.190) (-414.170) (-414.687) [-413.195] * (-415.243) [-413.337] (-414.044) (-415.386) -- 0:00:38
342500 -- (-417.028) (-415.683) (-417.806) [-414.641] * (-416.139) (-415.905) [-417.054] (-421.555) -- 0:00:38
343000 -- (-417.407) [-414.061] (-413.751) (-414.931) * (-415.255) (-414.439) [-413.868] (-412.839) -- 0:00:38
343500 -- (-417.710) (-414.981) [-413.744] (-414.220) * (-414.917) (-416.673) (-418.895) [-413.223] -- 0:00:38
344000 -- [-418.269] (-418.925) (-416.005) (-413.036) * [-414.217] (-414.865) (-413.736) (-415.631) -- 0:00:38
344500 -- [-415.561] (-416.497) (-417.156) (-413.180) * (-413.438) (-418.473) [-413.976] (-413.746) -- 0:00:39
345000 -- (-414.567) (-416.622) (-417.222) [-414.386] * (-416.717) (-415.376) (-417.271) [-415.445] -- 0:00:39
Average standard deviation of split frequencies: 0.012943
345500 -- [-413.916] (-416.035) (-415.520) (-413.380) * [-415.825] (-413.974) (-416.300) (-415.066) -- 0:00:39
346000 -- [-415.333] (-414.042) (-417.395) (-415.728) * (-416.754) [-414.917] (-415.633) (-413.940) -- 0:00:39
346500 -- (-417.283) (-413.759) (-418.981) [-415.357] * (-414.955) (-415.222) [-414.534] (-414.129) -- 0:00:39
347000 -- (-421.394) (-414.324) (-414.162) [-418.254] * (-417.222) [-419.272] (-413.943) (-414.572) -- 0:00:39
347500 -- (-414.388) [-416.135] (-417.088) (-414.601) * [-416.759] (-417.204) (-413.526) (-419.035) -- 0:00:39
348000 -- (-416.591) [-413.029] (-418.917) (-416.026) * (-412.998) (-415.007) (-416.004) [-413.755] -- 0:00:39
348500 -- (-414.144) [-414.266] (-416.213) (-414.060) * [-415.298] (-416.432) (-415.304) (-416.587) -- 0:00:39
349000 -- (-416.383) [-414.451] (-415.236) (-414.717) * (-413.254) (-414.406) [-416.625] (-415.250) -- 0:00:39
349500 -- [-414.459] (-415.529) (-416.712) (-413.553) * (-417.853) (-416.060) (-413.595) [-415.111] -- 0:00:39
350000 -- (-416.552) (-416.082) (-414.480) [-413.693] * (-415.841) (-415.673) [-416.231] (-417.389) -- 0:00:39
Average standard deviation of split frequencies: 0.011259
350500 -- [-417.212] (-415.023) (-416.158) (-413.439) * (-418.571) (-414.404) (-415.206) [-415.035] -- 0:00:38
351000 -- (-414.873) (-417.755) [-414.022] (-414.682) * (-414.870) [-415.864] (-416.247) (-414.790) -- 0:00:38
351500 -- [-414.820] (-415.922) (-415.013) (-414.073) * (-414.208) [-418.563] (-414.155) (-413.993) -- 0:00:38
352000 -- (-413.921) (-415.302) [-416.150] (-418.713) * (-415.351) (-415.809) (-416.585) [-414.574] -- 0:00:38
352500 -- (-416.192) (-415.845) (-417.182) [-413.687] * [-414.823] (-416.438) (-415.220) (-413.357) -- 0:00:38
353000 -- (-415.199) (-414.957) (-414.423) [-415.548] * [-413.265] (-421.978) (-413.789) (-416.562) -- 0:00:38
353500 -- (-418.806) (-415.985) (-421.760) [-414.513] * (-416.096) [-412.963] (-416.415) (-418.426) -- 0:00:38
354000 -- [-417.248] (-415.534) (-423.573) (-415.364) * (-415.273) [-416.956] (-414.988) (-420.213) -- 0:00:38
354500 -- (-414.660) [-417.339] (-416.507) (-415.517) * [-414.741] (-415.444) (-414.207) (-415.430) -- 0:00:38
355000 -- (-416.565) [-413.490] (-415.228) (-416.270) * (-415.163) [-413.459] (-415.054) (-416.983) -- 0:00:38
Average standard deviation of split frequencies: 0.011918
355500 -- (-416.443) [-415.040] (-414.916) (-415.764) * (-416.029) (-415.519) [-414.529] (-417.196) -- 0:00:38
356000 -- (-416.058) [-413.179] (-417.503) (-416.214) * (-419.529) [-417.202] (-419.600) (-416.479) -- 0:00:37
356500 -- [-415.066] (-415.958) (-414.769) (-416.219) * [-416.872] (-416.905) (-413.424) (-415.403) -- 0:00:37
357000 -- (-413.276) [-414.941] (-415.408) (-414.969) * (-417.908) (-416.136) [-416.346] (-414.013) -- 0:00:37
357500 -- (-418.959) [-415.633] (-416.965) (-415.167) * [-415.275] (-416.465) (-418.220) (-416.500) -- 0:00:37
358000 -- [-414.590] (-415.578) (-414.706) (-415.828) * (-414.124) (-418.847) (-417.233) [-414.244] -- 0:00:37
358500 -- (-413.573) [-413.283] (-415.509) (-414.718) * (-414.567) (-414.737) (-415.881) [-413.831] -- 0:00:37
359000 -- (-418.996) (-414.472) [-413.580] (-415.666) * (-416.139) [-414.009] (-418.889) (-419.810) -- 0:00:37
359500 -- [-413.576] (-414.472) (-416.040) (-413.048) * (-417.201) (-415.330) (-413.513) [-413.574] -- 0:00:37
360000 -- [-413.369] (-413.977) (-414.822) (-416.357) * [-415.103] (-416.283) (-413.297) (-413.506) -- 0:00:37
Average standard deviation of split frequencies: 0.012907
360500 -- (-412.903) (-416.425) (-413.820) [-415.652] * (-412.980) [-417.902] (-415.912) (-413.406) -- 0:00:37
361000 -- (-415.832) (-415.106) [-415.222] (-414.329) * (-418.660) (-418.249) [-416.287] (-415.431) -- 0:00:38
361500 -- (-417.388) [-413.034] (-414.809) (-414.037) * [-413.875] (-414.737) (-415.990) (-419.303) -- 0:00:38
362000 -- (-414.793) (-416.979) [-414.865] (-414.247) * (-413.724) [-415.250] (-413.972) (-415.058) -- 0:00:38
362500 -- (-413.984) (-415.236) (-414.269) [-414.030] * (-415.887) (-416.954) [-413.541] (-414.000) -- 0:00:38
363000 -- (-415.112) (-417.512) (-415.186) [-416.909] * [-415.180] (-415.645) (-413.820) (-412.838) -- 0:00:38
363500 -- (-417.187) [-417.224] (-417.248) (-414.397) * (-414.804) (-414.082) [-414.609] (-413.957) -- 0:00:38
364000 -- (-420.303) [-417.144] (-416.103) (-414.142) * [-416.077] (-415.704) (-416.403) (-413.440) -- 0:00:38
364500 -- [-414.270] (-414.978) (-414.048) (-414.251) * (-415.539) (-415.178) [-418.028] (-415.743) -- 0:00:38
365000 -- (-415.561) (-422.050) [-416.175] (-417.354) * (-415.480) (-418.136) [-416.074] (-415.385) -- 0:00:38
Average standard deviation of split frequencies: 0.012397
365500 -- (-413.841) [-414.348] (-415.724) (-414.934) * [-414.540] (-420.041) (-415.623) (-414.978) -- 0:00:38
366000 -- [-414.196] (-416.067) (-413.210) (-414.848) * (-415.549) (-416.893) [-417.247] (-412.950) -- 0:00:38
366500 -- (-414.682) (-414.313) [-416.182] (-416.025) * (-416.508) (-415.729) (-415.905) [-412.869] -- 0:00:38
367000 -- (-413.570) (-418.580) (-418.476) [-416.411] * (-413.160) [-414.575] (-417.222) (-415.218) -- 0:00:37
367500 -- (-419.687) [-415.746] (-414.071) (-414.106) * (-413.210) (-414.420) [-413.692] (-413.669) -- 0:00:37
368000 -- (-417.443) (-415.582) [-413.310] (-414.183) * (-419.332) (-415.216) (-415.826) [-419.971] -- 0:00:37
368500 -- (-413.185) [-413.110] (-415.718) (-414.898) * [-417.450] (-416.627) (-418.457) (-414.808) -- 0:00:37
369000 -- (-414.812) [-414.824] (-418.017) (-415.174) * (-414.000) (-413.428) (-416.742) [-413.639] -- 0:00:37
369500 -- (-417.262) (-413.796) [-415.707] (-413.706) * (-418.906) [-413.813] (-415.809) (-413.128) -- 0:00:37
370000 -- [-414.142] (-417.351) (-416.553) (-416.425) * (-416.332) (-413.947) (-414.332) [-417.113] -- 0:00:37
Average standard deviation of split frequencies: 0.012956
370500 -- [-415.974] (-414.111) (-413.525) (-417.167) * (-415.875) [-413.185] (-413.067) (-418.177) -- 0:00:37
371000 -- (-418.269) [-415.275] (-413.107) (-414.741) * [-415.278] (-417.917) (-414.976) (-419.852) -- 0:00:37
371500 -- (-414.682) [-416.102] (-415.238) (-414.563) * (-414.315) (-415.203) [-413.898] (-414.911) -- 0:00:37
372000 -- (-416.449) (-414.006) [-414.939] (-416.357) * [-415.179] (-416.070) (-415.275) (-415.235) -- 0:00:37
372500 -- (-418.397) [-413.707] (-416.126) (-417.208) * (-417.194) (-414.542) [-416.547] (-416.097) -- 0:00:37
373000 -- (-415.329) (-414.667) (-414.322) [-416.763] * [-415.227] (-415.387) (-415.899) (-416.111) -- 0:00:36
373500 -- [-414.025] (-413.157) (-414.505) (-417.634) * (-415.278) (-415.445) (-413.332) [-415.016] -- 0:00:36
374000 -- (-414.503) (-413.187) (-413.780) [-415.584] * (-415.203) (-414.735) [-414.347] (-417.075) -- 0:00:36
374500 -- (-414.041) (-413.762) [-417.037] (-414.595) * [-413.600] (-418.003) (-414.660) (-416.591) -- 0:00:36
375000 -- (-414.334) [-413.313] (-413.854) (-414.805) * (-415.829) [-414.678] (-419.124) (-414.313) -- 0:00:36
Average standard deviation of split frequencies: 0.013349
375500 -- (-414.947) (-413.340) (-414.039) [-414.357] * (-415.679) (-417.244) [-416.954] (-414.474) -- 0:00:36
376000 -- (-418.704) (-413.344) [-414.103] (-413.647) * [-414.796] (-417.517) (-415.528) (-414.263) -- 0:00:36
376500 -- (-422.814) (-413.320) [-413.475] (-416.881) * (-417.135) (-416.757) [-413.799] (-417.533) -- 0:00:36
377000 -- (-423.746) (-415.166) (-414.007) [-415.582] * [-415.490] (-416.336) (-416.021) (-414.048) -- 0:00:36
377500 -- (-417.924) (-414.447) [-413.816] (-416.444) * [-414.523] (-416.029) (-415.975) (-412.882) -- 0:00:36
378000 -- (-413.186) (-414.005) [-413.048] (-414.682) * [-414.813] (-414.119) (-413.656) (-415.773) -- 0:00:37
378500 -- (-416.305) (-422.474) [-413.498] (-414.827) * (-413.223) (-413.958) [-413.272] (-415.495) -- 0:00:37
379000 -- (-416.100) (-414.361) [-415.010] (-414.500) * (-415.079) (-420.518) [-416.756] (-414.075) -- 0:00:37
379500 -- (-415.246) (-414.913) (-413.604) [-413.157] * [-415.721] (-417.471) (-416.352) (-418.506) -- 0:00:37
380000 -- (-415.451) (-419.887) (-413.293) [-413.427] * (-415.451) [-415.398] (-418.135) (-414.541) -- 0:00:37
Average standard deviation of split frequencies: 0.013416
380500 -- [-415.009] (-414.314) (-417.744) (-417.598) * (-413.607) (-415.444) (-414.957) [-418.910] -- 0:00:37
381000 -- (-419.894) [-414.975] (-415.667) (-413.439) * [-415.475] (-416.179) (-416.093) (-418.115) -- 0:00:37
381500 -- [-413.385] (-414.620) (-415.806) (-416.273) * (-419.553) (-414.318) [-413.660] (-414.771) -- 0:00:37
382000 -- (-417.401) (-415.504) (-414.338) [-417.083] * (-416.155) (-414.520) (-413.705) [-414.685] -- 0:00:37
382500 -- (-419.456) [-412.953] (-417.336) (-415.628) * (-414.503) [-412.846] (-415.248) (-414.310) -- 0:00:37
383000 -- (-418.815) (-414.750) (-414.385) [-416.824] * (-414.721) (-414.888) [-414.535] (-414.987) -- 0:00:37
383500 -- (-414.524) (-413.737) (-413.801) [-415.360] * [-414.450] (-414.169) (-415.877) (-413.374) -- 0:00:36
384000 -- (-414.340) (-413.391) [-413.687] (-420.703) * (-417.363) [-415.164] (-416.822) (-413.709) -- 0:00:36
384500 -- (-419.170) (-418.306) [-415.466] (-419.579) * (-416.488) [-413.718] (-415.820) (-415.329) -- 0:00:36
385000 -- (-418.982) [-414.475] (-416.715) (-415.239) * (-418.589) [-413.785] (-417.065) (-417.838) -- 0:00:36
Average standard deviation of split frequencies: 0.013434
385500 -- [-417.634] (-416.578) (-418.584) (-413.750) * [-417.119] (-416.915) (-414.000) (-417.190) -- 0:00:36
386000 -- (-416.340) (-416.575) [-416.034] (-413.598) * (-414.844) [-414.239] (-413.119) (-413.282) -- 0:00:36
386500 -- (-416.420) (-418.508) [-416.347] (-415.858) * (-415.601) (-417.869) [-414.987] (-414.238) -- 0:00:36
387000 -- [-415.723] (-415.471) (-414.338) (-415.031) * [-414.097] (-416.301) (-419.202) (-417.993) -- 0:00:36
387500 -- [-413.631] (-416.368) (-413.877) (-420.297) * (-415.676) [-416.093] (-414.564) (-417.490) -- 0:00:36
388000 -- (-419.034) (-416.188) [-413.043] (-419.622) * (-415.323) [-414.927] (-415.373) (-415.720) -- 0:00:36
388500 -- [-414.379] (-414.053) (-416.412) (-416.563) * (-414.358) [-413.334] (-413.595) (-415.675) -- 0:00:36
389000 -- [-417.282] (-414.673) (-413.887) (-417.245) * (-413.163) [-413.899] (-414.387) (-417.686) -- 0:00:36
389500 -- (-420.350) (-413.804) (-415.436) [-416.313] * [-414.662] (-415.765) (-418.855) (-414.161) -- 0:00:36
390000 -- (-417.914) (-413.963) (-416.184) [-414.955] * [-416.295] (-416.613) (-413.288) (-412.899) -- 0:00:35
Average standard deviation of split frequencies: 0.013474
390500 -- (-417.404) [-414.121] (-415.787) (-418.199) * (-414.657) (-413.977) [-413.219] (-413.973) -- 0:00:35
391000 -- (-413.736) (-415.952) [-414.887] (-415.978) * (-415.061) (-415.396) [-414.331] (-417.112) -- 0:00:35
391500 -- (-414.579) (-417.405) (-414.482) [-413.502] * (-414.889) [-413.879] (-414.398) (-416.992) -- 0:00:35
392000 -- (-414.292) [-416.223] (-414.160) (-415.127) * [-413.513] (-414.261) (-419.460) (-413.915) -- 0:00:35
392500 -- [-413.535] (-414.599) (-414.451) (-414.829) * (-415.122) (-413.904) [-413.943] (-413.403) -- 0:00:35
393000 -- [-413.043] (-413.356) (-413.668) (-416.048) * (-417.977) [-413.792] (-414.694) (-414.082) -- 0:00:35
393500 -- (-413.599) [-415.427] (-416.486) (-413.577) * [-415.913] (-413.751) (-415.220) (-420.657) -- 0:00:35
394000 -- [-415.098] (-414.679) (-416.498) (-414.146) * (-417.263) (-415.947) (-414.133) [-414.466] -- 0:00:35
394500 -- [-413.875] (-416.155) (-415.564) (-415.959) * (-421.528) (-414.274) [-413.531] (-413.940) -- 0:00:35
395000 -- [-414.645] (-414.379) (-414.943) (-415.541) * (-415.739) [-414.953] (-413.763) (-413.787) -- 0:00:36
Average standard deviation of split frequencies: 0.013305
395500 -- [-414.411] (-416.004) (-416.771) (-414.423) * [-414.746] (-414.471) (-414.818) (-415.644) -- 0:00:36
396000 -- (-413.368) (-413.704) [-416.447] (-415.011) * (-418.983) (-413.400) (-415.837) [-415.624] -- 0:00:36
396500 -- (-414.373) (-416.999) (-413.787) [-421.619] * (-416.557) [-413.580] (-413.097) (-413.823) -- 0:00:36
397000 -- (-413.648) (-418.204) [-415.065] (-414.300) * (-413.606) (-414.534) (-413.494) [-415.408] -- 0:00:36
397500 -- [-417.076] (-417.095) (-413.243) (-415.532) * (-414.337) (-415.012) [-415.589] (-418.158) -- 0:00:36
398000 -- [-416.136] (-413.642) (-418.324) (-414.935) * (-416.625) [-415.901] (-414.505) (-414.894) -- 0:00:36
398500 -- [-415.498] (-418.177) (-415.734) (-414.450) * (-416.500) (-417.828) [-420.715] (-414.517) -- 0:00:36
399000 -- (-418.356) (-418.235) (-416.955) [-414.647] * (-418.221) (-417.168) [-416.710] (-419.861) -- 0:00:36
399500 -- (-413.359) (-414.290) [-417.057] (-413.887) * (-416.954) [-413.309] (-415.846) (-416.340) -- 0:00:36
400000 -- [-415.480] (-415.807) (-414.252) (-415.121) * (-417.943) [-412.951] (-415.968) (-415.250) -- 0:00:36
Average standard deviation of split frequencies: 0.013703
400500 -- [-414.416] (-415.359) (-414.001) (-413.891) * [-417.432] (-418.567) (-412.817) (-413.723) -- 0:00:35
401000 -- (-418.194) (-414.126) [-417.600] (-415.037) * (-415.931) (-420.153) [-413.549] (-414.457) -- 0:00:35
401500 -- (-414.064) (-415.604) [-415.971] (-418.219) * [-418.688] (-417.129) (-421.460) (-414.822) -- 0:00:35
402000 -- (-414.234) (-415.309) (-419.478) [-419.554] * (-421.608) (-418.211) [-415.277] (-417.734) -- 0:00:35
402500 -- (-416.891) (-417.726) [-414.977] (-415.085) * (-414.395) [-417.226] (-414.399) (-415.725) -- 0:00:35
403000 -- [-415.351] (-419.347) (-415.777) (-414.676) * (-413.760) [-414.003] (-414.465) (-420.168) -- 0:00:35
403500 -- (-414.633) (-415.655) [-416.722] (-416.840) * (-418.714) (-414.917) (-414.288) [-417.187] -- 0:00:35
404000 -- (-416.064) (-415.857) (-427.312) [-417.705] * (-417.439) [-414.151] (-416.731) (-413.849) -- 0:00:35
404500 -- (-414.943) (-416.391) (-414.655) [-416.585] * (-414.247) (-415.422) (-415.948) [-415.895] -- 0:00:35
405000 -- (-413.117) [-416.639] (-418.077) (-415.017) * [-414.806] (-415.547) (-416.868) (-414.753) -- 0:00:35
Average standard deviation of split frequencies: 0.014001
405500 -- (-416.805) [-413.291] (-416.477) (-416.243) * (-414.984) [-414.051] (-422.701) (-414.215) -- 0:00:35
406000 -- (-420.840) [-415.023] (-416.686) (-414.021) * (-415.957) [-414.088] (-420.746) (-414.009) -- 0:00:35
406500 -- (-415.408) (-415.100) (-415.858) [-414.209] * (-414.650) (-414.840) [-415.676] (-416.489) -- 0:00:35
407000 -- (-416.720) [-415.465] (-418.493) (-414.328) * [-413.808] (-413.734) (-415.870) (-414.520) -- 0:00:34
407500 -- (-413.907) (-413.920) (-416.837) [-413.069] * [-413.701] (-415.875) (-415.798) (-413.546) -- 0:00:34
408000 -- (-413.327) (-415.075) (-413.748) [-413.564] * (-420.916) [-417.165] (-415.269) (-417.763) -- 0:00:34
408500 -- (-415.173) (-415.001) [-415.182] (-413.823) * [-413.574] (-415.286) (-414.098) (-413.320) -- 0:00:34
409000 -- (-417.250) (-412.832) [-414.484] (-413.780) * [-415.374] (-414.598) (-418.425) (-415.181) -- 0:00:34
409500 -- (-421.330) (-413.519) [-413.833] (-416.306) * (-416.789) [-415.824] (-415.033) (-414.160) -- 0:00:34
410000 -- [-416.534] (-413.389) (-414.537) (-416.784) * (-413.684) (-418.445) (-414.030) [-415.710] -- 0:00:35
Average standard deviation of split frequencies: 0.013775
410500 -- [-417.277] (-414.799) (-413.972) (-414.038) * (-413.770) (-417.302) [-415.362] (-414.838) -- 0:00:35
411000 -- [-415.496] (-418.819) (-415.202) (-415.371) * [-414.906] (-412.918) (-416.330) (-414.622) -- 0:00:35
411500 -- (-413.791) [-419.405] (-413.525) (-413.506) * (-415.441) [-413.111] (-414.947) (-416.273) -- 0:00:35
412000 -- [-415.562] (-416.265) (-413.384) (-414.813) * (-416.336) (-416.467) [-414.411] (-416.231) -- 0:00:35
412500 -- (-414.120) (-413.966) (-415.274) [-416.117] * (-417.946) (-415.159) (-417.689) [-419.242] -- 0:00:35
413000 -- (-416.084) [-414.482] (-416.228) (-415.392) * (-422.648) (-414.079) (-414.890) [-415.910] -- 0:00:35
413500 -- (-415.705) (-416.838) [-413.026] (-414.290) * (-421.023) [-416.494] (-415.768) (-414.529) -- 0:00:35
414000 -- (-417.006) (-414.772) (-419.937) [-413.820] * (-417.666) (-415.262) (-415.403) [-414.100] -- 0:00:35
414500 -- [-413.806] (-414.807) (-416.752) (-414.668) * (-418.862) (-415.081) (-412.915) [-416.314] -- 0:00:35
415000 -- [-415.185] (-413.953) (-415.965) (-413.926) * (-415.719) (-413.667) (-413.528) [-414.743] -- 0:00:35
Average standard deviation of split frequencies: 0.012532
415500 -- (-413.680) (-414.433) (-413.859) [-414.291] * (-414.477) (-413.462) (-418.944) [-413.631] -- 0:00:35
416000 -- (-413.776) [-415.652] (-413.239) (-414.569) * (-415.794) [-413.714] (-413.990) (-414.651) -- 0:00:35
416500 -- (-414.405) (-418.021) (-415.172) [-415.011] * (-416.641) (-414.986) (-417.552) [-417.234] -- 0:00:35
417000 -- (-414.922) (-418.734) (-416.434) [-416.659] * (-415.276) (-413.318) [-414.784] (-414.351) -- 0:00:34
417500 -- (-421.994) (-417.209) (-416.801) [-414.392] * [-416.905] (-416.070) (-417.991) (-415.230) -- 0:00:34
418000 -- [-417.286] (-414.733) (-414.064) (-415.095) * (-416.461) (-420.222) (-415.443) [-416.328] -- 0:00:34
418500 -- (-414.747) [-418.919] (-414.535) (-415.151) * (-414.007) (-413.141) (-415.064) [-413.632] -- 0:00:34
419000 -- (-417.369) [-414.089] (-417.601) (-414.246) * [-413.334] (-413.531) (-416.032) (-414.424) -- 0:00:34
419500 -- (-425.341) (-414.209) [-413.792] (-416.756) * [-412.946] (-413.746) (-414.317) (-413.766) -- 0:00:34
420000 -- (-420.436) (-416.386) [-413.755] (-418.067) * (-414.375) [-413.373] (-414.002) (-416.064) -- 0:00:34
Average standard deviation of split frequencies: 0.012187
420500 -- (-413.427) [-414.078] (-416.937) (-413.191) * [-415.430] (-416.732) (-413.026) (-413.851) -- 0:00:34
421000 -- (-417.046) (-417.244) [-417.604] (-414.587) * [-414.973] (-413.339) (-414.198) (-413.823) -- 0:00:34
421500 -- [-416.934] (-414.888) (-414.155) (-414.700) * (-414.921) [-416.419] (-416.723) (-414.421) -- 0:00:34
422000 -- (-417.422) (-414.807) [-419.230] (-415.308) * (-416.921) [-420.518] (-414.937) (-414.129) -- 0:00:34
422500 -- (-416.938) (-413.741) [-414.712] (-418.946) * (-416.354) (-414.108) (-416.032) [-414.675] -- 0:00:34
423000 -- (-415.207) (-413.363) (-415.824) [-416.492] * [-417.065] (-415.304) (-415.716) (-417.277) -- 0:00:34
423500 -- (-414.294) (-420.297) (-415.344) [-414.599] * [-415.298] (-415.353) (-415.705) (-415.650) -- 0:00:35
424000 -- (-417.526) (-423.476) (-414.091) [-415.084] * (-419.641) (-413.238) [-415.518] (-415.485) -- 0:00:35
424500 -- [-414.780] (-417.502) (-415.952) (-414.292) * [-419.002] (-414.619) (-416.895) (-413.391) -- 0:00:35
425000 -- (-416.806) [-414.345] (-415.402) (-414.683) * (-421.415) (-417.768) [-413.929] (-413.583) -- 0:00:35
Average standard deviation of split frequencies: 0.011847
425500 -- (-414.554) [-415.227] (-417.793) (-414.196) * (-418.911) (-419.745) (-413.401) [-418.500] -- 0:00:35
426000 -- (-413.821) (-416.396) (-417.039) [-414.925] * (-416.518) (-414.265) [-413.671] (-417.409) -- 0:00:35
426500 -- (-414.777) [-414.223] (-414.989) (-419.496) * [-417.466] (-414.510) (-415.251) (-420.350) -- 0:00:34
427000 -- (-416.743) (-416.265) [-415.479] (-416.951) * (-419.828) (-414.562) (-413.865) [-415.635] -- 0:00:34
427500 -- (-415.059) (-414.316) [-414.998] (-415.656) * (-416.585) (-414.389) [-418.848] (-418.327) -- 0:00:34
428000 -- (-415.153) (-415.006) (-418.351) [-414.088] * (-416.010) (-415.295) [-414.134] (-416.231) -- 0:00:34
428500 -- (-415.626) (-413.828) [-414.753] (-414.474) * (-414.549) [-413.620] (-416.859) (-416.699) -- 0:00:34
429000 -- (-413.762) (-413.619) (-415.195) [-414.076] * (-414.144) [-414.106] (-413.470) (-420.867) -- 0:00:34
429500 -- (-416.684) [-415.209] (-414.560) (-414.548) * (-414.330) (-416.540) [-414.071] (-416.521) -- 0:00:34
430000 -- (-414.756) [-417.311] (-414.731) (-413.424) * (-415.000) [-413.399] (-415.638) (-414.113) -- 0:00:34
Average standard deviation of split frequencies: 0.011461
430500 -- (-417.208) (-414.180) (-413.853) [-413.232] * (-416.578) [-413.423] (-413.678) (-414.146) -- 0:00:34
431000 -- (-414.248) (-419.513) (-414.858) [-414.062] * (-415.610) (-415.449) (-413.618) [-414.130] -- 0:00:34
431500 -- (-413.428) [-414.630] (-416.006) (-413.055) * (-414.228) (-416.153) (-416.225) [-417.223] -- 0:00:34
432000 -- (-413.243) (-414.651) [-416.181] (-414.769) * (-415.229) [-413.556] (-415.326) (-416.538) -- 0:00:34
432500 -- (-416.456) (-413.842) (-426.360) [-413.821] * (-415.365) (-417.042) (-415.256) [-418.087] -- 0:00:34
433000 -- [-415.710] (-413.977) (-417.238) (-415.645) * (-415.269) [-415.923] (-414.038) (-416.193) -- 0:00:34
433500 -- (-413.606) [-413.436] (-418.373) (-417.093) * (-414.298) [-415.197] (-413.470) (-415.870) -- 0:00:33
434000 -- (-417.576) (-415.638) (-416.767) [-418.334] * [-413.994] (-412.957) (-412.898) (-419.296) -- 0:00:33
434500 -- (-417.412) [-415.806] (-416.910) (-419.080) * (-413.563) [-413.542] (-413.802) (-416.219) -- 0:00:33
435000 -- [-413.290] (-415.911) (-418.776) (-420.506) * (-416.750) (-416.498) [-416.012] (-414.683) -- 0:00:33
Average standard deviation of split frequencies: 0.012148
435500 -- [-415.357] (-418.220) (-416.654) (-416.771) * [-416.402] (-415.108) (-418.955) (-416.296) -- 0:00:33
436000 -- (-415.447) [-415.212] (-414.712) (-416.764) * (-415.189) [-415.574] (-416.060) (-413.789) -- 0:00:33
436500 -- (-415.417) (-413.683) [-414.880] (-415.330) * (-417.957) (-415.158) (-414.204) [-414.361] -- 0:00:33
437000 -- (-415.390) (-413.569) (-413.641) [-415.045] * (-415.640) (-414.836) (-413.006) [-414.462] -- 0:00:33
437500 -- (-414.248) (-415.851) (-414.415) [-414.947] * (-416.251) (-415.110) [-414.529] (-414.752) -- 0:00:33
438000 -- (-413.772) (-417.534) (-417.186) [-418.010] * (-413.657) (-422.389) (-415.955) [-413.711] -- 0:00:33
438500 -- (-413.655) (-413.670) [-414.838] (-415.780) * (-414.231) (-423.744) [-415.150] (-413.543) -- 0:00:34
439000 -- [-415.452] (-415.077) (-415.448) (-414.023) * (-414.299) (-420.773) [-417.078] (-416.466) -- 0:00:34
439500 -- (-414.136) (-413.771) [-413.711] (-413.464) * [-414.359] (-414.921) (-416.575) (-416.534) -- 0:00:34
440000 -- (-418.204) (-413.821) (-414.857) [-416.426] * [-414.697] (-415.700) (-414.012) (-414.534) -- 0:00:34
Average standard deviation of split frequencies: 0.011830
440500 -- (-417.150) [-413.049] (-414.870) (-418.593) * (-415.765) (-417.423) (-416.171) [-415.040] -- 0:00:34
441000 -- (-414.747) [-419.290] (-417.522) (-418.333) * [-414.354] (-416.009) (-416.299) (-417.334) -- 0:00:34
441500 -- (-414.149) [-420.936] (-415.557) (-413.726) * (-415.450) (-415.479) (-416.259) [-416.677] -- 0:00:34
442000 -- (-413.910) (-415.798) [-414.057] (-413.897) * [-414.760] (-415.307) (-416.234) (-415.754) -- 0:00:34
442500 -- (-413.622) [-414.446] (-415.620) (-416.061) * (-415.383) [-414.165] (-415.403) (-415.668) -- 0:00:34
443000 -- (-417.137) [-413.776] (-415.830) (-413.772) * (-415.927) (-419.233) (-413.972) [-416.122] -- 0:00:33
443500 -- (-414.510) [-413.463] (-415.969) (-416.512) * (-416.101) [-415.243] (-413.380) (-416.280) -- 0:00:33
444000 -- [-414.204] (-417.966) (-417.189) (-417.323) * [-413.661] (-414.783) (-414.961) (-414.980) -- 0:00:33
444500 -- (-413.171) (-418.153) (-417.001) [-415.416] * [-413.653] (-415.410) (-414.042) (-415.092) -- 0:00:33
445000 -- (-414.630) [-414.237] (-415.055) (-415.214) * [-416.112] (-414.613) (-413.477) (-415.119) -- 0:00:33
Average standard deviation of split frequencies: 0.012310
445500 -- [-413.856] (-416.067) (-418.392) (-414.686) * (-413.600) (-413.199) (-414.519) [-414.495] -- 0:00:33
446000 -- (-414.501) (-413.232) (-421.383) [-416.089] * (-415.283) (-413.441) [-414.840] (-413.924) -- 0:00:33
446500 -- (-416.147) [-415.436] (-417.080) (-415.509) * (-421.314) (-413.319) (-416.666) [-415.153] -- 0:00:33
447000 -- (-416.584) (-414.681) [-417.365] (-413.454) * (-416.396) (-415.140) (-415.352) [-414.017] -- 0:00:33
447500 -- (-414.244) [-414.278] (-415.083) (-416.718) * (-413.752) [-414.990] (-417.043) (-419.465) -- 0:00:33
448000 -- (-414.380) (-413.187) [-416.118] (-417.882) * (-413.050) (-414.309) [-417.460] (-420.057) -- 0:00:33
448500 -- [-415.818] (-420.135) (-419.855) (-414.964) * (-412.979) [-413.477] (-414.105) (-413.300) -- 0:00:33
449000 -- [-415.348] (-417.823) (-417.741) (-413.384) * [-414.164] (-417.691) (-417.932) (-413.847) -- 0:00:33
449500 -- (-416.077) (-413.868) (-416.715) [-413.885] * [-414.889] (-417.109) (-415.360) (-415.439) -- 0:00:33
450000 -- (-415.175) (-416.925) (-414.295) [-414.086] * (-414.755) (-418.196) [-415.812] (-413.909) -- 0:00:33
Average standard deviation of split frequencies: 0.011937
450500 -- (-413.675) (-415.110) (-414.609) [-414.945] * (-419.575) [-415.276] (-415.078) (-416.689) -- 0:00:32
451000 -- (-413.826) (-417.339) [-415.393] (-414.895) * (-416.653) [-415.859] (-415.310) (-415.394) -- 0:00:34
451500 -- (-414.923) (-414.438) (-419.380) [-414.923] * [-417.264] (-416.476) (-419.422) (-414.384) -- 0:00:34
452000 -- [-414.604] (-416.307) (-420.423) (-414.747) * (-418.964) (-418.050) (-416.124) [-414.010] -- 0:00:33
452500 -- (-415.628) (-417.564) (-415.668) [-414.133] * (-414.072) (-415.295) [-418.610] (-414.207) -- 0:00:33
453000 -- (-416.084) (-414.128) [-417.545] (-415.481) * (-414.152) (-413.634) (-414.884) [-413.138] -- 0:00:33
453500 -- [-413.692] (-419.252) (-422.329) (-413.223) * [-416.423] (-418.260) (-416.318) (-413.525) -- 0:00:33
454000 -- (-417.454) [-414.427] (-415.361) (-414.439) * (-414.508) (-418.013) [-414.510] (-414.785) -- 0:00:33
454500 -- (-414.204) (-414.117) [-415.529] (-416.225) * [-416.545] (-413.746) (-413.190) (-414.987) -- 0:00:33
455000 -- (-418.357) (-413.254) [-413.089] (-414.784) * (-415.452) [-413.984] (-415.957) (-415.195) -- 0:00:33
Average standard deviation of split frequencies: 0.011797
455500 -- [-415.951] (-413.597) (-413.598) (-416.177) * (-414.416) (-414.812) [-414.355] (-417.156) -- 0:00:33
456000 -- (-414.026) (-412.968) (-413.889) [-414.133] * (-414.758) (-420.830) [-414.969] (-415.567) -- 0:00:33
456500 -- (-414.457) [-414.266] (-414.845) (-414.777) * (-415.696) [-415.320] (-415.039) (-416.298) -- 0:00:33
457000 -- (-415.386) (-416.776) [-414.398] (-414.509) * (-416.588) (-415.040) [-415.769] (-416.837) -- 0:00:33
457500 -- (-414.452) [-414.333] (-415.868) (-419.536) * (-415.780) (-417.463) [-417.959] (-414.440) -- 0:00:33
458000 -- (-418.869) [-416.380] (-414.653) (-419.101) * (-415.359) (-413.949) (-415.066) [-414.370] -- 0:00:33
458500 -- [-413.833] (-415.179) (-417.182) (-419.098) * (-415.604) (-416.143) [-414.346] (-417.486) -- 0:00:33
459000 -- (-414.583) (-415.739) [-415.602] (-419.600) * (-413.110) [-413.322] (-415.364) (-414.896) -- 0:00:33
459500 -- (-414.433) (-414.681) [-415.230] (-413.372) * (-418.224) [-416.129] (-414.719) (-414.992) -- 0:00:32
460000 -- (-420.107) (-414.195) (-419.626) [-415.190] * (-412.912) (-416.226) [-413.736] (-414.690) -- 0:00:32
Average standard deviation of split frequencies: 0.012099
460500 -- (-414.806) [-417.208] (-416.918) (-413.804) * [-412.943] (-416.942) (-414.112) (-413.432) -- 0:00:32
461000 -- (-418.053) [-415.289] (-413.442) (-415.850) * (-413.311) [-414.525] (-418.049) (-414.761) -- 0:00:32
461500 -- (-418.394) [-413.750] (-415.493) (-419.692) * (-415.834) (-416.121) [-415.309] (-417.435) -- 0:00:32
462000 -- (-419.133) [-414.417] (-415.068) (-416.286) * (-417.153) (-415.913) [-414.229] (-415.363) -- 0:00:32
462500 -- (-415.191) (-415.397) (-414.660) [-415.768] * (-420.539) [-418.111] (-413.973) (-413.655) -- 0:00:32
463000 -- (-415.623) (-414.225) [-415.054] (-413.711) * (-418.057) (-414.379) (-417.200) [-415.273] -- 0:00:32
463500 -- (-413.973) [-415.329] (-414.259) (-415.216) * (-414.889) (-415.212) (-417.603) [-415.052] -- 0:00:32
464000 -- [-414.139] (-415.502) (-416.409) (-416.518) * (-417.358) (-416.810) (-419.273) [-413.991] -- 0:00:32
464500 -- [-415.775] (-419.264) (-413.402) (-413.534) * (-413.908) (-417.013) [-415.347] (-419.044) -- 0:00:32
465000 -- (-415.432) (-418.024) (-413.250) [-414.607] * (-413.897) (-414.175) [-413.601] (-415.642) -- 0:00:33
Average standard deviation of split frequencies: 0.012139
465500 -- (-419.817) (-415.274) (-413.299) [-416.232] * [-413.757] (-415.489) (-413.736) (-416.465) -- 0:00:33
466000 -- [-413.829] (-416.625) (-413.494) (-416.310) * (-417.113) (-414.868) [-413.268] (-417.233) -- 0:00:33
466500 -- [-414.097] (-416.640) (-414.649) (-414.996) * (-415.351) [-414.105] (-417.185) (-414.928) -- 0:00:33
467000 -- (-414.934) (-415.922) [-414.692] (-414.286) * (-414.588) (-418.754) [-421.914] (-417.189) -- 0:00:33
467500 -- (-414.605) [-414.442] (-417.770) (-416.127) * (-417.064) (-416.492) [-420.733] (-419.121) -- 0:00:33
468000 -- (-414.386) (-415.138) [-416.295] (-413.588) * (-419.186) (-414.952) (-414.437) [-417.492] -- 0:00:32
468500 -- [-414.796] (-416.937) (-414.087) (-415.376) * (-414.470) (-416.219) (-415.366) [-414.781] -- 0:00:32
469000 -- (-418.090) (-416.235) (-414.515) [-414.531] * (-415.537) (-415.230) [-416.115] (-414.128) -- 0:00:32
469500 -- (-414.310) [-414.555] (-415.438) (-414.059) * [-414.504] (-415.154) (-416.897) (-414.958) -- 0:00:32
470000 -- (-417.368) [-413.878] (-413.714) (-413.578) * (-420.359) [-418.658] (-418.969) (-413.827) -- 0:00:32
Average standard deviation of split frequencies: 0.012844
470500 -- [-414.838] (-416.282) (-413.942) (-413.559) * (-413.203) [-415.829] (-414.515) (-414.541) -- 0:00:32
471000 -- (-413.403) (-414.599) [-413.267] (-414.745) * (-416.050) (-415.121) [-414.847] (-413.634) -- 0:00:32
471500 -- (-413.391) (-416.116) [-413.349] (-416.422) * (-418.498) [-415.387] (-416.447) (-416.967) -- 0:00:32
472000 -- [-416.195] (-416.274) (-414.162) (-419.799) * (-413.874) (-414.625) [-414.424] (-414.834) -- 0:00:32
472500 -- [-413.802] (-414.293) (-413.890) (-417.705) * [-414.378] (-416.129) (-414.732) (-415.503) -- 0:00:32
473000 -- [-413.882] (-413.777) (-413.255) (-417.011) * (-414.407) (-413.186) (-416.669) [-418.121] -- 0:00:32
473500 -- (-413.724) (-416.276) [-414.529] (-413.795) * (-416.088) [-413.207] (-414.331) (-413.823) -- 0:00:32
474000 -- (-413.907) (-414.812) (-413.319) [-415.785] * (-415.358) [-414.965] (-418.053) (-416.577) -- 0:00:32
474500 -- [-413.759] (-417.086) (-414.949) (-415.334) * [-414.600] (-415.085) (-415.968) (-416.359) -- 0:00:32
475000 -- (-418.622) [-415.242] (-417.493) (-416.617) * [-413.470] (-417.241) (-414.345) (-422.979) -- 0:00:32
Average standard deviation of split frequencies: 0.012408
475500 -- (-414.740) (-417.813) (-415.546) [-418.190] * (-415.443) [-415.905] (-415.404) (-415.719) -- 0:00:31
476000 -- (-415.744) [-414.766] (-413.842) (-412.837) * (-417.838) (-415.816) [-416.369] (-414.432) -- 0:00:31
476500 -- (-416.747) (-414.316) (-416.937) [-414.063] * (-413.669) [-413.599] (-414.412) (-414.655) -- 0:00:31
477000 -- (-414.099) (-417.407) (-417.421) [-414.580] * (-413.207) [-418.464] (-415.896) (-417.204) -- 0:00:31
477500 -- (-414.979) [-414.003] (-414.510) (-414.563) * (-415.049) (-417.509) (-415.578) [-412.914] -- 0:00:31
478000 -- (-416.679) (-414.699) [-415.049] (-416.275) * (-414.470) [-417.143] (-419.463) (-415.388) -- 0:00:31
478500 -- (-414.780) (-418.201) (-417.161) [-412.808] * (-416.249) [-416.468] (-416.230) (-419.288) -- 0:00:31
479000 -- [-413.340] (-415.424) (-413.978) (-412.873) * (-414.121) [-414.628] (-420.529) (-416.971) -- 0:00:31
479500 -- (-417.798) [-414.264] (-415.930) (-414.819) * [-413.141] (-414.826) (-414.360) (-415.246) -- 0:00:31
480000 -- [-415.376] (-415.363) (-414.821) (-414.956) * (-417.191) (-416.049) (-417.216) [-415.208] -- 0:00:31
Average standard deviation of split frequencies: 0.011884
480500 -- (-416.564) (-417.788) [-414.687] (-414.603) * (-414.790) (-412.764) [-415.250] (-414.859) -- 0:00:32
481000 -- [-413.073] (-416.860) (-414.280) (-413.697) * (-415.052) [-413.222] (-414.844) (-417.610) -- 0:00:32
481500 -- (-414.853) [-414.193] (-415.528) (-413.731) * (-414.151) (-415.074) [-413.593] (-417.394) -- 0:00:32
482000 -- [-414.501] (-416.679) (-418.449) (-413.691) * (-414.488) (-415.797) [-415.566] (-414.280) -- 0:00:32
482500 -- [-414.290] (-415.367) (-413.505) (-414.560) * (-414.271) (-419.167) (-414.927) [-414.664] -- 0:00:32
483000 -- (-414.883) (-414.972) (-415.506) [-415.554] * (-416.094) [-415.283] (-415.396) (-414.527) -- 0:00:32
483500 -- (-413.539) (-416.832) (-416.675) [-415.625] * (-414.607) [-418.736] (-414.987) (-414.522) -- 0:00:32
484000 -- (-416.842) [-414.224] (-414.859) (-413.635) * [-416.395] (-417.764) (-415.625) (-414.739) -- 0:00:31
484500 -- (-415.407) (-417.480) [-414.582] (-414.094) * (-412.957) (-416.346) [-414.173] (-416.983) -- 0:00:31
485000 -- (-418.876) (-413.956) (-416.907) [-416.510] * (-413.306) (-415.304) [-420.640] (-417.631) -- 0:00:31
Average standard deviation of split frequencies: 0.011925
485500 -- (-416.277) (-413.508) (-416.665) [-414.591] * (-413.219) [-416.684] (-418.788) (-425.543) -- 0:00:31
486000 -- (-414.550) [-416.672] (-415.723) (-419.263) * [-416.439] (-414.522) (-416.306) (-414.153) -- 0:00:31
486500 -- (-414.792) (-414.724) [-416.567] (-414.766) * (-416.847) [-413.736] (-413.576) (-414.628) -- 0:00:31
487000 -- (-413.172) [-413.863] (-413.058) (-415.497) * (-413.905) (-412.880) (-413.129) [-413.979] -- 0:00:31
487500 -- (-414.908) (-413.771) (-414.014) [-414.386] * [-414.147] (-414.249) (-415.916) (-416.364) -- 0:00:31
488000 -- (-415.754) (-413.186) (-417.484) [-414.342] * (-413.633) [-414.717] (-417.840) (-418.183) -- 0:00:31
488500 -- (-418.995) (-417.607) (-415.268) [-414.009] * [-413.613] (-414.293) (-414.204) (-416.002) -- 0:00:31
489000 -- [-413.478] (-417.508) (-414.726) (-416.573) * (-417.242) [-413.714] (-415.053) (-415.941) -- 0:00:31
489500 -- (-414.479) [-415.926] (-414.383) (-413.383) * (-418.370) (-413.934) (-414.550) [-417.206] -- 0:00:31
490000 -- (-414.917) (-415.437) (-413.936) [-415.753] * [-414.532] (-416.200) (-414.093) (-414.701) -- 0:00:31
Average standard deviation of split frequencies: 0.012264
490500 -- (-416.590) [-414.093] (-413.711) (-415.983) * (-414.331) (-413.856) [-412.971] (-414.792) -- 0:00:31
491000 -- (-413.622) (-417.582) [-415.342] (-416.777) * (-419.189) (-414.704) [-413.453] (-418.018) -- 0:00:31
491500 -- (-413.366) (-417.579) (-416.094) [-418.846] * (-415.635) [-413.228] (-413.282) (-415.832) -- 0:00:31
492000 -- [-415.894] (-420.217) (-416.442) (-413.062) * (-416.740) (-415.369) (-415.970) [-415.782] -- 0:00:30
492500 -- (-416.100) (-416.922) [-414.849] (-413.607) * [-413.046] (-414.504) (-416.261) (-415.297) -- 0:00:30
493000 -- (-414.598) (-414.755) [-415.048] (-415.903) * (-415.086) (-414.632) (-416.040) [-415.953] -- 0:00:30
493500 -- (-414.123) (-414.621) [-415.513] (-418.811) * (-416.525) [-414.353] (-414.869) (-419.877) -- 0:00:30
494000 -- (-416.204) [-413.604] (-416.213) (-416.404) * [-418.699] (-415.991) (-416.601) (-416.805) -- 0:00:30
494500 -- (-416.780) [-414.877] (-414.828) (-413.670) * (-416.712) [-414.431] (-417.176) (-413.708) -- 0:00:30
495000 -- (-413.586) [-418.492] (-415.587) (-417.573) * (-413.863) (-415.026) (-423.824) [-413.264] -- 0:00:30
Average standard deviation of split frequencies: 0.011908
495500 -- (-417.466) [-414.110] (-412.945) (-414.432) * [-416.053] (-412.953) (-413.881) (-415.546) -- 0:00:31
496000 -- [-414.626] (-414.202) (-415.754) (-415.640) * [-414.571] (-413.536) (-413.921) (-417.682) -- 0:00:31
496500 -- (-414.312) [-418.893] (-417.253) (-419.730) * (-416.342) (-415.224) [-414.889] (-414.436) -- 0:00:31
497000 -- (-417.514) [-417.601] (-415.590) (-425.271) * [-414.254] (-418.237) (-413.936) (-416.112) -- 0:00:31
497500 -- (-416.383) (-419.229) [-414.209] (-422.085) * (-414.340) (-415.528) (-418.863) [-413.417] -- 0:00:31
498000 -- (-423.496) [-414.662] (-414.562) (-416.746) * (-415.967) (-414.408) [-415.267] (-414.455) -- 0:00:31
498500 -- (-415.175) (-413.877) (-415.216) [-414.448] * (-413.891) [-416.005] (-417.073) (-414.934) -- 0:00:31
499000 -- (-415.091) (-413.886) (-414.603) [-413.711] * (-415.762) (-417.225) (-416.187) [-416.002] -- 0:00:31
499500 -- [-417.576] (-413.039) (-417.071) (-415.999) * [-414.946] (-417.654) (-416.686) (-414.772) -- 0:00:31
500000 -- [-415.729] (-414.356) (-413.249) (-416.543) * [-418.493] (-421.703) (-419.590) (-415.734) -- 0:00:31
Average standard deviation of split frequencies: 0.011243
500500 -- [-414.396] (-412.938) (-414.507) (-417.482) * [-413.336] (-420.487) (-413.513) (-416.858) -- 0:00:30
501000 -- (-414.325) [-415.008] (-415.614) (-415.351) * (-417.880) (-415.001) [-413.228] (-414.794) -- 0:00:30
501500 -- (-414.494) [-413.694] (-416.359) (-417.042) * (-418.154) (-414.121) (-418.994) [-416.541] -- 0:00:30
502000 -- (-419.098) (-413.413) (-415.870) [-413.725] * (-416.000) (-416.421) (-418.590) [-413.926] -- 0:00:30
502500 -- (-414.912) [-417.891] (-413.107) (-416.798) * (-417.017) [-418.085] (-417.581) (-416.524) -- 0:00:30
503000 -- [-414.247] (-415.780) (-414.251) (-414.854) * (-414.334) [-416.537] (-417.401) (-414.697) -- 0:00:30
503500 -- (-413.797) [-415.268] (-417.491) (-414.627) * [-413.431] (-418.288) (-416.891) (-416.054) -- 0:00:30
504000 -- (-415.638) (-415.972) (-421.353) [-414.329] * (-416.496) (-417.920) [-413.826] (-417.973) -- 0:00:30
504500 -- (-417.004) (-415.764) (-417.313) [-414.610] * (-416.657) (-416.859) [-414.899] (-413.824) -- 0:00:30
505000 -- (-416.564) [-415.139] (-417.338) (-414.853) * (-413.216) [-415.685] (-413.822) (-417.143) -- 0:00:30
Average standard deviation of split frequencies: 0.011618
505500 -- [-415.065] (-414.002) (-415.267) (-414.485) * [-416.062] (-413.419) (-415.652) (-414.733) -- 0:00:30
506000 -- [-413.374] (-413.491) (-415.086) (-413.714) * (-414.303) [-415.075] (-417.245) (-417.906) -- 0:00:30
506500 -- (-415.321) (-415.614) [-416.141] (-413.841) * (-416.306) [-413.229] (-413.729) (-414.251) -- 0:00:30
507000 -- (-414.076) [-413.359] (-414.240) (-415.751) * (-418.905) (-414.559) (-415.461) [-414.311] -- 0:00:30
507500 -- (-414.436) [-415.486] (-415.494) (-417.262) * (-414.330) [-414.246] (-414.453) (-412.829) -- 0:00:30
508000 -- (-415.153) [-416.383] (-416.940) (-419.498) * [-416.742] (-419.224) (-419.059) (-413.910) -- 0:00:30
508500 -- (-415.650) (-415.438) [-414.726] (-415.735) * (-419.512) (-416.431) (-414.715) [-416.384] -- 0:00:29
509000 -- [-414.899] (-415.208) (-416.793) (-415.841) * (-415.370) (-416.780) (-414.666) [-416.743] -- 0:00:29
509500 -- (-415.035) (-418.552) (-414.720) [-416.693] * (-414.445) (-414.433) (-414.804) [-413.853] -- 0:00:29
510000 -- (-414.142) (-415.062) [-413.755] (-415.257) * (-413.939) [-413.847] (-418.804) (-416.672) -- 0:00:29
Average standard deviation of split frequencies: 0.010860
510500 -- (-417.272) (-415.182) [-415.277] (-414.908) * [-413.596] (-416.396) (-413.943) (-418.555) -- 0:00:29
511000 -- (-417.192) (-417.410) (-413.687) [-413.952] * (-413.856) (-417.730) (-415.011) [-414.010] -- 0:00:29
511500 -- [-413.488] (-413.608) (-414.642) (-414.224) * (-414.630) (-414.852) [-417.617] (-416.368) -- 0:00:29
512000 -- (-414.863) (-413.707) [-416.325] (-415.979) * (-414.848) [-415.298] (-415.791) (-413.831) -- 0:00:30
512500 -- [-417.280] (-419.032) (-415.152) (-413.764) * [-414.323] (-414.890) (-415.793) (-415.025) -- 0:00:30
513000 -- (-418.512) [-415.013] (-414.157) (-417.479) * (-416.941) (-413.282) (-416.815) [-413.995] -- 0:00:30
513500 -- (-415.865) [-413.176] (-414.105) (-412.850) * (-414.467) (-417.972) (-418.839) [-413.673] -- 0:00:30
514000 -- (-415.449) (-413.429) [-416.892] (-414.205) * (-416.050) (-413.732) [-417.426] (-414.858) -- 0:00:30
514500 -- (-415.128) (-417.398) [-415.851] (-414.862) * [-415.060] (-415.097) (-415.383) (-414.449) -- 0:00:30
515000 -- (-417.183) (-416.563) [-416.262] (-416.805) * (-415.509) [-413.513] (-414.980) (-415.157) -- 0:00:30
Average standard deviation of split frequencies: 0.011124
515500 -- (-414.055) (-413.893) [-415.037] (-414.043) * [-415.204] (-413.221) (-420.509) (-416.983) -- 0:00:30
516000 -- (-413.660) (-412.986) (-416.974) [-416.132] * [-412.853] (-419.111) (-419.614) (-417.429) -- 0:00:30
516500 -- [-413.643] (-414.935) (-416.385) (-417.198) * [-413.533] (-422.632) (-414.782) (-414.168) -- 0:00:29
517000 -- (-414.910) (-416.641) (-415.173) [-415.200] * (-416.341) [-415.533] (-415.454) (-417.243) -- 0:00:29
517500 -- (-414.832) [-416.984] (-418.840) (-414.958) * (-415.799) [-415.145] (-413.892) (-417.512) -- 0:00:29
518000 -- [-416.067] (-416.566) (-418.554) (-418.363) * (-415.046) (-416.815) [-413.547] (-413.842) -- 0:00:29
518500 -- (-413.569) (-417.508) [-415.880] (-419.984) * (-415.513) [-414.987] (-414.355) (-415.333) -- 0:00:29
519000 -- (-417.514) [-415.177] (-413.854) (-415.961) * (-416.517) (-415.692) [-413.894] (-413.306) -- 0:00:29
519500 -- (-413.821) (-416.046) [-414.781] (-415.645) * (-415.523) (-414.616) [-414.445] (-417.269) -- 0:00:29
520000 -- (-415.109) (-413.791) (-416.430) [-416.159] * (-424.514) (-414.794) (-415.284) [-416.297] -- 0:00:29
Average standard deviation of split frequencies: 0.011877
520500 -- (-414.407) (-414.701) (-417.957) [-419.696] * (-418.794) (-415.337) [-416.485] (-414.267) -- 0:00:29
521000 -- (-414.197) [-417.228] (-413.540) (-414.356) * (-419.509) (-413.408) [-415.109] (-417.197) -- 0:00:29
521500 -- (-416.042) (-418.631) [-417.924] (-414.485) * [-415.844] (-414.439) (-414.973) (-416.392) -- 0:00:29
522000 -- (-415.740) [-414.117] (-414.968) (-415.646) * (-416.389) (-415.028) [-414.523] (-416.432) -- 0:00:29
522500 -- (-413.905) (-413.629) [-416.647] (-417.460) * (-415.987) (-416.686) [-414.848] (-416.040) -- 0:00:29
523000 -- (-414.672) [-413.734] (-416.935) (-413.866) * [-414.892] (-415.563) (-415.583) (-415.384) -- 0:00:29
523500 -- (-414.073) (-415.862) [-414.757] (-415.319) * (-413.282) [-416.428] (-416.014) (-414.932) -- 0:00:29
524000 -- [-415.221] (-417.055) (-416.038) (-415.856) * (-413.522) [-416.784] (-415.334) (-416.391) -- 0:00:29
524500 -- (-415.928) (-417.682) [-414.020] (-414.397) * (-416.683) [-413.887] (-418.059) (-415.951) -- 0:00:29
525000 -- [-413.909] (-418.348) (-414.481) (-413.843) * (-417.519) (-414.653) [-417.547] (-414.167) -- 0:00:28
Average standard deviation of split frequencies: 0.011282
525500 -- (-414.739) [-414.151] (-413.654) (-417.754) * (-417.338) [-413.959] (-419.558) (-415.112) -- 0:00:28
526000 -- (-415.999) [-414.500] (-415.344) (-413.782) * (-414.948) (-416.681) (-413.745) [-418.727] -- 0:00:28
526500 -- (-414.353) [-413.494] (-413.277) (-413.248) * (-416.703) (-413.957) [-414.403] (-413.788) -- 0:00:28
527000 -- (-414.454) (-415.516) [-415.725] (-416.135) * (-414.441) (-415.441) [-414.659] (-413.398) -- 0:00:28
527500 -- (-414.106) [-413.957] (-415.445) (-414.902) * (-415.073) [-415.314] (-416.566) (-414.460) -- 0:00:28
528000 -- (-418.045) (-415.676) (-415.828) [-413.863] * (-415.429) [-412.813] (-416.101) (-419.300) -- 0:00:28
528500 -- (-417.053) (-415.490) [-413.788] (-417.230) * (-414.658) (-415.876) (-414.357) [-413.393] -- 0:00:28
529000 -- (-416.821) (-415.848) (-413.285) [-421.942] * (-416.292) [-416.466] (-415.704) (-414.650) -- 0:00:29
529500 -- (-415.914) [-415.510] (-413.354) (-417.035) * [-413.262] (-415.251) (-415.391) (-414.306) -- 0:00:29
530000 -- (-416.449) [-414.814] (-413.178) (-418.328) * (-416.589) [-415.797] (-416.743) (-416.502) -- 0:00:29
Average standard deviation of split frequencies: 0.010555
530500 -- (-416.030) [-414.057] (-416.425) (-416.467) * [-414.520] (-416.257) (-416.816) (-414.271) -- 0:00:29
531000 -- (-417.834) (-414.996) [-414.101] (-414.898) * [-418.580] (-414.184) (-414.445) (-415.055) -- 0:00:29
531500 -- (-419.388) (-415.180) (-414.434) [-414.264] * (-416.312) (-414.793) [-413.615] (-417.187) -- 0:00:29
532000 -- (-415.627) [-414.867] (-415.771) (-415.503) * (-416.734) (-418.514) [-414.335] (-418.581) -- 0:00:29
532500 -- (-414.469) [-413.660] (-414.700) (-414.366) * [-413.828] (-418.309) (-416.082) (-414.819) -- 0:00:28
533000 -- (-417.630) (-424.272) [-414.013] (-412.983) * (-415.140) (-417.770) [-413.614] (-414.275) -- 0:00:28
533500 -- (-416.402) (-419.892) [-413.407] (-415.427) * (-418.050) [-416.552] (-417.977) (-416.064) -- 0:00:28
534000 -- (-418.756) [-416.182] (-412.956) (-414.789) * (-415.851) (-417.460) [-419.611] (-413.546) -- 0:00:28
534500 -- (-413.900) (-416.822) [-414.976] (-413.821) * (-420.582) [-414.145] (-416.215) (-414.802) -- 0:00:28
535000 -- (-414.087) (-414.857) [-414.579] (-413.303) * (-417.853) [-413.118] (-414.090) (-415.069) -- 0:00:28
Average standard deviation of split frequencies: 0.010813
535500 -- (-417.135) [-416.710] (-416.817) (-414.768) * [-413.020] (-413.268) (-412.952) (-417.371) -- 0:00:28
536000 -- (-417.757) (-420.631) (-417.937) [-416.376] * (-414.279) [-417.214] (-415.833) (-417.682) -- 0:00:28
536500 -- (-414.876) (-423.583) (-418.530) [-416.972] * (-416.795) [-414.707] (-415.015) (-413.969) -- 0:00:28
537000 -- [-415.462] (-419.952) (-414.386) (-417.282) * (-414.619) (-416.032) (-416.036) [-415.466] -- 0:00:28
537500 -- [-413.579] (-413.339) (-414.078) (-414.694) * (-413.853) [-417.663] (-417.121) (-414.486) -- 0:00:28
538000 -- [-418.479] (-414.686) (-413.540) (-415.528) * (-414.933) [-414.784] (-413.292) (-418.345) -- 0:00:28
538500 -- (-417.590) (-414.322) (-413.378) [-414.372] * [-416.378] (-413.295) (-414.080) (-416.127) -- 0:00:28
539000 -- (-417.771) [-413.450] (-414.264) (-416.072) * (-414.717) (-415.326) (-414.562) [-415.116] -- 0:00:28
539500 -- (-413.972) (-415.530) [-413.218] (-416.401) * (-414.122) [-416.302] (-417.372) (-415.068) -- 0:00:28
540000 -- (-419.756) [-416.567] (-412.926) (-414.096) * (-413.398) (-416.258) (-415.307) [-416.476] -- 0:00:28
Average standard deviation of split frequencies: 0.010360
540500 -- (-416.079) (-413.460) (-414.445) [-414.983] * [-417.629] (-414.937) (-416.436) (-415.617) -- 0:00:28
541000 -- (-415.714) (-416.654) (-413.247) [-415.772] * [-414.624] (-415.182) (-417.231) (-414.928) -- 0:00:27
541500 -- (-415.729) (-414.762) [-416.163] (-416.939) * (-414.804) (-414.638) [-414.159] (-413.896) -- 0:00:27
542000 -- (-417.399) (-413.813) (-415.924) [-419.433] * (-417.074) [-414.768] (-415.621) (-413.254) -- 0:00:27
542500 -- (-419.359) [-413.843] (-413.435) (-413.863) * (-414.706) [-414.292] (-416.413) (-413.356) -- 0:00:27
543000 -- [-414.710] (-415.686) (-414.993) (-413.288) * (-413.402) (-416.808) (-417.056) [-415.276] -- 0:00:27
543500 -- (-417.521) [-414.213] (-415.260) (-413.276) * (-415.536) [-413.002] (-418.111) (-413.384) -- 0:00:27
544000 -- (-415.589) (-415.452) (-415.828) [-414.212] * [-415.325] (-414.064) (-414.435) (-413.251) -- 0:00:27
544500 -- (-414.483) (-416.435) [-415.710] (-420.493) * (-417.321) (-415.014) (-414.762) [-415.063] -- 0:00:27
545000 -- (-415.940) (-413.586) (-414.873) [-417.202] * [-414.489] (-415.640) (-419.551) (-415.111) -- 0:00:27
Average standard deviation of split frequencies: 0.010513
545500 -- (-416.474) (-415.691) (-414.822) [-417.197] * (-415.396) (-414.282) (-417.787) [-414.070] -- 0:00:28
546000 -- (-420.692) (-413.409) [-414.348] (-415.549) * (-417.428) (-413.555) [-413.517] (-414.804) -- 0:00:28
546500 -- [-414.391] (-413.398) (-415.665) (-416.294) * (-413.343) (-413.201) [-413.742] (-415.548) -- 0:00:28
547000 -- [-415.825] (-413.542) (-415.216) (-417.603) * (-419.704) [-414.258] (-413.499) (-413.921) -- 0:00:28
547500 -- (-416.878) (-417.466) [-415.358] (-416.478) * [-414.227] (-416.164) (-413.619) (-414.889) -- 0:00:28
548000 -- [-413.871] (-415.860) (-416.139) (-415.474) * [-415.565] (-414.610) (-415.420) (-415.971) -- 0:00:28
548500 -- (-414.311) (-418.981) (-414.261) [-415.504] * [-416.156] (-414.306) (-418.770) (-415.730) -- 0:00:27
549000 -- (-414.002) [-413.603] (-413.924) (-414.798) * [-416.560] (-421.054) (-416.955) (-417.065) -- 0:00:27
549500 -- (-414.626) [-415.987] (-415.362) (-415.943) * (-415.027) (-417.269) [-413.843] (-414.336) -- 0:00:27
550000 -- [-415.040] (-415.509) (-413.919) (-417.358) * (-416.405) (-417.195) [-413.946] (-414.927) -- 0:00:27
Average standard deviation of split frequencies: 0.010373
550500 -- (-414.214) [-415.061] (-413.786) (-413.405) * [-415.903] (-417.184) (-414.968) (-413.422) -- 0:00:27
551000 -- (-416.600) (-416.676) (-413.482) [-414.065] * [-419.313] (-414.656) (-415.211) (-416.817) -- 0:00:27
551500 -- (-415.399) (-414.105) [-415.331] (-414.497) * (-416.325) [-415.128] (-416.343) (-417.383) -- 0:00:27
552000 -- (-413.774) (-415.019) (-413.481) [-412.969] * (-414.325) (-415.347) [-414.964] (-415.611) -- 0:00:27
552500 -- (-414.545) (-418.224) (-414.006) [-414.976] * (-414.653) [-417.611] (-417.528) (-418.316) -- 0:00:27
553000 -- (-414.500) (-417.155) [-414.980] (-415.831) * (-414.024) (-414.904) [-415.245] (-414.001) -- 0:00:27
553500 -- (-415.038) (-415.914) (-415.174) [-415.225] * (-413.769) (-412.889) [-414.948] (-414.961) -- 0:00:27
554000 -- (-418.017) (-414.030) (-413.441) [-415.497] * (-415.751) [-412.844] (-422.889) (-415.755) -- 0:00:27
554500 -- [-415.971] (-413.925) (-419.685) (-413.904) * (-414.061) (-417.348) (-415.550) [-415.802] -- 0:00:27
555000 -- (-413.426) [-414.720] (-414.963) (-418.509) * (-413.072) (-415.895) [-414.108] (-419.637) -- 0:00:27
Average standard deviation of split frequencies: 0.010573
555500 -- (-413.895) (-415.251) [-413.945] (-417.177) * (-415.009) (-415.230) (-414.623) [-414.967] -- 0:00:27
556000 -- (-420.006) [-414.457] (-417.677) (-421.131) * (-421.912) (-413.696) (-415.647) [-413.066] -- 0:00:27
556500 -- [-416.625] (-416.674) (-414.331) (-416.904) * (-415.873) [-412.879] (-413.879) (-416.743) -- 0:00:27
557000 -- (-417.474) [-418.329] (-413.684) (-418.152) * (-413.700) (-413.311) (-413.511) [-413.493] -- 0:00:27
557500 -- (-413.434) [-420.427] (-414.116) (-414.167) * (-419.161) (-418.700) (-415.282) [-418.229] -- 0:00:26
558000 -- (-416.970) (-417.217) [-414.993] (-413.826) * [-414.088] (-416.098) (-414.193) (-413.187) -- 0:00:26
558500 -- (-414.679) (-417.814) (-415.295) [-414.202] * (-414.488) (-414.284) [-414.568] (-413.759) -- 0:00:26
559000 -- [-412.957] (-415.702) (-416.488) (-416.130) * (-414.604) (-414.520) (-417.940) [-416.555] -- 0:00:26
559500 -- (-413.597) [-413.318] (-414.119) (-415.642) * (-418.756) (-413.324) [-415.235] (-413.255) -- 0:00:26
560000 -- [-418.168] (-415.540) (-414.826) (-414.527) * (-419.457) (-413.643) (-418.705) [-414.032] -- 0:00:26
Average standard deviation of split frequencies: 0.011277
560500 -- (-415.722) (-414.025) (-415.341) [-414.291] * (-417.623) (-415.053) [-416.438] (-413.892) -- 0:00:26
561000 -- (-415.379) (-414.590) (-417.832) [-417.385] * [-414.102] (-413.698) (-418.781) (-416.058) -- 0:00:26
561500 -- (-414.658) [-415.137] (-413.286) (-418.409) * (-415.439) [-413.722] (-416.439) (-417.495) -- 0:00:26
562000 -- [-413.821] (-415.366) (-415.425) (-417.153) * [-415.266] (-414.779) (-415.531) (-414.422) -- 0:00:26
562500 -- (-413.044) [-415.578] (-418.040) (-414.684) * [-415.747] (-413.697) (-414.169) (-414.414) -- 0:00:27
563000 -- [-416.923] (-416.523) (-415.440) (-417.017) * (-415.433) [-414.932] (-414.132) (-414.161) -- 0:00:27
563500 -- (-415.105) (-414.279) [-414.890] (-416.042) * (-414.342) (-416.561) [-415.606] (-414.737) -- 0:00:27
564000 -- [-414.602] (-414.794) (-414.246) (-415.700) * (-414.481) [-418.339] (-418.629) (-414.452) -- 0:00:27
564500 -- (-416.175) (-414.172) [-417.348] (-413.382) * (-414.103) [-415.370] (-414.904) (-416.684) -- 0:00:27
565000 -- (-423.059) (-415.310) (-418.080) [-417.670] * [-414.216] (-417.462) (-417.579) (-415.871) -- 0:00:26
Average standard deviation of split frequencies: 0.012030
565500 -- [-413.691] (-418.379) (-414.180) (-420.803) * (-413.566) (-425.365) (-416.670) [-414.277] -- 0:00:26
566000 -- (-414.461) (-415.867) [-415.042] (-416.285) * [-415.035] (-420.365) (-416.808) (-417.081) -- 0:00:26
566500 -- (-420.069) (-416.621) [-418.887] (-414.631) * (-413.085) (-415.144) [-415.512] (-416.409) -- 0:00:26
567000 -- (-414.030) [-414.196] (-422.792) (-414.115) * [-413.048] (-413.880) (-414.544) (-414.515) -- 0:00:26
567500 -- (-417.914) [-414.546] (-425.505) (-414.235) * (-414.761) (-416.414) (-413.779) [-413.627] -- 0:00:26
568000 -- (-421.820) [-416.526] (-417.290) (-415.184) * (-413.941) [-420.211] (-414.688) (-414.913) -- 0:00:26
568500 -- [-416.349] (-414.010) (-413.373) (-413.550) * (-414.479) [-419.506] (-414.981) (-415.732) -- 0:00:26
569000 -- (-413.986) [-414.189] (-413.228) (-414.328) * [-414.708] (-416.880) (-418.166) (-415.979) -- 0:00:26
569500 -- (-414.182) (-413.530) [-413.418] (-417.432) * (-413.180) (-413.727) (-414.480) [-414.266] -- 0:00:26
570000 -- (-414.824) (-414.943) [-414.027] (-418.556) * (-419.014) [-414.747] (-414.258) (-413.499) -- 0:00:26
Average standard deviation of split frequencies: 0.012207
570500 -- (-418.624) [-413.970] (-413.946) (-416.439) * (-415.321) (-414.786) [-413.758] (-414.448) -- 0:00:26
571000 -- (-418.523) (-414.230) [-415.491] (-419.221) * (-415.963) (-417.108) (-415.649) [-414.848] -- 0:00:26
571500 -- (-414.953) (-415.709) [-416.378] (-420.650) * [-421.424] (-415.610) (-416.803) (-415.685) -- 0:00:26
572000 -- (-416.474) (-415.890) (-417.760) [-417.492] * (-415.342) (-414.461) (-416.999) [-416.532] -- 0:00:26
572500 -- (-417.398) [-412.898] (-413.531) (-415.356) * (-414.795) (-415.356) [-414.806] (-414.759) -- 0:00:26
573000 -- (-413.848) (-414.306) (-414.334) [-419.079] * (-420.561) [-417.166] (-414.600) (-416.726) -- 0:00:26
573500 -- (-415.001) [-415.314] (-413.247) (-415.253) * [-416.360] (-415.085) (-416.147) (-416.177) -- 0:00:26
574000 -- [-413.474] (-415.473) (-415.111) (-416.706) * (-416.344) (-413.861) (-417.236) [-413.947] -- 0:00:25
574500 -- (-413.372) (-414.965) [-420.251] (-415.710) * (-414.874) [-413.940] (-416.196) (-416.405) -- 0:00:25
575000 -- (-417.688) (-413.824) (-417.927) [-416.417] * (-417.368) [-415.214] (-415.206) (-417.858) -- 0:00:25
Average standard deviation of split frequencies: 0.012322
575500 -- (-418.546) (-416.016) [-416.334] (-420.410) * (-419.251) [-414.385] (-415.663) (-414.503) -- 0:00:25
576000 -- (-413.402) [-416.962] (-415.670) (-413.877) * [-413.614] (-414.906) (-413.375) (-414.255) -- 0:00:25
576500 -- (-414.355) [-414.894] (-414.875) (-415.124) * [-414.512] (-420.274) (-413.943) (-416.703) -- 0:00:25
577000 -- (-413.581) (-415.548) (-417.658) [-414.712] * (-414.862) (-423.214) (-414.612) [-416.439] -- 0:00:25
577500 -- [-417.045] (-415.265) (-415.900) (-416.574) * (-418.078) (-417.344) (-415.049) [-415.369] -- 0:00:25
578000 -- (-416.927) (-412.925) (-415.188) [-414.094] * (-417.009) [-416.144] (-414.626) (-413.067) -- 0:00:25
578500 -- (-414.386) (-414.045) (-413.906) [-416.919] * (-417.890) (-414.679) [-418.468] (-413.747) -- 0:00:25
579000 -- (-414.441) [-414.968] (-413.578) (-417.363) * (-416.327) (-417.747) [-414.807] (-417.467) -- 0:00:26
579500 -- [-414.404] (-413.862) (-415.433) (-419.628) * (-416.547) (-413.659) (-415.499) [-415.070] -- 0:00:26
580000 -- (-415.874) (-415.424) (-416.799) [-416.850] * (-415.800) (-417.638) [-414.273] (-415.246) -- 0:00:26
Average standard deviation of split frequencies: 0.011907
580500 -- (-415.799) (-414.528) (-415.078) [-415.425] * (-413.585) (-420.332) [-413.415] (-415.006) -- 0:00:26
581000 -- [-414.471] (-417.083) (-419.357) (-415.199) * (-416.500) (-414.153) (-413.925) [-413.548] -- 0:00:25
581500 -- (-414.101) (-417.974) [-413.649] (-413.970) * (-422.413) [-413.712] (-413.882) (-413.950) -- 0:00:25
582000 -- (-413.248) [-415.482] (-416.449) (-415.380) * (-416.544) (-414.234) (-415.735) [-416.443] -- 0:00:25
582500 -- (-413.205) (-415.399) (-414.281) [-416.647] * (-413.470) [-415.523] (-415.078) (-427.665) -- 0:00:25
583000 -- (-413.190) (-415.401) (-414.021) [-415.443] * [-413.031] (-414.052) (-413.153) (-414.927) -- 0:00:25
583500 -- (-414.705) (-415.628) (-417.966) [-413.749] * [-415.172] (-413.805) (-412.798) (-413.449) -- 0:00:25
584000 -- (-413.728) [-419.841] (-418.339) (-416.237) * (-418.148) (-417.724) (-413.620) [-416.862] -- 0:00:25
584500 -- (-414.835) (-415.766) [-413.667] (-413.615) * [-414.802] (-414.191) (-414.984) (-413.600) -- 0:00:25
585000 -- (-417.105) [-415.012] (-414.378) (-415.353) * (-413.923) (-418.617) (-415.860) [-414.217] -- 0:00:25
Average standard deviation of split frequencies: 0.012829
585500 -- (-419.561) [-415.183] (-413.974) (-421.639) * (-414.789) [-415.218] (-413.419) (-414.073) -- 0:00:25
586000 -- (-422.478) [-414.332] (-417.706) (-419.421) * (-417.068) (-413.967) [-415.887] (-415.984) -- 0:00:25
586500 -- (-419.481) (-416.108) [-415.037] (-420.437) * (-415.932) (-414.440) [-415.540] (-414.119) -- 0:00:25
587000 -- [-416.148] (-414.392) (-417.688) (-417.439) * (-413.660) (-414.202) (-414.722) [-413.445] -- 0:00:25
587500 -- [-414.916] (-414.702) (-415.775) (-418.886) * (-414.962) (-415.947) [-414.763] (-413.291) -- 0:00:25
588000 -- (-414.378) (-419.270) [-415.668] (-414.300) * (-414.509) (-417.145) [-414.311] (-416.167) -- 0:00:25
588500 -- (-414.764) [-417.442] (-416.551) (-414.304) * (-413.851) (-413.774) [-414.604] (-413.148) -- 0:00:25
589000 -- (-414.971) [-414.415] (-413.608) (-415.182) * [-415.510] (-414.863) (-417.243) (-413.087) -- 0:00:25
589500 -- [-412.918] (-415.417) (-414.783) (-413.873) * (-416.068) [-416.883] (-417.531) (-414.969) -- 0:00:25
590000 -- (-413.992) (-414.305) (-414.149) [-413.022] * (-415.096) (-415.953) (-413.651) [-416.561] -- 0:00:25
Average standard deviation of split frequencies: 0.012636
590500 -- (-416.276) (-420.009) [-414.299] (-413.777) * (-414.102) (-413.474) [-415.336] (-414.377) -- 0:00:24
591000 -- (-414.545) (-414.977) (-420.351) [-415.954] * (-416.295) (-414.767) (-416.230) [-418.520] -- 0:00:24
591500 -- (-413.896) (-413.549) (-414.293) [-414.558] * (-413.612) [-414.478] (-414.012) (-415.204) -- 0:00:24
592000 -- (-415.713) [-413.978] (-414.118) (-416.142) * [-413.636] (-415.860) (-414.753) (-416.782) -- 0:00:24
592500 -- (-414.232) [-414.428] (-421.915) (-416.879) * (-413.211) (-415.620) [-413.770] (-416.829) -- 0:00:24
593000 -- (-415.022) (-415.856) [-414.763] (-414.927) * (-414.028) (-412.933) (-415.062) [-416.656] -- 0:00:24
593500 -- (-415.846) (-414.257) [-415.061] (-417.396) * [-413.384] (-414.338) (-418.457) (-413.743) -- 0:00:24
594000 -- [-416.725] (-419.070) (-413.520) (-417.216) * [-413.676] (-413.821) (-415.255) (-415.418) -- 0:00:24
594500 -- (-418.795) (-416.248) (-417.290) [-421.507] * (-414.133) (-415.535) (-414.926) [-415.089] -- 0:00:24
595000 -- (-415.300) (-415.349) [-416.648] (-423.636) * (-415.873) [-417.281] (-415.788) (-419.004) -- 0:00:24
Average standard deviation of split frequencies: 0.012172
595500 -- (-416.284) [-415.201] (-416.304) (-413.544) * [-417.612] (-413.221) (-417.004) (-414.331) -- 0:00:24
596000 -- (-414.420) (-416.048) [-417.323] (-413.266) * (-417.760) [-414.068] (-418.227) (-413.941) -- 0:00:25
596500 -- (-415.226) (-415.170) (-413.794) [-414.352] * [-414.717] (-414.295) (-416.399) (-415.657) -- 0:00:25
597000 -- [-413.605] (-415.220) (-417.557) (-413.952) * (-414.617) (-414.157) (-414.515) [-414.785] -- 0:00:24
597500 -- (-419.882) (-414.209) (-417.828) [-415.319] * [-414.459] (-415.235) (-413.859) (-414.388) -- 0:00:24
598000 -- [-413.307] (-418.873) (-419.042) (-421.699) * (-415.970) (-416.787) (-420.029) [-414.440] -- 0:00:24
598500 -- [-413.483] (-415.457) (-416.091) (-415.225) * (-414.372) [-415.049] (-413.752) (-413.387) -- 0:00:24
599000 -- (-415.563) [-417.497] (-414.503) (-416.480) * (-413.485) (-414.382) [-415.107] (-413.307) -- 0:00:24
599500 -- [-414.311] (-414.597) (-415.257) (-416.062) * [-414.513] (-416.323) (-414.819) (-415.260) -- 0:00:24
600000 -- (-420.298) (-414.395) (-417.746) [-414.243] * (-418.905) [-416.691] (-423.095) (-414.134) -- 0:00:24
Average standard deviation of split frequencies: 0.012095
600500 -- (-417.421) (-416.944) (-414.470) [-415.939] * [-414.987] (-414.803) (-416.589) (-417.658) -- 0:00:24
601000 -- (-419.303) (-417.288) [-414.988] (-419.800) * (-414.790) (-413.779) [-416.853] (-414.056) -- 0:00:24
601500 -- (-414.777) [-413.609] (-416.032) (-415.458) * (-413.883) [-413.281] (-415.667) (-415.250) -- 0:00:24
602000 -- (-415.369) [-417.238] (-414.120) (-420.681) * [-415.127] (-413.984) (-414.052) (-414.936) -- 0:00:24
602500 -- [-418.348] (-415.740) (-413.643) (-415.819) * (-415.156) (-413.786) (-416.135) [-417.196] -- 0:00:24
603000 -- [-413.544] (-415.946) (-418.145) (-414.988) * (-416.447) [-413.571] (-417.275) (-413.886) -- 0:00:24
603500 -- (-416.151) [-413.730] (-418.134) (-413.940) * (-415.523) [-417.133] (-413.067) (-414.579) -- 0:00:24
604000 -- [-416.045] (-415.477) (-414.426) (-416.755) * (-413.238) (-415.677) (-413.736) [-413.994] -- 0:00:24
604500 -- [-413.802] (-414.248) (-415.196) (-413.743) * [-416.746] (-413.828) (-414.191) (-415.341) -- 0:00:24
605000 -- (-413.992) [-414.125] (-416.086) (-413.104) * [-412.924] (-417.396) (-414.594) (-415.020) -- 0:00:24
Average standard deviation of split frequencies: 0.011806
605500 -- (-417.769) (-417.473) (-414.729) [-413.821] * (-413.217) (-414.328) [-415.435] (-415.565) -- 0:00:24
606000 -- (-418.654) [-416.351] (-414.296) (-417.162) * (-415.952) (-414.137) (-416.559) [-413.543] -- 0:00:24
606500 -- [-414.102] (-416.293) (-417.054) (-416.882) * [-415.077] (-413.615) (-415.363) (-416.749) -- 0:00:24
607000 -- (-413.712) (-418.109) (-414.787) [-415.166] * (-417.878) [-413.714] (-419.733) (-414.979) -- 0:00:23
607500 -- (-413.114) [-416.942] (-415.337) (-413.813) * (-419.304) (-413.654) [-416.811] (-414.576) -- 0:00:23
608000 -- (-414.108) (-418.614) [-414.403] (-413.974) * (-416.031) (-413.367) [-415.572] (-415.185) -- 0:00:23
608500 -- [-413.523] (-414.697) (-415.812) (-413.234) * (-414.181) (-415.073) (-418.708) [-415.302] -- 0:00:23
609000 -- (-417.259) [-416.075] (-416.310) (-419.923) * (-419.935) (-413.997) [-414.845] (-415.802) -- 0:00:23
609500 -- (-415.051) (-415.595) [-413.976] (-418.727) * (-417.772) [-413.595] (-416.481) (-417.563) -- 0:00:23
610000 -- (-413.936) [-412.976] (-416.483) (-414.790) * (-415.209) (-414.136) (-414.629) [-416.727] -- 0:00:23
Average standard deviation of split frequencies: 0.012079
610500 -- (-416.525) [-414.435] (-413.485) (-415.680) * (-416.727) (-416.360) [-414.561] (-414.621) -- 0:00:23
611000 -- (-413.626) (-413.214) (-418.059) [-414.159] * (-415.473) (-416.373) [-413.984] (-415.422) -- 0:00:23
611500 -- (-416.468) [-414.743] (-417.262) (-413.432) * (-415.882) (-415.795) (-416.132) [-418.167] -- 0:00:23
612000 -- [-414.097] (-420.805) (-417.270) (-415.220) * (-416.040) (-418.068) [-414.343] (-418.868) -- 0:00:23
612500 -- (-414.626) [-418.679] (-413.833) (-415.302) * (-414.028) (-417.981) (-415.676) [-419.024] -- 0:00:24
613000 -- (-415.155) (-415.377) [-414.384] (-418.807) * (-413.256) (-414.143) (-415.265) [-416.450] -- 0:00:23
613500 -- [-413.870] (-413.475) (-416.835) (-418.292) * (-417.062) [-413.217] (-415.053) (-417.078) -- 0:00:23
614000 -- (-413.833) (-415.386) (-419.639) [-414.421] * (-415.023) [-413.203] (-413.164) (-413.713) -- 0:00:23
614500 -- [-415.297] (-417.892) (-415.662) (-416.438) * (-416.350) [-414.438] (-417.826) (-415.087) -- 0:00:23
615000 -- [-415.376] (-417.583) (-416.782) (-415.077) * [-413.705] (-418.128) (-413.732) (-416.298) -- 0:00:23
Average standard deviation of split frequencies: 0.012149
615500 -- (-416.180) [-414.681] (-417.748) (-415.519) * (-416.074) (-415.138) [-413.861] (-415.267) -- 0:00:23
616000 -- (-415.602) [-414.601] (-418.466) (-414.182) * (-416.239) (-414.475) (-416.589) [-415.841] -- 0:00:23
616500 -- (-416.302) (-415.038) (-414.673) [-414.556] * (-413.375) [-413.339] (-417.459) (-419.395) -- 0:00:23
617000 -- [-413.133] (-416.104) (-413.512) (-419.040) * [-414.712] (-413.947) (-415.274) (-417.348) -- 0:00:23
617500 -- (-413.475) (-415.753) [-412.951] (-416.054) * (-415.690) (-415.618) (-423.292) [-417.197] -- 0:00:23
618000 -- [-414.817] (-416.305) (-417.976) (-415.809) * [-414.785] (-416.913) (-416.342) (-413.560) -- 0:00:23
618500 -- (-413.255) (-416.693) (-418.016) [-417.085] * (-415.370) [-414.275] (-414.968) (-415.485) -- 0:00:23
619000 -- (-413.862) (-413.084) (-418.179) [-416.615] * (-414.727) (-416.944) [-415.297] (-413.378) -- 0:00:23
619500 -- (-417.603) (-413.370) (-413.896) [-415.602] * (-414.435) [-416.974] (-419.116) (-414.861) -- 0:00:23
620000 -- (-416.333) (-420.290) (-414.990) [-413.931] * (-415.335) (-415.041) [-414.882] (-417.817) -- 0:00:23
Average standard deviation of split frequencies: 0.012376
620500 -- (-415.187) (-416.922) (-413.997) [-417.961] * (-416.963) [-417.383] (-415.906) (-413.809) -- 0:00:23
621000 -- (-415.793) (-413.965) (-418.595) [-415.990] * (-415.323) (-413.983) [-414.354] (-415.384) -- 0:00:23
621500 -- (-414.093) (-414.060) (-414.977) [-414.231] * (-415.737) [-414.146] (-415.927) (-416.111) -- 0:00:23
622000 -- (-414.128) (-414.566) [-413.181] (-412.939) * [-415.668] (-415.131) (-416.543) (-414.626) -- 0:00:23
622500 -- [-415.376] (-416.310) (-415.973) (-414.383) * (-418.143) (-416.403) [-418.081] (-413.426) -- 0:00:23
623000 -- (-414.730) (-413.555) (-416.672) [-413.324] * [-414.934] (-417.003) (-415.980) (-413.817) -- 0:00:22
623500 -- (-418.795) [-414.186] (-414.726) (-414.782) * (-417.531) (-413.848) (-415.723) [-414.020] -- 0:00:22
624000 -- [-415.256] (-417.862) (-418.039) (-416.179) * (-413.186) [-413.634] (-413.898) (-415.139) -- 0:00:22
624500 -- (-416.824) (-413.715) [-417.325] (-413.685) * (-415.026) (-414.456) [-417.738] (-414.449) -- 0:00:22
625000 -- (-415.590) [-414.170] (-426.689) (-415.640) * (-416.195) (-417.237) (-417.028) [-413.927] -- 0:00:22
Average standard deviation of split frequencies: 0.012757
625500 -- (-418.265) (-414.349) (-414.713) [-415.335] * (-416.978) (-416.390) (-416.482) [-413.650] -- 0:00:22
626000 -- (-417.008) (-416.439) [-417.944] (-414.168) * (-417.346) (-414.787) (-420.443) [-413.004] -- 0:00:22
626500 -- (-413.794) [-414.724] (-417.312) (-418.293) * (-418.233) [-414.817] (-413.415) (-415.343) -- 0:00:22
627000 -- (-414.021) (-414.694) [-418.955] (-415.848) * (-417.084) (-416.044) (-415.945) [-415.312] -- 0:00:22
627500 -- (-416.307) (-415.629) (-419.918) [-415.978] * [-413.262] (-414.136) (-415.293) (-415.143) -- 0:00:22
628000 -- (-415.911) (-415.462) (-415.473) [-414.308] * (-413.357) (-417.651) [-416.351] (-414.455) -- 0:00:22
628500 -- (-414.971) (-414.726) (-414.176) [-413.857] * (-414.036) (-415.828) (-416.743) [-419.078] -- 0:00:22
629000 -- (-413.515) (-419.101) [-416.789] (-413.227) * (-413.419) (-419.438) (-413.008) [-415.356] -- 0:00:22
629500 -- (-415.201) [-417.744] (-414.375) (-417.687) * (-413.964) (-415.479) [-415.345] (-416.298) -- 0:00:22
630000 -- (-416.568) (-415.142) (-416.057) [-414.044] * (-414.767) (-415.809) (-414.949) [-414.038] -- 0:00:22
Average standard deviation of split frequencies: 0.012427
630500 -- (-416.830) (-418.268) (-413.825) [-414.906] * (-415.930) (-418.271) (-415.439) [-412.917] -- 0:00:22
631000 -- [-415.116] (-413.188) (-413.558) (-414.447) * [-413.996] (-416.451) (-418.035) (-417.545) -- 0:00:22
631500 -- [-413.700] (-415.061) (-413.704) (-415.619) * (-415.543) (-417.324) [-418.755] (-414.257) -- 0:00:22
632000 -- [-414.387] (-414.877) (-413.401) (-416.456) * [-415.629] (-417.945) (-414.094) (-414.641) -- 0:00:22
632500 -- (-417.049) (-417.728) (-414.804) [-413.930] * (-413.560) [-413.655] (-413.471) (-416.290) -- 0:00:22
633000 -- (-414.888) (-414.593) [-413.971] (-414.390) * (-419.505) (-415.709) [-414.541] (-415.751) -- 0:00:22
633500 -- (-413.502) (-415.821) (-415.740) [-413.741] * (-420.247) (-413.469) [-414.115] (-418.245) -- 0:00:22
634000 -- [-413.965] (-415.788) (-418.107) (-417.992) * (-416.850) (-417.984) (-416.385) [-415.308] -- 0:00:22
634500 -- (-414.558) (-418.743) (-413.751) [-419.620] * (-413.451) [-422.040] (-417.209) (-415.860) -- 0:00:22
635000 -- (-416.432) (-414.558) [-414.709] (-416.327) * (-413.455) (-417.543) (-413.261) [-414.030] -- 0:00:22
Average standard deviation of split frequencies: 0.012971
635500 -- (-422.134) (-415.800) [-413.239] (-416.373) * [-414.501] (-415.085) (-412.872) (-413.881) -- 0:00:22
636000 -- (-414.330) (-417.483) (-413.257) [-414.432] * (-415.199) [-416.013] (-413.442) (-415.058) -- 0:00:22
636500 -- (-414.649) [-414.008] (-414.959) (-413.235) * (-416.131) [-415.046] (-414.771) (-416.616) -- 0:00:22
637000 -- (-414.247) [-414.900] (-415.689) (-413.739) * [-413.902] (-414.396) (-420.690) (-412.799) -- 0:00:22
637500 -- (-414.912) (-419.569) (-414.504) [-414.076] * (-414.237) [-413.289] (-419.918) (-415.165) -- 0:00:22
638000 -- [-414.841] (-415.984) (-416.422) (-414.350) * (-414.527) [-415.204] (-419.205) (-414.179) -- 0:00:22
638500 -- (-421.792) (-414.280) (-414.253) [-417.011] * (-416.852) (-416.696) [-413.315] (-413.522) -- 0:00:22
639000 -- (-415.572) [-415.035] (-417.282) (-414.306) * [-413.857] (-414.754) (-415.310) (-413.969) -- 0:00:22
639500 -- [-413.927] (-415.184) (-417.373) (-413.783) * (-417.635) [-418.133] (-413.435) (-416.162) -- 0:00:21
640000 -- [-419.097] (-416.817) (-414.168) (-417.777) * (-413.556) (-416.296) (-415.204) [-413.823] -- 0:00:21
Average standard deviation of split frequencies: 0.012417
640500 -- (-418.208) (-415.126) [-413.817] (-414.067) * (-417.995) [-415.381] (-414.255) (-414.788) -- 0:00:21
641000 -- (-415.166) (-413.365) [-414.473] (-413.217) * (-416.388) (-415.869) (-416.356) [-414.789] -- 0:00:21
641500 -- [-416.180] (-414.569) (-417.712) (-414.924) * (-415.939) [-414.914] (-415.220) (-414.603) -- 0:00:21
642000 -- [-414.874] (-416.993) (-416.030) (-414.318) * (-413.587) [-416.409] (-415.902) (-415.204) -- 0:00:21
642500 -- (-414.443) (-416.791) [-414.646] (-414.657) * (-414.441) (-419.824) [-415.061] (-414.983) -- 0:00:21
643000 -- (-415.581) (-416.099) [-414.069] (-414.637) * (-417.661) [-417.839] (-419.793) (-413.861) -- 0:00:21
643500 -- [-413.639] (-418.372) (-415.507) (-415.371) * (-415.717) (-417.932) (-416.448) [-416.090] -- 0:00:21
644000 -- [-419.771] (-415.496) (-415.504) (-414.487) * (-417.839) (-416.595) [-414.569] (-417.005) -- 0:00:21
644500 -- (-415.662) (-414.453) [-415.646] (-415.440) * (-415.331) (-422.207) (-413.352) [-414.174] -- 0:00:21
645000 -- (-414.760) (-418.200) [-416.938] (-414.165) * (-414.099) (-417.668) (-413.305) [-413.913] -- 0:00:21
Average standard deviation of split frequencies: 0.013307
645500 -- (-413.546) (-416.651) [-416.061] (-417.377) * (-415.354) (-419.307) [-417.046] (-417.123) -- 0:00:21
646000 -- (-416.017) (-418.381) (-415.010) [-418.764] * (-415.161) (-417.792) (-413.704) [-416.540] -- 0:00:21
646500 -- (-414.068) (-413.036) [-417.581] (-415.121) * (-418.543) (-414.291) (-415.168) [-413.984] -- 0:00:21
647000 -- (-414.390) [-413.584] (-415.569) (-416.857) * (-413.859) [-414.831] (-416.348) (-414.151) -- 0:00:21
647500 -- [-413.949] (-413.359) (-416.778) (-415.377) * (-413.183) [-415.792] (-420.563) (-420.547) -- 0:00:21
648000 -- (-415.138) (-417.035) [-419.331] (-414.746) * (-414.570) (-413.435) (-418.715) [-415.287] -- 0:00:21
648500 -- (-414.728) (-415.543) (-415.329) [-415.894] * (-413.365) (-418.739) (-414.797) [-414.685] -- 0:00:21
649000 -- (-413.866) (-414.205) [-415.768] (-414.244) * [-414.976] (-415.600) (-415.873) (-414.622) -- 0:00:21
649500 -- (-416.827) (-414.718) (-414.928) [-417.075] * (-419.524) (-416.343) [-414.949] (-415.446) -- 0:00:21
650000 -- (-416.397) (-418.591) (-413.591) [-414.102] * (-414.745) [-415.159] (-414.669) (-415.115) -- 0:00:21
Average standard deviation of split frequencies: 0.012181
650500 -- (-419.737) (-414.217) (-416.660) [-413.955] * [-414.251] (-415.882) (-423.751) (-416.757) -- 0:00:21
651000 -- [-418.306] (-413.029) (-415.252) (-416.591) * (-413.818) [-416.218] (-415.654) (-413.436) -- 0:00:21
651500 -- [-417.679] (-417.148) (-416.867) (-415.913) * [-417.834] (-416.258) (-415.118) (-415.989) -- 0:00:21
652000 -- (-416.468) [-413.076] (-418.723) (-413.264) * (-415.673) [-414.746] (-417.717) (-414.343) -- 0:00:21
652500 -- (-416.361) (-415.313) (-421.363) [-415.842] * (-416.082) [-413.814] (-417.639) (-414.573) -- 0:00:21
653000 -- (-419.495) [-414.301] (-419.284) (-415.386) * (-416.527) (-413.110) (-416.923) [-413.813] -- 0:00:21
653500 -- (-415.909) (-413.179) [-413.394] (-416.562) * (-416.589) (-414.752) (-413.380) [-414.626] -- 0:00:21
654000 -- [-413.942] (-414.487) (-414.034) (-417.010) * (-417.256) (-415.398) [-416.319] (-413.693) -- 0:00:21
654500 -- [-414.182] (-415.362) (-413.559) (-414.291) * [-414.239] (-419.681) (-413.966) (-413.191) -- 0:00:21
655000 -- [-413.784] (-416.238) (-414.213) (-413.198) * (-414.101) (-418.455) [-414.186] (-414.703) -- 0:00:21
Average standard deviation of split frequencies: 0.012428
655500 -- (-414.344) [-414.088] (-415.028) (-414.513) * (-414.003) (-413.824) (-412.915) [-413.795] -- 0:00:21
656000 -- (-414.274) (-417.330) (-418.716) [-414.300] * (-419.350) (-413.921) [-414.492] (-415.536) -- 0:00:20
656500 -- (-414.895) (-413.964) (-413.969) [-415.067] * (-414.963) [-415.765] (-414.663) (-415.023) -- 0:00:20
657000 -- [-416.357] (-415.823) (-415.213) (-416.635) * (-420.857) (-414.886) (-413.495) [-416.068] -- 0:00:20
657500 -- (-417.113) [-417.087] (-414.073) (-418.079) * (-416.162) [-415.318] (-416.084) (-413.602) -- 0:00:20
658000 -- [-415.387] (-421.290) (-416.401) (-417.206) * (-416.322) (-414.683) [-418.464] (-422.836) -- 0:00:20
658500 -- (-414.543) [-413.607] (-414.564) (-414.573) * (-414.485) [-414.755] (-418.656) (-413.047) -- 0:00:20
659000 -- (-415.409) [-414.097] (-414.405) (-414.043) * (-413.313) (-414.875) [-413.987] (-414.711) -- 0:00:20
659500 -- (-415.421) (-420.169) (-415.018) [-415.062] * (-413.330) (-416.109) [-415.921] (-415.742) -- 0:00:20
660000 -- (-416.121) (-416.179) (-414.194) [-414.648] * (-414.507) (-416.755) (-413.041) [-414.764] -- 0:00:20
Average standard deviation of split frequencies: 0.012004
660500 -- [-413.270] (-419.829) (-415.157) (-418.282) * (-416.492) (-416.559) [-415.132] (-418.285) -- 0:00:20
661000 -- (-416.229) (-415.767) [-414.076] (-416.560) * (-414.633) [-416.718] (-415.635) (-415.852) -- 0:00:20
661500 -- [-414.578] (-414.444) (-413.494) (-414.989) * (-416.252) (-418.237) [-414.203] (-414.569) -- 0:00:20
662000 -- (-414.961) (-416.630) (-413.845) [-415.060] * [-413.976] (-417.011) (-414.642) (-414.046) -- 0:00:20
662500 -- [-413.319] (-414.328) (-414.240) (-415.435) * (-415.485) [-414.819] (-416.901) (-413.678) -- 0:00:20
663000 -- (-413.066) (-415.934) [-418.379] (-415.931) * (-414.193) (-417.544) [-414.187] (-414.513) -- 0:00:20
663500 -- (-412.978) (-413.642) [-417.705] (-414.168) * (-414.669) [-414.921] (-417.694) (-413.001) -- 0:00:20
664000 -- (-412.971) (-414.298) (-416.544) [-414.134] * (-414.139) (-413.418) [-416.585] (-415.706) -- 0:00:20
664500 -- (-413.392) (-413.379) [-415.449] (-414.762) * (-414.362) (-415.289) (-415.267) [-414.126] -- 0:00:20
665000 -- [-414.481] (-415.890) (-415.094) (-413.927) * [-416.715] (-417.428) (-417.208) (-415.189) -- 0:00:20
Average standard deviation of split frequencies: 0.011700
665500 -- (-416.666) (-413.264) (-413.660) [-414.412] * (-413.990) [-413.895] (-417.254) (-414.176) -- 0:00:20
666000 -- (-415.617) (-414.774) (-413.970) [-413.638] * (-413.233) [-416.755] (-414.265) (-414.800) -- 0:00:20
666500 -- (-419.167) [-413.425] (-414.538) (-414.312) * (-415.875) (-414.543) (-417.513) [-414.924] -- 0:00:20
667000 -- (-418.406) [-414.109] (-418.448) (-413.109) * (-414.673) (-417.960) (-413.743) [-415.432] -- 0:00:20
667500 -- (-416.598) [-413.451] (-414.486) (-414.049) * (-415.346) [-416.975] (-414.364) (-416.625) -- 0:00:20
668000 -- [-417.124] (-414.906) (-413.258) (-414.272) * [-414.738] (-414.551) (-414.010) (-420.890) -- 0:00:20
668500 -- (-415.606) (-415.563) (-414.192) [-414.777] * [-413.811] (-417.720) (-415.838) (-417.219) -- 0:00:20
669000 -- (-417.959) (-416.418) [-419.562] (-418.222) * (-413.329) [-417.378] (-416.692) (-415.593) -- 0:00:20
669500 -- [-416.940] (-415.823) (-414.637) (-418.098) * (-413.153) [-417.691] (-416.957) (-414.029) -- 0:00:20
670000 -- (-415.016) (-415.918) (-416.193) [-414.975] * (-414.339) (-415.554) [-414.796] (-416.414) -- 0:00:20
Average standard deviation of split frequencies: 0.011202
670500 -- (-416.088) (-414.961) [-413.116] (-419.938) * (-413.816) (-414.212) [-414.700] (-413.978) -- 0:00:20
671000 -- [-415.905] (-414.987) (-416.854) (-418.778) * (-415.732) [-415.043] (-414.749) (-415.038) -- 0:00:20
671500 -- (-414.313) (-414.436) (-414.718) [-413.523] * (-415.281) (-414.852) (-413.959) [-416.713] -- 0:00:20
672000 -- (-415.090) (-417.614) (-414.491) [-418.193] * (-414.049) [-413.867] (-415.348) (-419.468) -- 0:00:20
672500 -- (-416.047) [-415.966] (-415.803) (-417.134) * [-416.397] (-414.153) (-416.437) (-416.893) -- 0:00:19
673000 -- (-414.621) (-421.284) (-415.925) [-414.202] * (-413.389) [-413.956] (-416.314) (-415.177) -- 0:00:19
673500 -- (-416.182) (-418.626) [-418.036] (-413.325) * (-414.288) [-413.941] (-414.640) (-414.463) -- 0:00:19
674000 -- (-413.702) [-414.742] (-416.305) (-416.392) * (-414.121) (-412.971) [-419.778] (-420.788) -- 0:00:19
674500 -- (-414.709) (-413.682) [-415.071] (-417.829) * (-414.315) [-414.943] (-416.473) (-414.885) -- 0:00:19
675000 -- (-414.662) [-413.400] (-414.356) (-418.152) * (-413.103) (-413.941) (-416.729) [-417.355] -- 0:00:19
Average standard deviation of split frequencies: 0.011550
675500 -- (-413.855) [-414.270] (-416.524) (-418.053) * (-413.566) [-413.605] (-413.368) (-414.211) -- 0:00:19
676000 -- (-416.536) (-414.638) (-413.479) [-416.756] * (-414.300) (-418.241) [-418.494] (-413.405) -- 0:00:19
676500 -- [-414.467] (-424.248) (-418.745) (-414.817) * (-413.701) (-416.138) (-420.988) [-414.020] -- 0:00:19
677000 -- (-415.814) [-424.031] (-414.015) (-414.024) * (-413.801) (-415.480) [-418.392] (-421.342) -- 0:00:19
677500 -- (-416.347) [-415.644] (-416.861) (-415.755) * (-414.499) (-417.991) (-416.404) [-415.388] -- 0:00:19
678000 -- (-418.369) (-417.857) (-414.469) [-415.379] * (-421.124) (-415.731) (-414.657) [-414.500] -- 0:00:19
678500 -- [-413.653] (-415.484) (-414.890) (-417.191) * (-413.713) (-414.817) (-416.211) [-414.989] -- 0:00:19
679000 -- (-414.212) (-413.911) [-414.701] (-414.278) * (-413.581) (-421.267) [-414.178] (-414.090) -- 0:00:19
679500 -- (-417.091) [-416.008] (-418.401) (-415.226) * (-413.325) [-414.005] (-413.651) (-413.714) -- 0:00:19
680000 -- (-416.843) (-417.278) [-414.378] (-414.287) * [-417.296] (-415.070) (-414.051) (-414.348) -- 0:00:19
Average standard deviation of split frequencies: 0.011254
680500 -- (-413.747) [-415.199] (-415.544) (-414.082) * (-413.626) [-414.136] (-418.715) (-413.964) -- 0:00:19
681000 -- (-414.512) (-414.394) [-415.193] (-417.384) * (-414.015) [-414.725] (-416.741) (-415.109) -- 0:00:19
681500 -- (-414.870) [-414.301] (-416.624) (-417.809) * (-414.093) (-414.128) (-418.745) [-415.753] -- 0:00:19
682000 -- (-415.570) (-412.962) [-414.201] (-413.363) * [-416.774] (-413.426) (-416.977) (-414.695) -- 0:00:19
682500 -- (-414.850) [-415.418] (-414.752) (-414.102) * [-417.260] (-415.808) (-415.860) (-416.069) -- 0:00:19
683000 -- (-419.999) [-414.228] (-414.799) (-414.268) * (-414.930) (-414.879) [-414.346] (-415.199) -- 0:00:19
683500 -- (-415.080) [-413.886] (-414.514) (-413.798) * (-421.709) (-416.609) [-412.911] (-415.688) -- 0:00:19
684000 -- [-417.732] (-413.708) (-413.291) (-419.257) * (-415.908) (-417.034) (-414.108) [-415.470] -- 0:00:19
684500 -- [-414.775] (-414.666) (-418.697) (-415.505) * (-413.789) (-415.638) (-418.516) [-413.666] -- 0:00:19
685000 -- [-415.633] (-416.380) (-415.363) (-414.505) * (-415.331) [-416.379] (-413.601) (-413.987) -- 0:00:19
Average standard deviation of split frequencies: 0.011381
685500 -- (-415.968) (-416.350) (-414.109) [-416.092] * (-416.228) (-416.732) [-413.591] (-415.814) -- 0:00:19
686000 -- (-415.122) (-414.287) (-416.223) [-416.541] * (-415.182) (-417.186) (-414.648) [-415.976] -- 0:00:19
686500 -- [-414.593] (-415.638) (-413.535) (-413.993) * (-415.205) (-413.502) [-415.799] (-415.885) -- 0:00:19
687000 -- [-414.879] (-413.570) (-416.561) (-416.115) * [-414.350] (-413.512) (-417.633) (-418.818) -- 0:00:19
687500 -- (-416.700) [-414.981] (-413.960) (-417.184) * (-414.981) [-417.574] (-413.972) (-414.014) -- 0:00:19
688000 -- (-416.018) (-414.383) [-414.568] (-416.210) * [-414.696] (-416.935) (-414.923) (-414.857) -- 0:00:19
688500 -- (-414.936) (-415.072) [-414.156] (-419.656) * (-419.435) [-415.219] (-413.491) (-419.487) -- 0:00:19
689000 -- (-415.822) (-413.691) (-414.679) [-413.462] * [-416.562] (-414.924) (-415.233) (-416.207) -- 0:00:18
689500 -- (-416.133) (-415.455) (-417.697) [-415.550] * (-414.929) [-414.358] (-415.537) (-415.692) -- 0:00:18
690000 -- (-416.836) (-415.808) (-420.624) [-416.101] * (-415.096) [-414.761] (-414.055) (-413.952) -- 0:00:18
Average standard deviation of split frequencies: 0.010963
690500 -- [-414.093] (-414.762) (-413.425) (-414.039) * (-413.935) [-415.441] (-419.283) (-414.071) -- 0:00:18
691000 -- [-416.673] (-415.197) (-415.125) (-415.568) * (-416.628) (-416.070) [-415.889] (-416.131) -- 0:00:18
691500 -- (-414.175) (-415.830) (-416.626) [-414.879] * [-415.479] (-416.070) (-422.337) (-422.701) -- 0:00:18
692000 -- (-420.386) [-414.761] (-415.738) (-417.275) * (-415.751) [-414.325] (-417.631) (-417.945) -- 0:00:18
692500 -- (-417.013) (-413.798) (-416.352) [-415.222] * (-416.565) (-417.226) (-417.172) [-415.247] -- 0:00:18
693000 -- (-413.529) [-413.755] (-413.918) (-414.150) * (-417.837) [-414.971] (-418.140) (-414.589) -- 0:00:18
693500 -- (-416.247) (-413.277) [-413.138] (-413.582) * (-415.985) (-413.600) [-414.518] (-414.666) -- 0:00:18
694000 -- [-413.660] (-422.224) (-414.314) (-416.038) * (-417.587) (-413.738) (-414.334) [-415.334] -- 0:00:18
694500 -- (-417.353) (-416.823) (-414.553) [-420.554] * [-423.161] (-412.960) (-412.939) (-414.069) -- 0:00:18
695000 -- (-417.070) [-414.885] (-414.600) (-417.369) * [-413.052] (-417.632) (-414.302) (-416.940) -- 0:00:18
Average standard deviation of split frequencies: 0.011091
695500 -- [-415.988] (-418.266) (-414.857) (-412.886) * (-414.093) (-415.436) [-414.582] (-413.525) -- 0:00:18
696000 -- (-413.273) (-414.512) [-414.522] (-414.785) * (-414.175) (-415.748) [-415.879] (-416.847) -- 0:00:18
696500 -- [-416.864] (-415.765) (-414.808) (-416.312) * (-414.121) (-414.261) [-414.633] (-414.290) -- 0:00:18
697000 -- (-414.884) [-412.836] (-414.490) (-414.692) * (-413.859) (-417.415) (-416.547) [-414.029] -- 0:00:18
697500 -- (-417.802) [-416.449] (-416.274) (-414.584) * (-415.080) [-414.089] (-415.748) (-413.895) -- 0:00:18
698000 -- (-420.675) (-414.976) [-416.047] (-417.001) * (-414.135) (-414.607) [-413.913] (-415.669) -- 0:00:18
698500 -- (-414.994) (-414.507) [-413.443] (-414.374) * (-419.088) (-413.763) (-418.270) [-414.251] -- 0:00:18
699000 -- (-417.524) (-413.532) (-414.768) [-420.830] * (-418.561) (-414.939) (-416.473) [-414.976] -- 0:00:18
699500 -- (-416.759) (-414.724) (-415.195) [-414.727] * [-416.867] (-415.783) (-417.256) (-414.559) -- 0:00:18
700000 -- (-417.965) (-413.298) [-415.464] (-414.437) * (-417.333) [-415.069] (-415.643) (-413.588) -- 0:00:18
Average standard deviation of split frequencies: 0.010723
700500 -- (-415.410) [-416.085] (-417.821) (-416.504) * [-416.837] (-416.329) (-416.765) (-420.508) -- 0:00:18
701000 -- [-416.053] (-414.631) (-413.136) (-414.809) * (-415.100) (-414.824) [-418.951] (-415.177) -- 0:00:18
701500 -- (-413.751) (-414.695) (-419.075) [-413.573] * (-414.057) (-416.134) (-413.443) [-417.328] -- 0:00:18
702000 -- (-414.775) (-415.134) [-416.316] (-413.654) * [-413.549] (-412.839) (-416.197) (-416.771) -- 0:00:18
702500 -- (-420.270) [-413.181] (-414.341) (-414.723) * (-413.696) (-413.707) (-415.899) [-414.516] -- 0:00:18
703000 -- (-418.976) (-418.331) (-413.219) [-415.247] * (-414.922) (-413.440) (-413.835) [-414.556] -- 0:00:18
703500 -- (-414.102) (-414.189) (-414.869) [-414.591] * (-415.447) [-413.565] (-414.892) (-415.193) -- 0:00:18
704000 -- (-415.589) [-413.724] (-415.237) (-414.595) * (-418.609) [-417.710] (-416.272) (-415.333) -- 0:00:18
704500 -- (-413.651) (-416.919) (-416.808) [-414.300] * (-415.175) (-414.532) (-414.220) [-417.044] -- 0:00:18
705000 -- (-414.425) (-414.597) [-413.590] (-416.038) * [-414.889] (-415.930) (-414.230) (-413.893) -- 0:00:17
Average standard deviation of split frequencies: 0.010642
705500 -- (-415.132) (-413.929) [-414.444] (-415.941) * [-413.994] (-416.165) (-418.834) (-414.013) -- 0:00:17
706000 -- (-413.701) (-418.943) (-416.138) [-415.114] * (-416.025) [-413.621] (-413.914) (-414.490) -- 0:00:17
706500 -- (-417.554) (-425.740) (-414.451) [-414.145] * (-416.415) [-413.158] (-414.772) (-416.999) -- 0:00:17
707000 -- (-417.658) [-413.776] (-417.950) (-414.228) * (-413.787) (-413.426) (-414.176) [-415.841] -- 0:00:17
707500 -- [-415.023] (-413.198) (-414.568) (-416.321) * (-413.630) (-413.600) [-413.453] (-415.889) -- 0:00:17
708000 -- (-414.758) (-414.342) (-418.507) [-413.649] * (-419.508) [-414.622] (-413.591) (-414.769) -- 0:00:17
708500 -- (-414.575) (-413.636) (-414.143) [-413.613] * [-415.170] (-415.315) (-417.515) (-417.038) -- 0:00:17
709000 -- (-415.294) [-414.069] (-417.645) (-414.312) * [-418.239] (-414.830) (-417.255) (-414.545) -- 0:00:17
709500 -- [-416.543] (-414.800) (-413.577) (-413.265) * [-416.136] (-414.915) (-414.538) (-417.610) -- 0:00:17
710000 -- (-415.867) (-416.850) [-415.444] (-413.495) * (-419.124) (-413.867) [-413.739] (-422.080) -- 0:00:17
Average standard deviation of split frequencies: 0.010779
710500 -- [-416.392] (-415.174) (-414.290) (-413.528) * (-413.909) (-413.267) (-413.793) [-414.268] -- 0:00:17
711000 -- (-416.661) [-416.314] (-416.996) (-419.585) * (-413.557) [-418.290] (-417.660) (-416.349) -- 0:00:17
711500 -- (-423.039) (-417.897) (-423.849) [-413.606] * [-413.990] (-416.984) (-413.192) (-415.389) -- 0:00:17
712000 -- (-418.570) [-417.900] (-421.214) (-419.671) * [-414.509] (-414.696) (-414.684) (-416.722) -- 0:00:17
712500 -- (-414.890) [-418.389] (-425.815) (-420.535) * [-413.598] (-414.498) (-414.555) (-415.779) -- 0:00:17
713000 -- [-413.218] (-416.956) (-414.935) (-416.708) * (-413.954) (-414.743) [-417.902] (-413.505) -- 0:00:17
713500 -- [-417.399] (-414.703) (-416.331) (-414.958) * (-416.191) (-418.473) [-416.566] (-413.453) -- 0:00:17
714000 -- (-414.411) (-413.696) (-415.578) [-416.692] * [-415.849] (-417.737) (-414.832) (-414.280) -- 0:00:17
714500 -- (-415.621) [-412.954] (-415.001) (-416.914) * (-415.659) [-413.885] (-417.313) (-414.158) -- 0:00:17
715000 -- (-416.152) (-413.766) [-414.366] (-417.478) * (-415.334) (-416.625) [-416.296] (-413.251) -- 0:00:17
Average standard deviation of split frequencies: 0.010452
715500 -- [-414.568] (-417.116) (-418.972) (-417.620) * [-414.322] (-415.588) (-414.558) (-417.795) -- 0:00:17
716000 -- (-414.806) [-415.946] (-422.294) (-416.678) * (-413.915) (-416.364) [-415.789] (-417.389) -- 0:00:17
716500 -- (-415.249) [-413.851] (-416.321) (-414.950) * (-413.913) (-418.157) [-416.838] (-416.324) -- 0:00:17
717000 -- [-415.232] (-415.363) (-421.443) (-414.131) * (-415.667) (-417.577) (-415.046) [-413.720] -- 0:00:17
717500 -- [-415.912] (-413.826) (-419.665) (-415.370) * (-415.316) (-418.405) (-415.023) [-415.421] -- 0:00:17
718000 -- [-414.704] (-415.492) (-414.047) (-420.055) * (-414.789) (-416.454) (-413.505) [-413.678] -- 0:00:17
718500 -- (-416.128) [-414.614] (-417.372) (-413.610) * [-416.276] (-416.014) (-413.429) (-413.798) -- 0:00:17
719000 -- (-415.683) [-413.462] (-415.142) (-414.794) * (-412.976) (-414.413) [-417.933] (-415.858) -- 0:00:17
719500 -- (-414.232) [-415.467] (-416.263) (-413.690) * (-413.974) (-414.540) [-414.979] (-413.998) -- 0:00:17
720000 -- (-414.574) (-415.240) (-415.133) [-415.197] * [-413.893] (-413.878) (-418.138) (-414.877) -- 0:00:17
Average standard deviation of split frequencies: 0.010589
720500 -- [-416.755] (-415.748) (-417.347) (-414.601) * (-414.093) [-415.632] (-417.402) (-413.825) -- 0:00:17
721000 -- [-414.988] (-414.012) (-415.157) (-415.858) * [-415.375] (-416.227) (-413.680) (-417.095) -- 0:00:17
721500 -- (-412.867) (-414.882) [-415.308] (-420.582) * (-415.781) [-415.167] (-414.053) (-414.618) -- 0:00:16
722000 -- [-414.235] (-420.797) (-416.301) (-417.441) * (-414.458) [-418.020] (-415.026) (-414.533) -- 0:00:16
722500 -- (-413.241) (-415.977) (-417.049) [-415.376] * (-416.031) (-413.487) (-413.502) [-417.149] -- 0:00:16
723000 -- (-414.124) [-415.763] (-415.663) (-415.552) * (-413.810) [-413.180] (-415.025) (-414.042) -- 0:00:16
723500 -- (-414.250) (-413.870) [-414.364] (-417.116) * (-415.388) [-413.518] (-413.934) (-413.230) -- 0:00:16
724000 -- [-414.343] (-414.557) (-415.846) (-413.026) * (-415.463) [-414.101] (-415.906) (-414.301) -- 0:00:16
724500 -- (-415.557) [-413.671] (-415.920) (-413.663) * (-415.724) (-420.149) [-414.863] (-413.872) -- 0:00:16
725000 -- (-417.114) [-414.324] (-415.055) (-414.737) * (-414.558) (-415.337) (-416.041) [-416.768] -- 0:00:16
Average standard deviation of split frequencies: 0.010389
725500 -- (-414.322) (-413.999) [-414.334] (-422.918) * [-415.589] (-415.546) (-414.211) (-413.789) -- 0:00:16
726000 -- (-414.488) (-415.981) (-413.557) [-417.425] * [-414.202] (-415.480) (-418.843) (-415.032) -- 0:00:16
726500 -- (-413.311) [-413.416] (-418.508) (-418.113) * [-413.945] (-417.342) (-415.206) (-417.202) -- 0:00:16
727000 -- (-413.433) (-420.116) [-414.848] (-414.197) * (-414.632) (-413.910) [-415.626] (-418.083) -- 0:00:16
727500 -- (-413.374) [-416.448] (-416.783) (-417.533) * (-416.218) (-418.939) (-417.191) [-414.522] -- 0:00:16
728000 -- [-413.203] (-414.495) (-417.371) (-419.949) * [-414.377] (-416.673) (-417.661) (-413.966) -- 0:00:16
728500 -- (-418.701) [-414.415] (-415.835) (-415.207) * (-414.178) (-413.693) [-414.088] (-415.953) -- 0:00:16
729000 -- [-416.829] (-416.190) (-417.731) (-414.679) * [-417.218] (-416.189) (-413.972) (-413.109) -- 0:00:16
729500 -- (-416.162) (-414.460) (-414.728) [-415.792] * (-417.975) [-414.089] (-414.633) (-415.860) -- 0:00:16
730000 -- (-412.874) (-415.136) [-413.517] (-414.056) * (-422.517) (-413.692) (-413.625) [-414.779] -- 0:00:16
Average standard deviation of split frequencies: 0.010524
730500 -- (-416.337) [-414.220] (-417.213) (-414.383) * (-416.556) [-414.219] (-413.452) (-417.754) -- 0:00:16
731000 -- (-414.084) [-413.900] (-418.724) (-414.205) * (-415.115) (-416.776) [-415.444] (-416.874) -- 0:00:16
731500 -- (-414.204) (-416.914) (-417.326) [-415.517] * (-415.211) (-419.334) [-413.940] (-417.140) -- 0:00:16
732000 -- (-414.165) (-413.791) [-414.277] (-417.083) * (-413.679) [-415.352] (-413.620) (-415.021) -- 0:00:16
732500 -- (-414.368) [-415.400] (-413.640) (-412.978) * (-415.617) (-415.763) [-415.050] (-414.091) -- 0:00:16
733000 -- (-414.630) (-417.946) [-413.793] (-415.765) * [-413.290] (-413.530) (-414.104) (-415.262) -- 0:00:16
733500 -- (-413.806) (-417.119) (-417.228) [-413.711] * [-413.178] (-415.071) (-417.494) (-414.933) -- 0:00:16
734000 -- (-417.986) (-417.361) [-417.174] (-415.145) * (-416.419) (-412.910) [-415.911] (-416.151) -- 0:00:16
734500 -- (-414.128) [-414.440] (-414.690) (-414.741) * (-417.574) (-415.044) (-414.695) [-420.380] -- 0:00:16
735000 -- (-413.691) [-413.792] (-416.932) (-414.058) * (-418.427) (-413.618) [-416.310] (-416.173) -- 0:00:16
Average standard deviation of split frequencies: 0.010208
735500 -- (-417.303) [-413.877] (-417.183) (-416.317) * (-417.745) (-412.918) (-418.696) [-416.395] -- 0:00:16
736000 -- [-413.208] (-413.909) (-415.190) (-417.993) * (-413.216) (-416.448) [-414.224] (-413.315) -- 0:00:16
736500 -- (-414.535) (-413.933) [-412.917] (-414.699) * (-413.007) (-413.809) (-414.212) [-414.053] -- 0:00:16
737000 -- (-420.592) [-413.823] (-414.091) (-415.592) * (-414.107) (-413.733) (-413.748) [-413.630] -- 0:00:16
737500 -- [-418.110] (-416.331) (-415.096) (-415.521) * (-415.319) (-413.187) (-416.272) [-414.623] -- 0:00:16
738000 -- (-415.066) (-416.656) [-413.156] (-415.840) * (-415.616) (-415.135) (-414.794) [-413.913] -- 0:00:15
738500 -- [-414.637] (-415.554) (-413.613) (-414.404) * (-418.071) [-419.503] (-412.966) (-414.388) -- 0:00:15
739000 -- (-412.956) [-414.615] (-415.556) (-414.132) * (-416.798) (-416.650) (-416.172) [-413.915] -- 0:00:15
739500 -- (-419.658) (-415.000) (-417.642) [-414.151] * [-416.585] (-413.752) (-415.738) (-415.436) -- 0:00:15
740000 -- [-414.111] (-418.608) (-415.963) (-415.636) * (-417.186) [-414.646] (-415.756) (-413.636) -- 0:00:15
Average standard deviation of split frequencies: 0.010263
740500 -- [-414.735] (-417.097) (-413.992) (-415.117) * (-415.540) [-414.701] (-415.981) (-417.235) -- 0:00:15
741000 -- (-414.800) (-418.941) (-415.424) [-414.265] * (-415.110) [-414.972] (-415.778) (-415.301) -- 0:00:15
741500 -- (-417.180) [-413.783] (-415.060) (-413.605) * [-413.086] (-418.007) (-414.413) (-414.029) -- 0:00:15
742000 -- (-416.562) (-418.079) [-415.212] (-412.819) * (-418.061) [-417.685] (-415.974) (-416.243) -- 0:00:15
742500 -- [-415.612] (-415.095) (-413.583) (-413.945) * [-416.228] (-413.649) (-416.594) (-418.127) -- 0:00:15
743000 -- (-416.752) (-413.351) [-413.583] (-416.394) * [-413.285] (-416.620) (-414.630) (-412.964) -- 0:00:15
743500 -- (-417.461) (-416.050) [-413.335] (-419.224) * [-414.595] (-416.517) (-415.376) (-413.497) -- 0:00:15
744000 -- [-413.780] (-420.898) (-413.355) (-413.961) * [-416.512] (-417.902) (-414.022) (-413.238) -- 0:00:15
744500 -- (-414.761) (-415.981) (-413.851) [-413.605] * (-416.855) [-414.546] (-414.186) (-414.254) -- 0:00:15
745000 -- [-413.399] (-414.713) (-414.544) (-416.154) * (-414.324) (-416.068) (-417.957) [-413.961] -- 0:00:15
Average standard deviation of split frequencies: 0.010150
745500 -- (-416.385) (-414.146) (-414.412) [-414.147] * (-414.701) (-414.958) (-414.840) [-415.214] -- 0:00:15
746000 -- (-416.270) [-414.196] (-415.399) (-417.593) * [-418.178] (-415.346) (-414.367) (-419.166) -- 0:00:15
746500 -- [-417.166] (-423.526) (-413.549) (-414.945) * (-413.292) (-414.407) [-414.631] (-416.091) -- 0:00:15
747000 -- (-416.069) [-414.293] (-415.989) (-413.946) * (-414.710) (-414.453) [-415.308] (-414.706) -- 0:00:15
747500 -- (-415.407) [-415.034] (-417.914) (-414.801) * (-414.201) (-415.561) [-416.721] (-416.910) -- 0:00:15
748000 -- [-414.915] (-415.906) (-415.619) (-417.316) * (-417.136) (-415.580) [-413.887] (-416.500) -- 0:00:15
748500 -- (-417.685) (-416.486) (-415.712) [-413.823] * (-417.882) (-414.047) [-415.623] (-414.194) -- 0:00:15
749000 -- [-414.074] (-416.267) (-415.223) (-414.217) * (-421.341) (-415.489) [-419.320] (-414.308) -- 0:00:15
749500 -- (-415.339) [-417.117] (-414.620) (-416.641) * (-413.156) (-413.447) (-416.214) [-413.434] -- 0:00:15
750000 -- (-414.983) (-413.974) (-415.562) [-413.340] * (-413.928) (-415.086) (-415.135) [-415.192] -- 0:00:15
Average standard deviation of split frequencies: 0.009694
750500 -- (-414.683) (-417.538) (-415.461) [-414.242] * [-417.153] (-413.786) (-414.703) (-415.167) -- 0:00:15
751000 -- [-414.256] (-414.156) (-414.879) (-418.824) * (-414.988) (-415.296) [-414.848] (-414.273) -- 0:00:15
751500 -- (-415.011) [-414.157] (-413.373) (-414.314) * (-415.190) [-415.055] (-413.658) (-415.697) -- 0:00:15
752000 -- (-415.260) (-415.499) [-415.857] (-417.870) * (-413.788) [-416.005] (-414.738) (-415.228) -- 0:00:15
752500 -- (-414.473) [-415.241] (-416.108) (-414.581) * [-413.297] (-414.343) (-414.540) (-413.772) -- 0:00:15
753000 -- (-413.755) [-415.625] (-418.150) (-415.901) * (-415.687) [-415.828] (-416.707) (-417.140) -- 0:00:15
753500 -- (-416.305) [-414.000] (-419.513) (-414.290) * [-414.776] (-417.519) (-415.279) (-413.900) -- 0:00:15
754000 -- (-419.804) (-414.026) [-414.578] (-418.515) * (-414.031) [-415.407] (-414.840) (-417.143) -- 0:00:15
754500 -- [-413.424] (-414.289) (-413.912) (-417.105) * (-413.561) (-414.618) [-412.760] (-418.196) -- 0:00:14
755000 -- (-413.613) [-413.778] (-421.255) (-415.381) * (-417.027) (-415.561) [-413.419] (-416.861) -- 0:00:14
Average standard deviation of split frequencies: 0.009938
755500 -- (-413.772) [-415.125] (-417.742) (-414.247) * (-415.836) (-414.434) (-421.213) [-416.910] -- 0:00:14
756000 -- (-413.714) (-413.122) (-414.275) [-415.394] * (-416.695) (-413.083) [-416.481] (-419.542) -- 0:00:14
756500 -- [-416.896] (-417.180) (-416.595) (-418.089) * (-420.652) (-414.754) [-413.704] (-415.260) -- 0:00:14
757000 -- [-414.115] (-415.314) (-416.920) (-415.897) * (-417.072) (-413.939) (-413.419) [-414.476] -- 0:00:14
757500 -- [-416.008] (-419.276) (-414.555) (-416.100) * (-419.533) (-413.856) [-414.624] (-415.693) -- 0:00:14
758000 -- [-414.287] (-416.302) (-414.964) (-414.598) * (-414.175) [-416.603] (-414.393) (-414.056) -- 0:00:14
758500 -- (-418.600) (-415.937) (-416.134) [-414.429] * (-413.972) (-413.953) (-414.523) [-413.575] -- 0:00:14
759000 -- (-414.540) (-413.224) (-416.846) [-418.114] * (-420.087) (-414.543) (-413.628) [-413.887] -- 0:00:14
759500 -- (-414.867) (-413.235) (-417.946) [-415.280] * (-414.886) [-414.992] (-415.322) (-414.003) -- 0:00:14
760000 -- (-415.872) [-416.040] (-416.428) (-413.726) * (-414.278) (-416.704) (-415.457) [-415.153] -- 0:00:14
Average standard deviation of split frequencies: 0.010187
760500 -- (-413.914) (-413.827) [-416.041] (-413.288) * (-415.039) (-416.773) (-414.704) [-413.428] -- 0:00:14
761000 -- (-417.658) (-415.308) (-413.626) [-413.213] * [-414.353] (-414.615) (-417.366) (-419.007) -- 0:00:14
761500 -- (-416.923) [-413.717] (-417.043) (-415.100) * (-414.481) [-413.606] (-415.862) (-418.629) -- 0:00:14
762000 -- (-418.850) (-415.685) (-416.803) [-413.146] * [-414.311] (-415.215) (-415.894) (-418.616) -- 0:00:14
762500 -- (-414.892) (-415.263) (-414.820) [-420.136] * (-420.393) [-415.139] (-415.148) (-414.780) -- 0:00:14
763000 -- [-413.731] (-416.897) (-414.555) (-416.799) * (-413.880) (-414.371) [-415.251] (-418.989) -- 0:00:14
763500 -- (-417.821) (-417.655) (-412.978) [-416.171] * (-415.088) [-413.571] (-414.524) (-414.020) -- 0:00:14
764000 -- [-415.006] (-418.340) (-414.662) (-414.553) * (-415.851) (-413.287) (-414.568) [-414.037] -- 0:00:14
764500 -- (-413.446) [-413.822] (-418.069) (-413.556) * (-414.414) (-414.110) (-414.201) [-416.988] -- 0:00:14
765000 -- (-416.834) (-414.370) (-414.976) [-415.106] * (-415.129) (-415.495) [-415.037] (-414.457) -- 0:00:14
Average standard deviation of split frequencies: 0.010193
765500 -- (-414.941) [-415.205] (-415.981) (-416.749) * (-421.050) (-415.881) (-417.667) [-414.546] -- 0:00:14
766000 -- [-414.012] (-413.170) (-417.047) (-414.892) * (-414.494) (-415.205) [-416.094] (-415.791) -- 0:00:14
766500 -- (-415.269) (-416.159) [-416.138] (-415.667) * [-417.375] (-415.608) (-413.117) (-416.441) -- 0:00:14
767000 -- (-415.535) [-419.865] (-417.494) (-418.340) * (-415.980) (-416.405) (-415.582) [-413.356] -- 0:00:14
767500 -- (-413.231) (-418.469) (-416.807) [-415.342] * (-416.600) [-414.166] (-413.148) (-421.499) -- 0:00:14
768000 -- (-417.575) (-418.257) (-416.726) [-416.215] * (-416.991) (-418.640) [-414.453] (-418.031) -- 0:00:14
768500 -- [-415.242] (-413.817) (-414.743) (-414.003) * [-416.542] (-415.066) (-415.402) (-416.341) -- 0:00:14
769000 -- (-413.570) (-415.598) (-416.186) [-413.666] * (-413.427) [-413.778] (-415.407) (-416.900) -- 0:00:14
769500 -- [-413.977] (-415.311) (-416.866) (-413.220) * (-420.109) (-413.399) (-415.518) [-414.594] -- 0:00:14
770000 -- [-415.007] (-415.070) (-413.824) (-414.375) * (-414.806) (-412.925) [-414.174] (-415.148) -- 0:00:14
Average standard deviation of split frequencies: 0.009863
770500 -- (-416.555) [-415.555] (-418.501) (-417.364) * (-420.307) (-414.692) (-415.139) [-415.119] -- 0:00:13
771000 -- (-417.173) (-416.984) [-414.014] (-414.062) * (-417.471) (-414.502) (-416.267) [-416.545] -- 0:00:13
771500 -- [-416.886] (-415.895) (-415.403) (-417.618) * (-418.147) [-413.578] (-414.110) (-414.633) -- 0:00:13
772000 -- (-419.839) (-415.277) (-413.965) [-414.520] * [-415.546] (-413.194) (-415.877) (-422.939) -- 0:00:13
772500 -- [-415.075] (-414.493) (-413.264) (-414.125) * [-414.116] (-416.628) (-417.137) (-418.709) -- 0:00:13
773000 -- (-414.545) (-416.201) (-413.819) [-416.056] * [-414.227] (-420.122) (-414.602) (-413.288) -- 0:00:13
773500 -- (-414.313) (-417.841) (-414.398) [-416.115] * [-414.237] (-414.512) (-414.140) (-416.572) -- 0:00:13
774000 -- [-417.022] (-414.076) (-417.211) (-415.963) * [-419.624] (-418.097) (-415.929) (-415.690) -- 0:00:13
774500 -- [-416.023] (-413.846) (-416.388) (-421.838) * (-414.580) (-413.816) [-413.359] (-418.083) -- 0:00:13
775000 -- (-421.765) (-416.434) [-414.511] (-419.222) * (-415.773) (-413.446) (-413.754) [-414.660] -- 0:00:13
Average standard deviation of split frequencies: 0.009606
775500 -- (-417.748) [-415.676] (-416.931) (-417.954) * (-415.903) (-414.203) (-415.879) [-413.765] -- 0:00:13
776000 -- (-421.861) (-415.277) (-420.203) [-417.813] * (-415.398) (-415.056) [-414.491] (-417.447) -- 0:00:13
776500 -- (-414.729) (-415.714) (-414.694) [-414.472] * (-415.943) [-416.275] (-414.631) (-415.161) -- 0:00:13
777000 -- (-415.218) (-415.315) (-418.521) [-413.984] * (-414.988) [-414.651] (-416.047) (-414.839) -- 0:00:13
777500 -- (-417.314) [-418.724] (-415.303) (-415.936) * (-413.255) (-418.524) [-413.733] (-417.135) -- 0:00:13
778000 -- (-415.477) (-415.114) [-414.017] (-420.710) * (-413.806) [-413.902] (-412.829) (-414.648) -- 0:00:13
778500 -- (-415.305) [-414.797] (-414.968) (-414.526) * (-415.923) (-421.045) (-412.835) [-414.566] -- 0:00:13
779000 -- (-417.095) (-417.032) [-415.626] (-415.083) * [-413.893] (-416.611) (-414.284) (-414.909) -- 0:00:13
779500 -- (-414.745) (-419.539) (-416.198) [-415.386] * (-415.075) [-416.015] (-416.145) (-415.856) -- 0:00:13
780000 -- (-415.262) (-415.045) [-414.966] (-413.276) * [-417.534] (-418.032) (-418.675) (-414.498) -- 0:00:13
Average standard deviation of split frequencies: 0.009624
780500 -- (-417.642) (-414.090) (-414.023) [-413.399] * [-413.240] (-414.923) (-414.084) (-415.785) -- 0:00:13
781000 -- [-414.726] (-413.343) (-415.759) (-416.272) * [-414.116] (-414.624) (-415.472) (-414.902) -- 0:00:13
781500 -- [-415.816] (-413.523) (-415.374) (-415.736) * (-414.059) [-413.482] (-416.064) (-416.963) -- 0:00:13
782000 -- [-415.497] (-413.601) (-416.053) (-416.945) * (-415.034) (-413.900) [-415.252] (-416.894) -- 0:00:13
782500 -- [-416.714] (-415.509) (-416.033) (-415.038) * (-414.955) [-417.546] (-420.564) (-418.842) -- 0:00:13
783000 -- (-419.161) (-414.991) (-414.079) [-416.295] * (-415.809) (-414.620) [-419.996] (-416.404) -- 0:00:13
783500 -- (-413.684) (-414.036) (-420.033) [-416.277] * (-416.625) (-414.706) (-420.735) [-417.095] -- 0:00:13
784000 -- (-414.442) [-414.558] (-413.727) (-418.361) * [-413.280] (-413.990) (-417.905) (-415.389) -- 0:00:13
784500 -- (-416.603) (-413.994) [-413.462] (-420.147) * (-416.131) (-416.486) (-413.948) [-413.150] -- 0:00:13
785000 -- (-414.950) [-414.667] (-415.659) (-416.739) * (-418.467) (-414.889) (-418.036) [-417.135] -- 0:00:13
Average standard deviation of split frequencies: 0.009671
785500 -- (-415.301) [-414.208] (-413.812) (-414.712) * [-414.215] (-415.911) (-416.098) (-413.818) -- 0:00:13
786000 -- [-413.473] (-413.130) (-414.081) (-414.260) * (-414.144) (-415.612) (-413.019) [-415.587] -- 0:00:13
786500 -- [-415.780] (-418.507) (-416.202) (-415.406) * [-414.208] (-415.081) (-414.874) (-419.483) -- 0:00:13
787000 -- [-415.438] (-418.468) (-416.016) (-413.469) * (-413.713) (-413.183) [-414.529] (-422.944) -- 0:00:12
787500 -- (-414.632) [-413.896] (-419.111) (-415.514) * (-414.251) (-420.929) (-414.460) [-417.247] -- 0:00:12
788000 -- (-414.573) (-417.577) (-417.627) [-415.387] * (-415.345) (-414.963) [-413.777] (-416.843) -- 0:00:12
788500 -- [-417.291] (-416.426) (-416.497) (-414.249) * [-413.957] (-416.896) (-416.125) (-415.926) -- 0:00:12
789000 -- [-415.693] (-419.579) (-417.245) (-421.461) * (-413.304) (-419.411) (-416.973) [-418.421] -- 0:00:12
789500 -- (-416.508) (-417.245) (-415.299) [-415.690] * (-415.333) (-419.752) [-415.056] (-417.534) -- 0:00:12
790000 -- [-415.953] (-415.121) (-416.563) (-415.609) * (-414.388) [-415.659] (-418.065) (-414.323) -- 0:00:12
Average standard deviation of split frequencies: 0.009651
790500 -- (-416.046) (-415.914) (-416.278) [-414.721] * (-414.624) (-417.649) (-413.176) [-413.998] -- 0:00:12
791000 -- (-415.670) (-415.368) (-414.120) [-414.539] * (-414.793) [-416.776] (-415.276) (-413.443) -- 0:00:12
791500 -- (-416.841) (-416.898) (-415.661) [-414.440] * [-414.221] (-415.912) (-416.335) (-414.270) -- 0:00:12
792000 -- [-419.125] (-414.776) (-413.880) (-414.325) * [-414.301] (-416.330) (-417.022) (-413.789) -- 0:00:12
792500 -- (-419.460) (-415.241) (-413.899) [-414.874] * (-415.465) [-413.600] (-416.231) (-416.093) -- 0:00:12
793000 -- (-415.821) (-414.225) (-414.901) [-416.547] * (-416.065) (-413.228) [-417.170] (-414.266) -- 0:00:12
793500 -- (-414.307) (-418.205) (-413.954) [-413.255] * (-416.131) (-413.842) [-414.277] (-413.973) -- 0:00:12
794000 -- (-414.026) (-415.161) [-413.859] (-415.120) * (-413.462) [-413.748] (-414.545) (-415.205) -- 0:00:12
794500 -- [-415.193] (-416.674) (-418.246) (-418.071) * (-414.026) (-414.712) (-415.089) [-417.930] -- 0:00:12
795000 -- (-415.490) (-415.134) [-414.067] (-416.569) * (-414.474) [-417.714] (-413.798) (-418.424) -- 0:00:12
Average standard deviation of split frequencies: 0.009475
795500 -- (-415.769) (-416.556) (-415.216) [-414.737] * (-415.582) (-414.359) (-415.482) [-415.036] -- 0:00:12
796000 -- [-415.544] (-416.672) (-415.551) (-417.125) * [-415.553] (-415.451) (-414.364) (-416.152) -- 0:00:12
796500 -- [-414.942] (-413.724) (-413.865) (-415.046) * [-417.951] (-414.662) (-414.739) (-417.225) -- 0:00:12
797000 -- (-413.569) [-415.308] (-413.484) (-413.496) * [-416.910] (-414.012) (-416.174) (-413.915) -- 0:00:12
797500 -- (-413.717) (-414.692) (-415.971) [-416.653] * [-413.931] (-413.988) (-414.578) (-418.367) -- 0:00:12
798000 -- [-415.132] (-415.070) (-413.290) (-416.413) * (-415.112) (-412.894) (-417.236) [-416.321] -- 0:00:12
798500 -- (-416.284) (-412.868) (-421.433) [-415.345] * (-417.152) (-415.539) [-413.370] (-414.791) -- 0:00:12
799000 -- [-415.025] (-413.870) (-416.730) (-415.378) * (-413.972) (-418.786) (-417.354) [-416.181] -- 0:00:12
799500 -- [-415.025] (-413.739) (-415.830) (-415.096) * [-414.033] (-419.080) (-416.624) (-415.382) -- 0:00:12
800000 -- (-414.302) [-418.913] (-415.271) (-413.068) * (-415.027) [-413.727] (-413.692) (-414.149) -- 0:00:12
Average standard deviation of split frequencies: 0.009126
800500 -- (-414.963) (-415.419) (-418.005) [-414.273] * (-415.302) (-419.163) (-413.410) [-418.270] -- 0:00:12
801000 -- (-416.344) (-415.708) (-420.299) [-416.038] * (-416.223) (-417.790) [-415.180] (-415.206) -- 0:00:12
801500 -- (-418.421) [-414.080] (-420.670) (-414.151) * (-417.087) (-415.418) [-418.706] (-413.639) -- 0:00:12
802000 -- (-415.448) (-415.177) (-416.506) [-413.615] * (-413.491) (-415.579) [-416.916] (-415.077) -- 0:00:12
802500 -- (-416.033) (-417.629) (-415.245) [-412.885] * (-418.247) [-414.669] (-416.906) (-414.667) -- 0:00:12
803000 -- (-415.196) (-414.629) [-414.212] (-414.283) * (-414.173) (-414.513) [-421.479] (-414.812) -- 0:00:12
803500 -- [-415.340] (-413.676) (-414.724) (-414.378) * (-415.675) (-419.773) [-414.929] (-413.753) -- 0:00:11
804000 -- (-414.279) (-415.857) (-415.987) [-416.947] * (-417.516) (-417.123) (-414.213) [-414.872] -- 0:00:11
804500 -- [-415.380] (-415.603) (-415.862) (-416.376) * (-414.891) [-413.749] (-417.012) (-417.626) -- 0:00:11
805000 -- (-414.332) [-413.430] (-417.080) (-416.380) * (-415.467) (-413.505) [-414.389] (-414.416) -- 0:00:11
Average standard deviation of split frequencies: 0.009175
805500 -- (-413.252) (-414.866) [-414.871] (-417.282) * (-416.159) (-417.345) [-414.621] (-416.659) -- 0:00:11
806000 -- (-414.782) (-413.518) [-417.694] (-414.284) * (-417.478) (-413.883) [-417.705] (-415.699) -- 0:00:11
806500 -- (-413.622) [-413.551] (-415.512) (-413.452) * (-414.445) (-413.930) (-414.001) [-415.668] -- 0:00:11
807000 -- [-415.012] (-414.238) (-415.303) (-416.393) * (-417.525) [-413.171] (-413.370) (-416.333) -- 0:00:11
807500 -- (-414.714) [-418.634] (-415.393) (-414.562) * (-416.842) [-416.617] (-413.611) (-414.277) -- 0:00:11
808000 -- (-413.564) (-416.185) [-414.258] (-415.469) * (-423.657) (-416.736) (-414.571) [-412.951] -- 0:00:11
808500 -- (-417.431) (-413.966) (-417.791) [-415.907] * (-415.934) [-413.264] (-414.827) (-413.206) -- 0:00:11
809000 -- (-417.781) [-414.983] (-414.532) (-416.296) * (-415.537) (-413.714) (-416.230) [-413.360] -- 0:00:11
809500 -- (-417.743) [-414.661] (-414.669) (-416.443) * [-413.798] (-414.502) (-415.364) (-413.528) -- 0:00:11
810000 -- (-415.429) (-419.557) [-415.784] (-416.730) * (-418.373) [-414.197] (-414.795) (-414.519) -- 0:00:11
Average standard deviation of split frequencies: 0.009050
810500 -- (-415.053) [-413.532] (-414.308) (-415.840) * (-417.171) (-415.777) (-413.766) [-414.079] -- 0:00:11
811000 -- [-414.927] (-413.401) (-418.546) (-417.046) * (-414.248) [-414.135] (-413.590) (-414.645) -- 0:00:11
811500 -- (-414.372) (-414.624) [-415.921] (-415.368) * (-417.027) (-414.792) (-416.594) [-416.230] -- 0:00:11
812000 -- (-414.904) (-414.365) [-417.534] (-414.687) * [-414.430] (-415.209) (-417.096) (-415.314) -- 0:00:11
812500 -- (-419.251) (-414.559) (-413.345) [-414.651] * [-414.456] (-414.465) (-416.811) (-416.543) -- 0:00:11
813000 -- (-416.207) (-418.013) (-414.339) [-416.410] * (-412.955) (-413.812) [-414.762] (-418.921) -- 0:00:11
813500 -- (-414.827) (-416.327) [-413.933] (-416.057) * (-415.532) [-415.811] (-415.365) (-418.545) -- 0:00:11
814000 -- (-415.707) (-418.750) [-416.274] (-420.876) * (-414.913) (-415.352) [-415.955] (-417.692) -- 0:00:11
814500 -- [-417.157] (-419.057) (-419.072) (-421.748) * (-414.479) (-413.540) (-415.169) [-414.824] -- 0:00:11
815000 -- (-413.880) (-414.669) [-413.616] (-418.749) * (-421.168) (-418.595) [-414.736] (-415.118) -- 0:00:11
Average standard deviation of split frequencies: 0.009279
815500 -- (-413.538) [-412.938] (-415.152) (-415.521) * (-417.733) [-414.877] (-414.501) (-413.007) -- 0:00:11
816000 -- (-414.842) (-414.716) [-414.048] (-415.915) * (-414.818) (-414.500) (-414.261) [-413.434] -- 0:00:11
816500 -- (-412.856) (-414.866) (-415.337) [-413.507] * (-414.639) [-415.094] (-416.540) (-419.210) -- 0:00:11
817000 -- [-414.442] (-416.463) (-416.429) (-413.360) * (-413.540) [-413.891] (-416.560) (-414.436) -- 0:00:11
817500 -- (-415.316) (-416.196) [-414.708] (-414.227) * (-414.275) (-414.099) [-414.771] (-415.748) -- 0:00:11
818000 -- (-414.297) (-414.372) (-414.392) [-414.089] * [-412.988] (-416.095) (-416.913) (-418.898) -- 0:00:11
818500 -- (-418.902) (-415.467) [-415.117] (-418.707) * (-413.363) (-413.331) [-414.604] (-420.676) -- 0:00:11
819000 -- (-418.216) (-417.525) (-416.991) [-416.301] * (-414.378) (-415.041) [-415.450] (-417.886) -- 0:00:11
819500 -- (-415.124) (-415.512) [-414.707] (-417.584) * [-416.810] (-417.553) (-413.248) (-415.267) -- 0:00:11
820000 -- (-417.342) [-414.574] (-416.303) (-414.535) * (-415.342) [-414.147] (-417.308) (-419.053) -- 0:00:10
Average standard deviation of split frequencies: 0.009514
820500 -- (-415.828) (-414.873) (-418.667) [-414.663] * (-415.055) [-416.691] (-416.028) (-419.983) -- 0:00:10
821000 -- (-419.595) [-415.974] (-421.954) (-417.526) * (-421.658) (-413.749) (-417.224) [-417.628] -- 0:00:10
821500 -- (-414.747) (-414.386) [-416.900] (-416.304) * (-417.040) (-414.387) (-413.494) [-413.638] -- 0:00:10
822000 -- (-416.557) (-417.887) [-414.179] (-416.139) * (-417.250) (-414.017) [-416.242] (-414.103) -- 0:00:10
822500 -- (-413.246) [-414.695] (-414.918) (-415.667) * (-413.860) (-416.435) [-415.795] (-414.027) -- 0:00:10
823000 -- [-413.658] (-416.127) (-416.712) (-415.142) * [-414.678] (-414.414) (-414.772) (-414.543) -- 0:00:10
823500 -- (-414.682) (-414.570) (-415.221) [-415.359] * (-416.178) [-416.598] (-415.992) (-415.588) -- 0:00:10
824000 -- (-415.021) [-414.549] (-414.207) (-413.528) * (-415.963) [-414.440] (-417.520) (-414.638) -- 0:00:10
824500 -- (-413.770) (-415.771) (-414.839) [-413.704] * [-415.395] (-418.748) (-414.701) (-414.027) -- 0:00:10
825000 -- (-414.731) (-416.356) (-414.741) [-413.825] * (-419.986) (-416.977) (-415.254) [-418.204] -- 0:00:10
Average standard deviation of split frequencies: 0.009601
825500 -- [-415.240] (-416.016) (-413.593) (-413.577) * [-414.088] (-414.775) (-421.367) (-417.856) -- 0:00:10
826000 -- (-415.051) (-418.776) (-414.418) [-414.542] * (-415.281) (-416.970) [-419.680] (-416.149) -- 0:00:10
826500 -- (-419.203) (-414.956) (-414.686) [-414.075] * (-417.113) (-414.954) [-413.418] (-413.830) -- 0:00:10
827000 -- (-416.861) [-414.537] (-416.444) (-413.734) * (-418.059) (-414.970) [-414.742] (-414.886) -- 0:00:10
827500 -- (-416.862) (-413.339) [-414.947] (-417.062) * (-414.740) [-414.247] (-413.842) (-413.967) -- 0:00:10
828000 -- (-419.702) (-413.100) (-414.323) [-415.508] * (-415.479) [-413.078] (-413.853) (-414.941) -- 0:00:10
828500 -- (-413.970) (-414.129) [-416.729] (-414.541) * [-415.629] (-416.180) (-415.335) (-416.033) -- 0:00:10
829000 -- [-413.170] (-413.878) (-415.958) (-418.548) * (-414.933) (-413.985) (-416.842) [-414.774] -- 0:00:10
829500 -- [-413.784] (-414.628) (-415.955) (-418.530) * [-415.889] (-414.792) (-416.513) (-414.283) -- 0:00:10
830000 -- (-417.979) (-420.921) [-414.554] (-414.202) * (-414.584) [-416.218] (-415.157) (-414.972) -- 0:00:10
Average standard deviation of split frequencies: 0.009881
830500 -- (-414.536) (-417.844) [-414.543] (-413.513) * (-415.012) (-414.035) (-413.878) [-417.347] -- 0:00:10
831000 -- (-416.254) [-416.249] (-414.143) (-415.363) * (-415.290) [-413.824] (-415.003) (-420.615) -- 0:00:10
831500 -- (-413.872) (-415.552) (-414.308) [-417.668] * (-415.311) (-415.450) [-416.019] (-418.230) -- 0:00:10
832000 -- (-415.770) (-414.123) [-415.157] (-414.865) * (-414.884) (-418.469) [-418.132] (-419.416) -- 0:00:10
832500 -- [-413.530] (-414.465) (-415.167) (-413.856) * (-414.047) (-413.251) (-413.281) [-415.155] -- 0:00:10
833000 -- (-414.011) (-417.972) [-416.797] (-420.571) * (-415.909) [-415.150] (-415.043) (-414.980) -- 0:00:10
833500 -- (-414.287) (-416.441) (-417.083) [-414.220] * [-416.337] (-413.969) (-416.396) (-414.051) -- 0:00:10
834000 -- (-413.031) [-416.236] (-413.822) (-414.161) * (-417.528) [-414.306] (-414.838) (-414.032) -- 0:00:10
834500 -- (-415.333) (-414.705) [-415.032] (-414.909) * (-414.472) (-419.037) (-413.307) [-413.945] -- 0:00:10
835000 -- (-417.735) [-417.118] (-417.465) (-415.881) * (-414.567) [-415.800] (-415.608) (-413.305) -- 0:00:10
Average standard deviation of split frequencies: 0.010050
835500 -- (-416.959) (-414.004) [-414.073] (-414.951) * (-416.821) [-413.121] (-414.749) (-414.146) -- 0:00:10
836000 -- (-416.170) [-415.084] (-413.581) (-415.049) * (-413.477) (-413.109) (-415.175) [-415.599] -- 0:00:10
836500 -- [-414.714] (-417.337) (-413.164) (-414.095) * [-420.506] (-413.722) (-417.785) (-414.104) -- 0:00:09
837000 -- (-414.982) (-413.805) [-415.226] (-413.436) * (-416.562) (-416.187) (-419.400) [-414.781] -- 0:00:09
837500 -- (-417.261) (-416.419) [-414.175] (-414.027) * [-413.699] (-414.013) (-416.441) (-413.890) -- 0:00:09
838000 -- (-416.971) [-416.802] (-414.769) (-413.563) * (-413.881) (-416.544) [-418.038] (-414.311) -- 0:00:09
838500 -- (-416.643) (-414.172) [-414.781] (-416.235) * (-413.409) (-416.375) (-414.663) [-415.267] -- 0:00:09
839000 -- [-415.395] (-414.031) (-415.946) (-416.125) * (-416.218) (-415.810) [-414.040] (-417.692) -- 0:00:09
839500 -- (-417.429) [-415.596] (-414.112) (-416.233) * (-413.284) [-414.500] (-413.783) (-414.843) -- 0:00:09
840000 -- (-417.753) (-415.858) [-413.490] (-419.354) * [-414.006] (-414.274) (-413.183) (-415.703) -- 0:00:09
Average standard deviation of split frequencies: 0.010192
840500 -- (-416.416) (-414.148) (-415.804) [-416.499] * (-414.213) (-416.926) (-414.075) [-413.555] -- 0:00:09
841000 -- [-415.569] (-417.395) (-416.216) (-415.857) * (-413.788) (-418.361) [-414.183] (-414.082) -- 0:00:09
841500 -- (-415.522) (-414.621) (-412.870) [-414.217] * [-415.199] (-416.242) (-414.859) (-413.499) -- 0:00:09
842000 -- [-415.399] (-414.934) (-415.172) (-415.955) * [-413.226] (-421.805) (-414.827) (-419.047) -- 0:00:09
842500 -- (-413.226) [-413.989] (-414.475) (-413.804) * [-414.132] (-415.500) (-417.171) (-416.523) -- 0:00:09
843000 -- (-414.105) (-413.110) (-414.394) [-414.930] * [-412.804] (-418.065) (-414.878) (-416.725) -- 0:00:09
843500 -- (-413.336) (-419.836) (-414.294) [-414.840] * [-413.229] (-419.545) (-418.262) (-414.212) -- 0:00:09
844000 -- (-413.145) [-416.956] (-415.845) (-417.897) * (-413.975) (-424.347) [-416.612] (-414.117) -- 0:00:09
844500 -- (-413.087) (-416.277) [-415.278] (-416.974) * (-415.730) (-419.121) [-414.768] (-416.634) -- 0:00:09
845000 -- (-414.467) [-415.193] (-417.565) (-416.323) * [-415.503] (-422.204) (-415.836) (-418.355) -- 0:00:09
Average standard deviation of split frequencies: 0.010030
845500 -- (-414.555) [-416.202] (-418.335) (-416.407) * (-416.033) (-418.010) (-413.771) [-414.235] -- 0:00:09
846000 -- [-414.370] (-415.849) (-414.696) (-421.109) * (-414.813) [-414.263] (-414.747) (-414.989) -- 0:00:09
846500 -- (-414.219) (-416.645) [-415.537] (-418.680) * (-416.701) (-415.663) (-413.774) [-414.389] -- 0:00:09
847000 -- (-414.603) (-416.375) (-416.705) [-413.703] * [-414.843] (-418.974) (-413.351) (-415.637) -- 0:00:09
847500 -- (-417.619) (-419.453) (-414.537) [-415.168] * (-416.520) (-417.745) [-413.109] (-415.554) -- 0:00:09
848000 -- (-415.098) (-418.159) (-416.378) [-415.264] * (-415.570) (-420.520) [-413.400] (-417.246) -- 0:00:09
848500 -- [-414.927] (-417.975) (-413.722) (-416.509) * (-414.183) (-414.912) (-416.625) [-414.592] -- 0:00:09
849000 -- [-415.777] (-416.104) (-413.351) (-418.248) * (-415.481) (-416.553) [-415.547] (-414.406) -- 0:00:09
849500 -- (-413.231) [-414.782] (-416.655) (-414.935) * [-413.841] (-415.371) (-415.795) (-413.478) -- 0:00:09
850000 -- (-414.822) [-414.816] (-412.874) (-415.529) * (-413.944) (-413.985) [-418.037] (-415.040) -- 0:00:09
Average standard deviation of split frequencies: 0.010399
850500 -- [-413.725] (-419.080) (-412.767) (-418.446) * [-413.837] (-413.529) (-413.942) (-416.189) -- 0:00:09
851000 -- (-417.817) (-416.551) [-414.322] (-421.101) * [-413.942] (-413.686) (-416.288) (-419.012) -- 0:00:09
851500 -- (-417.406) (-415.225) [-413.279] (-418.284) * (-413.587) (-419.958) (-420.293) [-414.784] -- 0:00:09
852000 -- (-416.417) [-414.650] (-416.413) (-414.176) * (-413.777) (-417.058) [-414.823] (-414.446) -- 0:00:09
852500 -- [-414.376] (-413.789) (-415.824) (-416.006) * (-413.687) (-415.549) (-415.096) [-415.902] -- 0:00:08
853000 -- (-419.397) (-417.651) [-414.138] (-416.494) * (-417.216) (-417.335) [-413.512] (-415.060) -- 0:00:08
853500 -- [-414.749] (-414.896) (-414.046) (-413.604) * (-414.440) (-418.009) (-413.981) [-415.272] -- 0:00:08
854000 -- [-415.273] (-415.204) (-414.885) (-413.916) * (-415.331) [-413.449] (-414.384) (-415.562) -- 0:00:08
854500 -- (-415.209) (-414.112) (-415.446) [-417.280] * (-416.746) [-413.199] (-415.774) (-413.571) -- 0:00:08
855000 -- (-413.869) (-414.926) [-416.257] (-418.786) * (-415.063) (-415.577) [-413.620] (-414.073) -- 0:00:08
Average standard deviation of split frequencies: 0.010075
855500 -- (-413.733) (-414.148) [-414.354] (-414.324) * (-420.157) (-413.858) (-416.638) [-416.582] -- 0:00:08
856000 -- [-415.194] (-416.078) (-414.975) (-414.930) * (-414.708) (-417.041) [-414.242] (-416.695) -- 0:00:08
856500 -- [-414.558] (-417.452) (-413.804) (-413.483) * (-415.767) [-416.480] (-417.061) (-422.084) -- 0:00:08
857000 -- (-413.941) (-414.362) [-414.871] (-414.691) * (-416.875) (-414.795) (-415.327) [-418.205] -- 0:00:08
857500 -- (-416.370) [-414.380] (-413.802) (-415.121) * (-414.331) (-413.954) [-414.322] (-414.003) -- 0:00:08
858000 -- (-413.769) (-413.747) [-413.338] (-416.843) * (-414.332) (-415.558) [-416.087] (-416.096) -- 0:00:08
858500 -- [-415.123] (-413.750) (-417.824) (-416.579) * (-415.382) [-418.068] (-414.100) (-417.786) -- 0:00:08
859000 -- (-414.882) [-414.994] (-415.240) (-419.534) * [-416.284] (-415.760) (-416.617) (-418.450) -- 0:00:08
859500 -- (-414.433) [-416.342] (-415.175) (-417.779) * (-418.192) (-415.072) (-414.858) [-414.557] -- 0:00:08
860000 -- (-421.429) (-415.250) [-414.607] (-414.021) * (-419.957) [-413.481] (-415.103) (-414.898) -- 0:00:08
Average standard deviation of split frequencies: 0.009891
860500 -- (-414.816) [-414.522] (-413.111) (-415.716) * [-421.389] (-412.951) (-416.825) (-416.113) -- 0:00:08
861000 -- (-418.994) (-417.126) (-415.755) [-415.530] * (-421.150) (-416.372) [-415.402] (-418.274) -- 0:00:08
861500 -- (-419.025) [-415.110] (-416.435) (-418.018) * [-416.079] (-415.579) (-416.143) (-417.915) -- 0:00:08
862000 -- (-416.587) (-414.907) (-417.989) [-413.958] * (-415.082) [-416.400] (-418.076) (-414.799) -- 0:00:08
862500 -- [-412.918] (-414.336) (-415.342) (-413.076) * [-417.662] (-416.427) (-417.820) (-417.169) -- 0:00:08
863000 -- [-415.880] (-413.910) (-414.421) (-414.248) * (-414.446) (-417.746) [-414.646] (-415.505) -- 0:00:08
863500 -- (-415.092) (-413.138) (-415.259) [-414.708] * (-414.770) [-415.145] (-414.024) (-415.685) -- 0:00:08
864000 -- (-414.075) (-414.552) [-413.293] (-414.132) * (-414.348) (-418.546) [-414.912] (-419.057) -- 0:00:08
864500 -- (-415.429) [-416.157] (-413.047) (-414.533) * [-413.048] (-415.740) (-413.439) (-417.011) -- 0:00:08
865000 -- (-414.404) (-413.992) (-414.949) [-413.857] * [-413.331] (-413.455) (-414.154) (-413.561) -- 0:00:08
Average standard deviation of split frequencies: 0.010182
865500 -- (-417.178) [-414.597] (-419.397) (-418.447) * (-416.728) (-413.533) (-414.569) [-417.946] -- 0:00:08
866000 -- (-415.312) [-417.847] (-414.085) (-418.004) * (-413.369) (-414.199) [-419.032] (-416.952) -- 0:00:08
866500 -- (-416.106) (-419.289) (-413.995) [-415.458] * (-415.586) (-413.672) [-415.204] (-413.772) -- 0:00:08
867000 -- (-417.216) (-413.897) [-415.136] (-416.309) * (-413.621) [-414.076] (-413.371) (-413.752) -- 0:00:08
867500 -- (-414.928) [-415.413] (-416.543) (-415.062) * (-415.494) (-413.166) (-414.690) [-419.309] -- 0:00:08
868000 -- (-414.728) (-415.498) [-414.889] (-415.566) * [-415.548] (-413.946) (-419.581) (-417.334) -- 0:00:08
868500 -- (-415.784) [-414.929] (-414.427) (-414.643) * (-413.788) (-415.074) (-418.662) [-417.675] -- 0:00:08
869000 -- (-415.708) [-415.137] (-416.005) (-415.875) * (-415.012) (-417.194) (-417.165) [-416.137] -- 0:00:07
869500 -- [-416.069] (-414.268) (-417.781) (-414.249) * (-415.140) [-415.659] (-415.456) (-420.366) -- 0:00:07
870000 -- (-414.020) [-416.357] (-414.899) (-414.876) * (-412.942) (-416.238) [-416.723] (-418.414) -- 0:00:07
Average standard deviation of split frequencies: 0.010255
870500 -- (-417.546) (-415.671) [-417.417] (-415.290) * [-413.739] (-415.622) (-416.364) (-420.391) -- 0:00:07
871000 -- (-416.035) (-414.204) (-419.361) [-413.885] * (-414.152) [-414.648] (-417.295) (-414.378) -- 0:00:07
871500 -- (-415.139) (-415.280) [-417.283] (-413.949) * [-416.265] (-414.230) (-417.126) (-414.217) -- 0:00:07
872000 -- (-413.691) [-414.095] (-417.292) (-413.345) * (-417.577) (-413.976) [-414.185] (-414.244) -- 0:00:07
872500 -- (-414.192) (-414.295) (-414.365) [-413.858] * [-413.174] (-419.220) (-415.111) (-414.626) -- 0:00:07
873000 -- [-415.834] (-415.993) (-413.472) (-415.605) * [-417.691] (-416.849) (-415.929) (-414.630) -- 0:00:07
873500 -- [-416.045] (-422.957) (-415.630) (-413.995) * (-414.598) (-416.139) [-414.670] (-419.487) -- 0:00:07
874000 -- (-417.832) (-419.567) [-417.680] (-413.560) * (-413.964) (-417.334) [-413.466] (-415.933) -- 0:00:07
874500 -- [-415.090] (-417.354) (-415.720) (-413.374) * (-415.756) (-419.254) (-414.282) [-414.146] -- 0:00:07
875000 -- (-415.139) (-416.506) [-419.082] (-413.906) * (-415.103) (-414.865) (-413.176) [-415.107] -- 0:00:07
Average standard deviation of split frequencies: 0.010383
875500 -- (-415.042) (-414.778) (-418.623) [-413.872] * (-413.969) [-414.226] (-418.077) (-415.826) -- 0:00:07
876000 -- (-415.837) (-413.967) (-417.743) [-412.992] * (-415.787) (-414.136) (-413.523) [-415.518] -- 0:00:07
876500 -- (-413.278) (-415.536) (-417.071) [-416.562] * (-417.711) [-415.359] (-415.325) (-414.467) -- 0:00:07
877000 -- (-415.482) (-415.021) [-414.961] (-416.129) * [-414.848] (-416.332) (-412.930) (-413.276) -- 0:00:07
877500 -- (-414.197) [-417.319] (-419.030) (-415.683) * (-414.344) (-415.605) [-412.930] (-413.822) -- 0:00:07
878000 -- [-416.418] (-415.624) (-416.853) (-415.106) * (-414.821) (-417.014) (-412.909) [-415.549] -- 0:00:07
878500 -- [-416.098] (-422.907) (-415.102) (-415.313) * (-418.904) (-413.677) [-414.200] (-416.830) -- 0:00:07
879000 -- [-415.001] (-419.079) (-414.009) (-418.278) * [-416.952] (-417.614) (-414.604) (-418.419) -- 0:00:07
879500 -- (-418.032) (-415.682) (-413.865) [-415.454] * (-417.351) (-421.950) [-413.984] (-417.363) -- 0:00:07
880000 -- [-415.936] (-416.491) (-418.439) (-418.572) * (-416.452) (-417.100) [-413.641] (-416.653) -- 0:00:07
Average standard deviation of split frequencies: 0.010611
880500 -- (-413.783) (-414.386) [-414.501] (-413.108) * [-415.698] (-415.690) (-418.573) (-417.147) -- 0:00:07
881000 -- (-414.871) [-414.882] (-415.145) (-417.413) * (-414.108) [-413.539] (-417.060) (-414.506) -- 0:00:07
881500 -- [-414.824] (-418.309) (-413.702) (-417.806) * [-413.527] (-415.032) (-418.189) (-415.757) -- 0:00:07
882000 -- (-413.708) (-416.585) (-414.737) [-415.596] * (-413.668) [-420.688] (-415.902) (-413.805) -- 0:00:07
882500 -- (-415.948) (-419.425) (-414.632) [-414.587] * [-415.233] (-415.676) (-414.654) (-414.076) -- 0:00:07
883000 -- [-413.655] (-416.613) (-413.606) (-414.460) * (-417.087) (-415.052) [-415.722] (-418.435) -- 0:00:07
883500 -- (-415.249) (-413.075) (-417.842) [-416.586] * [-416.934] (-416.220) (-419.240) (-417.151) -- 0:00:07
884000 -- (-413.833) (-415.976) [-414.929] (-417.196) * [-416.119] (-415.552) (-424.068) (-419.434) -- 0:00:07
884500 -- [-413.939] (-415.591) (-414.256) (-414.770) * (-414.665) (-414.507) (-417.215) [-417.596] -- 0:00:07
885000 -- (-415.291) [-413.446] (-416.047) (-414.265) * (-413.450) [-414.908] (-415.711) (-414.468) -- 0:00:07
Average standard deviation of split frequencies: 0.010391
885500 -- (-415.115) (-419.754) [-415.768] (-413.943) * (-415.058) [-415.725] (-416.858) (-414.887) -- 0:00:06
886000 -- (-414.975) (-416.656) (-415.258) [-412.890] * (-415.572) (-414.128) [-414.404] (-414.549) -- 0:00:06
886500 -- (-418.251) (-421.088) [-414.184] (-415.186) * [-414.249] (-417.079) (-415.358) (-413.650) -- 0:00:06
887000 -- [-416.630] (-420.877) (-416.576) (-413.933) * (-414.078) (-415.366) [-415.124] (-413.153) -- 0:00:06
887500 -- [-419.619] (-415.856) (-416.228) (-413.391) * (-414.985) [-417.533] (-417.320) (-413.207) -- 0:00:06
888000 -- (-415.172) (-416.472) [-415.646] (-417.977) * (-418.598) (-415.653) (-417.910) [-414.187] -- 0:00:06
888500 -- (-414.214) (-414.889) (-414.688) [-415.975] * [-415.997] (-415.942) (-415.237) (-417.029) -- 0:00:06
889000 -- (-416.352) [-416.716] (-418.761) (-416.106) * (-415.226) (-417.823) [-415.744] (-416.288) -- 0:00:06
889500 -- (-413.889) [-414.689] (-417.933) (-416.719) * (-415.148) [-414.537] (-415.267) (-416.537) -- 0:00:06
890000 -- (-413.464) [-415.775] (-415.692) (-415.716) * (-414.365) (-413.257) [-414.290] (-414.079) -- 0:00:06
Average standard deviation of split frequencies: 0.010025
890500 -- (-413.547) [-414.394] (-415.279) (-414.616) * (-417.188) (-415.160) (-417.617) [-413.747] -- 0:00:06
891000 -- (-414.459) [-415.022] (-414.774) (-416.773) * (-416.843) (-413.435) [-419.855] (-413.953) -- 0:00:06
891500 -- (-413.989) (-416.246) (-415.014) [-415.133] * (-416.763) [-416.307] (-415.691) (-414.663) -- 0:00:06
892000 -- [-416.549] (-418.765) (-413.269) (-417.889) * (-416.675) (-414.488) (-414.509) [-414.142] -- 0:00:06
892500 -- (-414.260) (-414.225) (-418.280) [-415.051] * [-413.937] (-414.199) (-415.120) (-415.757) -- 0:00:06
893000 -- [-415.345] (-413.638) (-417.625) (-416.964) * [-416.451] (-417.376) (-417.889) (-416.205) -- 0:00:06
893500 -- (-415.527) [-414.059] (-413.375) (-414.626) * (-414.823) [-418.751] (-418.567) (-413.701) -- 0:00:06
894000 -- (-417.412) (-413.742) [-414.087] (-415.656) * (-414.978) (-415.047) [-418.788] (-413.359) -- 0:00:06
894500 -- (-414.783) [-413.457] (-413.457) (-421.579) * (-414.668) (-417.057) (-413.989) [-415.259] -- 0:00:06
895000 -- [-413.552] (-413.557) (-415.642) (-415.931) * (-416.313) (-415.007) (-415.598) [-415.968] -- 0:00:06
Average standard deviation of split frequencies: 0.009873
895500 -- [-415.343] (-413.930) (-414.543) (-417.618) * (-414.025) (-417.281) (-416.523) [-417.888] -- 0:00:06
896000 -- (-418.398) [-414.315] (-420.769) (-416.164) * (-414.232) (-419.700) [-420.670] (-414.391) -- 0:00:06
896500 -- [-415.326] (-416.789) (-413.058) (-414.670) * (-416.554) (-413.471) (-415.402) [-414.554] -- 0:00:06
897000 -- (-413.606) [-414.718] (-415.259) (-413.320) * (-413.434) (-415.143) [-414.216] (-413.833) -- 0:00:06
897500 -- (-417.903) (-414.975) [-416.010] (-414.896) * (-415.022) (-417.903) (-418.770) [-417.752] -- 0:00:06
898000 -- [-414.268] (-416.098) (-415.577) (-414.901) * (-415.358) (-416.271) [-416.146] (-413.562) -- 0:00:06
898500 -- (-414.414) (-418.482) (-416.018) [-416.037] * (-416.908) (-417.012) (-415.373) [-414.315] -- 0:00:06
899000 -- (-415.658) (-417.228) (-416.922) [-415.541] * [-415.941] (-418.584) (-414.725) (-416.662) -- 0:00:06
899500 -- (-414.414) (-415.572) (-415.421) [-418.453] * (-415.691) (-416.318) (-418.727) [-416.927] -- 0:00:06
900000 -- (-413.870) (-415.374) [-414.250] (-415.291) * (-416.130) (-415.990) (-416.484) [-414.944] -- 0:00:06
Average standard deviation of split frequencies: 0.009698
900500 -- [-413.685] (-415.349) (-415.464) (-413.585) * (-415.986) [-416.502] (-415.164) (-417.117) -- 0:00:06
901000 -- (-413.867) [-413.265] (-415.413) (-413.628) * (-415.740) [-415.788] (-415.032) (-417.640) -- 0:00:06
901500 -- [-418.182] (-413.263) (-415.811) (-416.257) * (-416.953) [-415.984] (-417.967) (-416.968) -- 0:00:06
902000 -- (-415.113) (-414.048) [-416.049] (-414.240) * (-416.181) (-417.355) (-415.999) [-416.402] -- 0:00:05
902500 -- (-418.163) (-413.327) [-416.682] (-413.440) * (-421.037) (-412.964) (-412.903) [-414.599] -- 0:00:05
903000 -- (-414.834) [-416.381] (-420.641) (-416.362) * (-416.573) [-416.042] (-413.955) (-416.548) -- 0:00:05
903500 -- [-414.614] (-414.628) (-416.887) (-413.606) * [-415.454] (-416.287) (-414.566) (-419.157) -- 0:00:05
904000 -- (-414.537) (-413.297) [-413.639] (-414.137) * (-417.680) [-414.289] (-414.593) (-415.019) -- 0:00:05
904500 -- (-416.613) [-414.436] (-414.846) (-415.786) * (-414.377) [-414.735] (-416.063) (-415.526) -- 0:00:05
905000 -- [-415.821] (-413.832) (-415.850) (-415.190) * [-414.068] (-412.846) (-413.343) (-414.167) -- 0:00:05
Average standard deviation of split frequencies: 0.009641
905500 -- (-414.898) [-413.044] (-414.015) (-421.830) * (-415.225) [-413.466] (-414.963) (-416.281) -- 0:00:05
906000 -- [-413.777] (-415.318) (-416.408) (-414.919) * [-413.459] (-418.380) (-414.690) (-414.098) -- 0:00:05
906500 -- (-417.224) [-413.353] (-413.605) (-414.575) * (-419.283) [-413.747] (-414.204) (-416.550) -- 0:00:05
907000 -- (-414.525) [-414.575] (-414.026) (-414.736) * (-415.074) (-415.748) (-417.106) [-415.154] -- 0:00:05
907500 -- (-416.218) [-416.298] (-414.581) (-416.507) * (-413.536) (-414.702) [-418.808] (-420.462) -- 0:00:05
908000 -- (-420.010) (-415.856) (-414.791) [-415.135] * (-416.543) (-416.350) (-414.715) [-414.400] -- 0:00:05
908500 -- (-419.228) [-413.747] (-413.622) (-415.299) * (-415.138) (-413.585) (-413.542) [-415.732] -- 0:00:05
909000 -- (-416.501) (-418.988) (-414.257) [-413.869] * (-417.990) (-415.123) [-415.015] (-415.201) -- 0:00:05
909500 -- [-414.276] (-420.160) (-414.705) (-414.533) * (-418.801) (-418.959) [-414.602] (-415.293) -- 0:00:05
910000 -- (-417.165) (-417.290) [-416.136] (-417.133) * (-416.414) (-417.482) (-416.255) [-414.531] -- 0:00:05
Average standard deviation of split frequencies: 0.009683
910500 -- [-414.027] (-421.597) (-416.121) (-415.753) * [-415.490] (-416.351) (-414.751) (-415.418) -- 0:00:05
911000 -- (-413.378) (-415.646) [-414.712] (-413.935) * (-413.984) [-416.698] (-413.198) (-415.142) -- 0:00:05
911500 -- (-416.484) (-418.279) [-413.060] (-414.677) * (-414.353) (-413.619) (-414.948) [-415.381] -- 0:00:05
912000 -- (-416.115) (-415.583) [-416.186] (-413.112) * [-414.107] (-413.557) (-413.450) (-414.804) -- 0:00:05
912500 -- [-414.982] (-417.673) (-416.065) (-417.035) * (-414.009) [-414.984] (-413.115) (-419.149) -- 0:00:05
913000 -- (-414.640) [-418.666] (-413.829) (-415.059) * (-414.314) (-415.848) [-413.804] (-413.323) -- 0:00:05
913500 -- (-417.422) (-420.461) [-414.572] (-413.668) * [-416.346] (-415.590) (-414.498) (-413.349) -- 0:00:05
914000 -- (-416.544) (-420.695) [-414.483] (-415.011) * (-414.657) (-415.223) (-415.775) [-414.631] -- 0:00:05
914500 -- [-415.098] (-419.737) (-418.535) (-414.603) * (-414.453) (-414.492) (-414.330) [-414.045] -- 0:00:05
915000 -- [-415.587] (-419.187) (-415.330) (-414.261) * (-414.479) (-415.114) (-416.074) [-414.747] -- 0:00:05
Average standard deviation of split frequencies: 0.009384
915500 -- (-419.505) (-418.264) (-417.009) [-416.821] * (-414.033) (-414.424) [-415.215] (-414.591) -- 0:00:05
916000 -- (-414.835) [-414.073] (-416.195) (-416.790) * (-416.034) [-414.726] (-414.807) (-417.543) -- 0:00:05
916500 -- (-415.884) (-414.057) [-414.130] (-418.886) * (-414.190) (-414.082) (-414.788) [-414.747] -- 0:00:05
917000 -- (-417.501) (-416.444) [-416.559] (-413.726) * (-413.727) (-413.290) (-414.083) [-416.141] -- 0:00:05
917500 -- [-419.272] (-414.498) (-414.585) (-413.185) * (-416.455) (-414.508) [-413.187] (-416.951) -- 0:00:05
918000 -- (-415.929) (-413.990) (-413.736) [-414.350] * (-414.695) (-414.951) (-413.411) [-415.909] -- 0:00:05
918500 -- (-416.967) [-420.241] (-417.620) (-415.431) * (-416.850) (-413.272) [-415.783] (-419.428) -- 0:00:04
919000 -- (-414.882) [-415.170] (-417.456) (-419.704) * (-415.931) (-414.013) (-416.718) [-420.765] -- 0:00:04
919500 -- [-415.232] (-415.871) (-415.788) (-419.712) * [-414.718] (-414.244) (-414.189) (-419.851) -- 0:00:04
920000 -- [-415.979] (-416.033) (-416.696) (-418.747) * (-414.846) (-413.778) [-415.241] (-419.961) -- 0:00:04
Average standard deviation of split frequencies: 0.009397
920500 -- [-413.489] (-415.952) (-414.726) (-414.085) * (-415.533) (-414.302) (-414.211) [-415.954] -- 0:00:04
921000 -- [-413.748] (-415.178) (-413.278) (-413.981) * (-414.202) (-416.668) [-415.392] (-414.827) -- 0:00:04
921500 -- (-416.048) [-415.322] (-413.362) (-413.513) * (-417.587) (-413.600) [-416.121] (-416.034) -- 0:00:04
922000 -- (-415.369) [-416.157] (-416.012) (-417.272) * (-416.461) (-414.009) [-417.313] (-414.579) -- 0:00:04
922500 -- [-414.294] (-414.534) (-414.743) (-421.052) * (-421.664) [-418.347] (-414.139) (-416.258) -- 0:00:04
923000 -- (-420.126) (-414.770) [-413.940] (-416.813) * (-421.745) (-416.946) [-414.677] (-414.325) -- 0:00:04
923500 -- (-423.177) (-416.396) (-415.415) [-414.316] * (-414.619) (-415.242) [-413.165] (-414.787) -- 0:00:04
924000 -- (-416.253) [-415.695] (-415.171) (-415.413) * (-415.736) [-419.284] (-413.457) (-419.344) -- 0:00:04
924500 -- (-419.101) [-415.455] (-414.692) (-413.202) * (-421.258) (-421.580) [-416.062] (-417.202) -- 0:00:04
925000 -- (-415.669) (-414.915) [-414.063] (-415.197) * (-413.714) [-415.336] (-417.868) (-425.367) -- 0:00:04
Average standard deviation of split frequencies: 0.009433
925500 -- (-415.503) (-414.700) [-415.585] (-415.658) * [-417.537] (-413.437) (-417.532) (-419.737) -- 0:00:04
926000 -- [-415.585] (-414.826) (-413.892) (-416.290) * (-414.617) [-412.951] (-414.304) (-414.199) -- 0:00:04
926500 -- (-416.170) (-417.120) [-414.406] (-415.065) * (-413.454) (-415.302) (-414.240) [-413.715] -- 0:00:04
927000 -- [-416.974] (-413.628) (-413.697) (-414.700) * (-417.130) (-416.185) (-415.828) [-413.629] -- 0:00:04
927500 -- (-418.706) [-413.390] (-415.906) (-416.126) * (-413.830) (-413.948) (-421.293) [-417.129] -- 0:00:04
928000 -- (-414.750) [-413.593] (-416.949) (-415.472) * (-415.950) (-413.589) [-417.589] (-415.342) -- 0:00:04
928500 -- (-418.082) (-415.226) (-415.150) [-415.211] * (-415.685) (-414.282) [-416.444] (-414.630) -- 0:00:04
929000 -- (-415.514) [-414.247] (-415.942) (-414.372) * [-415.382] (-421.369) (-416.028) (-416.785) -- 0:00:04
929500 -- (-414.769) [-415.473] (-414.853) (-416.123) * [-416.811] (-415.610) (-415.132) (-417.501) -- 0:00:04
930000 -- (-415.802) [-415.686] (-414.336) (-415.768) * (-417.085) [-418.510] (-418.889) (-415.343) -- 0:00:04
Average standard deviation of split frequencies: 0.009117
930500 -- [-415.880] (-413.481) (-416.617) (-415.790) * (-418.188) [-416.802] (-414.965) (-413.369) -- 0:00:04
931000 -- (-413.211) (-415.297) [-415.184] (-416.616) * (-414.899) [-415.060] (-415.711) (-415.490) -- 0:00:04
931500 -- (-412.751) (-414.607) (-417.296) [-418.197] * (-416.557) (-418.133) [-414.893] (-416.525) -- 0:00:04
932000 -- [-415.059] (-414.484) (-419.407) (-414.072) * (-420.929) (-421.883) (-415.064) [-414.082] -- 0:00:04
932500 -- (-416.158) [-416.259] (-414.473) (-413.960) * [-414.149] (-417.514) (-416.732) (-414.534) -- 0:00:04
933000 -- (-413.752) [-414.676] (-414.825) (-416.612) * (-414.859) [-414.464] (-416.126) (-416.251) -- 0:00:04
933500 -- [-416.531] (-418.674) (-418.207) (-415.970) * (-416.884) [-414.017] (-414.996) (-418.244) -- 0:00:04
934000 -- [-415.649] (-414.885) (-417.215) (-417.104) * (-415.307) (-417.965) [-414.700] (-413.705) -- 0:00:04
934500 -- [-414.823] (-415.203) (-414.712) (-418.351) * (-414.635) (-416.080) (-415.247) [-415.777] -- 0:00:03
935000 -- (-413.877) [-414.285] (-417.769) (-413.646) * (-415.355) (-414.440) (-415.029) [-415.269] -- 0:00:03
Average standard deviation of split frequencies: 0.009036
935500 -- (-416.411) [-414.440] (-415.750) (-414.080) * (-414.172) (-414.593) (-414.369) [-414.745] -- 0:00:03
936000 -- (-414.699) (-415.385) (-416.575) [-414.711] * (-418.593) (-414.934) [-416.573] (-422.608) -- 0:00:03
936500 -- [-414.221] (-413.744) (-417.903) (-416.555) * (-417.627) (-414.666) [-415.979] (-417.848) -- 0:00:03
937000 -- (-414.966) (-415.829) [-414.701] (-414.276) * (-414.792) (-414.101) [-416.310] (-414.453) -- 0:00:03
937500 -- (-414.432) (-415.886) (-414.289) [-413.279] * (-414.727) (-414.852) (-417.161) [-414.033] -- 0:00:03
938000 -- (-415.150) (-414.629) [-413.429] (-413.868) * (-415.398) (-413.730) [-415.632] (-415.074) -- 0:00:03
938500 -- (-413.413) (-415.964) (-415.188) [-413.723] * (-414.038) [-414.533] (-416.717) (-413.320) -- 0:00:03
939000 -- (-416.269) [-415.011] (-414.978) (-416.940) * (-414.220) (-414.030) (-417.277) [-414.380] -- 0:00:03
939500 -- (-414.370) (-414.849) (-415.797) [-417.071] * (-416.531) [-414.730] (-417.624) (-415.462) -- 0:00:03
940000 -- (-417.788) [-414.146] (-415.010) (-413.285) * (-415.987) (-418.317) (-417.268) [-413.793] -- 0:00:03
Average standard deviation of split frequencies: 0.008844
940500 -- (-416.923) [-413.193] (-415.692) (-417.411) * (-419.440) (-415.965) [-413.224] (-416.163) -- 0:00:03
941000 -- [-414.453] (-413.415) (-415.073) (-414.364) * (-415.692) [-414.559] (-417.255) (-415.727) -- 0:00:03
941500 -- (-414.050) [-415.763] (-413.605) (-413.557) * (-416.641) (-414.231) [-416.195] (-416.159) -- 0:00:03
942000 -- (-413.814) (-415.642) [-415.901] (-415.124) * (-414.245) [-416.145] (-414.926) (-416.431) -- 0:00:03
942500 -- (-416.977) (-414.160) (-414.063) [-416.239] * (-414.991) (-416.264) (-417.662) [-413.526] -- 0:00:03
943000 -- [-416.710] (-416.715) (-415.198) (-417.065) * [-416.150] (-418.220) (-419.951) (-413.032) -- 0:00:03
943500 -- (-414.759) (-414.663) (-415.347) [-413.686] * (-416.355) (-413.181) (-414.662) [-415.176] -- 0:00:03
944000 -- [-415.401] (-413.936) (-418.188) (-414.797) * (-415.699) (-416.236) (-413.424) [-415.982] -- 0:00:03
944500 -- [-415.414] (-417.347) (-417.238) (-413.701) * (-416.958) [-415.177] (-417.263) (-417.330) -- 0:00:03
945000 -- [-416.487] (-414.146) (-415.358) (-414.176) * [-414.562] (-413.800) (-416.360) (-417.308) -- 0:00:03
Average standard deviation of split frequencies: 0.008618
945500 -- (-415.124) [-413.350] (-415.242) (-416.434) * (-413.047) [-415.050] (-415.269) (-421.346) -- 0:00:03
946000 -- (-419.454) [-416.449] (-414.289) (-413.041) * (-419.027) (-412.950) [-413.692] (-414.690) -- 0:00:03
946500 -- (-416.653) (-421.506) [-412.830] (-413.598) * (-415.842) (-414.681) (-418.684) [-413.586] -- 0:00:03
947000 -- (-414.644) [-418.877] (-414.668) (-415.208) * (-414.097) (-416.213) (-418.044) [-415.675] -- 0:00:03
947500 -- (-420.162) (-417.701) (-413.958) [-415.015] * [-416.048] (-415.228) (-414.760) (-415.265) -- 0:00:03
948000 -- (-416.929) (-418.356) [-413.195] (-417.149) * (-413.886) [-415.861] (-419.445) (-413.775) -- 0:00:03
948500 -- [-416.114] (-416.768) (-415.357) (-417.646) * (-415.240) (-413.942) (-415.163) [-414.577] -- 0:00:03
949000 -- (-418.086) [-416.955] (-414.590) (-413.990) * [-413.830] (-418.795) (-417.775) (-417.577) -- 0:00:03
949500 -- [-413.736] (-417.731) (-415.612) (-416.198) * (-413.628) [-418.414] (-416.679) (-416.502) -- 0:00:03
950000 -- (-416.721) [-414.584] (-414.355) (-416.219) * (-413.677) (-414.526) [-413.419] (-415.270) -- 0:00:03
Average standard deviation of split frequencies: 0.008430
950500 -- [-415.397] (-413.977) (-414.116) (-413.727) * (-413.730) (-419.234) (-420.815) [-419.099] -- 0:00:03
951000 -- (-413.587) [-416.160] (-414.613) (-414.774) * (-414.974) [-414.269] (-413.257) (-416.234) -- 0:00:02
951500 -- [-413.104] (-416.473) (-413.944) (-418.370) * [-414.157] (-414.120) (-413.619) (-418.203) -- 0:00:02
952000 -- (-414.367) (-417.460) [-418.288] (-413.247) * [-415.199] (-413.198) (-413.326) (-415.035) -- 0:00:02
952500 -- (-415.524) (-421.662) (-414.893) [-412.893] * [-413.277] (-418.447) (-415.731) (-415.858) -- 0:00:02
953000 -- [-414.055] (-415.323) (-415.254) (-416.938) * (-414.328) (-414.054) [-413.983] (-417.317) -- 0:00:02
953500 -- (-413.975) (-417.173) (-414.553) [-416.233] * (-416.010) (-413.498) (-417.706) [-414.808] -- 0:00:02
954000 -- (-414.377) [-415.289] (-417.202) (-415.187) * (-419.507) (-414.310) [-419.217] (-413.398) -- 0:00:02
954500 -- (-414.852) [-414.596] (-414.117) (-416.885) * (-417.846) [-414.652] (-414.857) (-413.675) -- 0:00:02
955000 -- (-415.122) [-413.320] (-415.121) (-416.130) * (-414.398) [-417.158] (-413.670) (-412.897) -- 0:00:02
Average standard deviation of split frequencies: 0.008760
955500 -- (-414.265) [-415.587] (-414.894) (-413.849) * (-416.010) (-413.989) (-414.868) [-413.169] -- 0:00:02
956000 -- (-415.162) (-415.175) (-417.101) [-413.920] * (-414.054) (-414.863) (-414.392) [-413.101] -- 0:00:02
956500 -- (-417.747) (-418.281) (-423.324) [-417.614] * (-413.161) (-413.680) [-416.203] (-417.785) -- 0:00:02
957000 -- (-413.736) (-417.721) (-422.729) [-416.439] * (-416.193) [-415.018] (-415.589) (-420.395) -- 0:00:02
957500 -- (-416.249) (-417.848) [-422.847] (-415.059) * [-416.874] (-415.600) (-415.405) (-415.042) -- 0:00:02
958000 -- [-415.623] (-416.094) (-418.388) (-419.912) * (-413.358) [-414.553] (-422.100) (-415.457) -- 0:00:02
958500 -- (-418.190) (-416.076) [-416.932] (-416.191) * (-415.856) (-415.808) [-414.871] (-413.259) -- 0:00:02
959000 -- [-414.174] (-415.185) (-418.553) (-414.433) * (-414.515) (-415.410) [-414.443] (-415.150) -- 0:00:02
959500 -- (-416.272) (-414.305) [-414.940] (-415.799) * [-416.186] (-414.212) (-413.722) (-415.181) -- 0:00:02
960000 -- (-417.396) [-415.288] (-416.894) (-416.799) * (-421.231) [-413.718] (-415.981) (-415.638) -- 0:00:02
Average standard deviation of split frequencies: 0.009208
960500 -- [-416.122] (-412.965) (-418.938) (-415.722) * (-413.738) (-413.519) (-415.517) [-414.128] -- 0:00:02
961000 -- (-419.105) (-414.464) (-416.113) [-416.454] * (-413.924) (-414.999) (-418.357) [-415.049] -- 0:00:02
961500 -- (-422.132) (-412.739) (-415.676) [-413.358] * (-415.449) (-416.639) [-417.347] (-414.727) -- 0:00:02
962000 -- (-418.522) (-415.133) (-414.668) [-415.088] * [-413.998] (-421.136) (-413.952) (-414.037) -- 0:00:02
962500 -- (-416.386) (-414.003) (-413.906) [-415.949] * (-413.857) (-413.903) (-413.970) [-416.742] -- 0:00:02
963000 -- [-415.573] (-414.557) (-414.172) (-415.272) * [-414.455] (-420.301) (-416.661) (-415.421) -- 0:00:02
963500 -- (-414.755) (-414.036) [-414.983] (-413.057) * (-416.644) (-418.489) (-417.335) [-416.108] -- 0:00:02
964000 -- [-413.793] (-413.912) (-418.678) (-414.047) * (-419.551) (-420.206) [-413.386] (-413.867) -- 0:00:02
964500 -- (-416.339) (-413.321) (-415.508) [-417.528] * (-415.213) (-418.403) (-417.078) [-416.544] -- 0:00:02
965000 -- (-413.894) [-417.652] (-417.856) (-414.000) * (-417.244) [-414.984] (-421.198) (-417.436) -- 0:00:02
Average standard deviation of split frequencies: 0.009089
965500 -- [-413.538] (-420.081) (-415.856) (-415.505) * [-414.184] (-416.222) (-414.465) (-416.041) -- 0:00:02
966000 -- (-417.228) (-413.100) [-414.464] (-417.027) * [-415.874] (-416.572) (-413.626) (-419.111) -- 0:00:02
966500 -- (-419.068) (-413.303) (-414.499) [-413.037] * (-414.278) (-412.929) [-414.714] (-413.361) -- 0:00:02
967000 -- (-415.343) [-418.765] (-413.601) (-416.442) * (-414.152) [-418.865] (-413.403) (-417.241) -- 0:00:02
967500 -- [-413.496] (-417.606) (-413.379) (-414.180) * (-421.567) (-416.009) (-414.771) [-415.979] -- 0:00:01
968000 -- (-416.261) [-413.327] (-413.894) (-413.428) * (-417.952) (-414.304) (-414.066) [-415.565] -- 0:00:01
968500 -- (-414.967) [-416.391] (-414.253) (-416.396) * (-415.281) (-414.419) (-414.735) [-415.551] -- 0:00:01
969000 -- (-415.249) (-416.069) (-414.833) [-414.935] * (-418.217) [-420.486] (-419.865) (-413.491) -- 0:00:01
969500 -- [-415.063] (-416.232) (-419.032) (-416.011) * (-413.620) [-416.220] (-424.472) (-413.981) -- 0:00:01
970000 -- (-415.605) (-415.201) [-416.921] (-413.110) * (-416.356) (-414.385) (-416.672) [-414.794] -- 0:00:01
Average standard deviation of split frequencies: 0.009076
970500 -- [-414.969] (-414.534) (-420.998) (-414.716) * (-414.881) (-415.716) [-416.077] (-425.879) -- 0:00:01
971000 -- (-414.690) (-417.061) [-417.945] (-413.873) * (-414.191) (-416.188) (-415.160) [-413.444] -- 0:00:01
971500 -- [-415.473] (-417.297) (-415.555) (-415.589) * (-416.903) [-414.042] (-416.276) (-416.349) -- 0:00:01
972000 -- (-415.010) (-415.511) (-415.954) [-414.607] * [-416.748] (-418.458) (-418.317) (-414.605) -- 0:00:01
972500 -- (-415.151) (-413.263) (-414.978) [-413.206] * [-414.468] (-413.232) (-414.902) (-414.599) -- 0:00:01
973000 -- (-414.643) [-414.440] (-414.581) (-415.330) * (-415.342) (-415.529) [-416.071] (-414.588) -- 0:00:01
973500 -- [-413.708] (-415.270) (-415.191) (-414.025) * (-415.720) [-416.308] (-420.435) (-413.441) -- 0:00:01
974000 -- (-412.942) (-414.635) [-413.855] (-414.381) * (-415.000) (-417.840) (-414.129) [-413.383] -- 0:00:01
974500 -- (-417.954) [-415.632] (-414.319) (-414.846) * [-413.447] (-418.659) (-414.622) (-414.916) -- 0:00:01
975000 -- [-417.747] (-416.744) (-414.199) (-417.517) * (-414.163) (-414.788) [-413.247] (-415.100) -- 0:00:01
Average standard deviation of split frequencies: 0.008483
975500 -- [-414.388] (-413.762) (-417.391) (-414.603) * (-413.768) (-415.832) [-414.789] (-414.958) -- 0:00:01
976000 -- [-414.293] (-415.935) (-413.831) (-415.084) * (-414.604) [-412.741] (-415.114) (-416.011) -- 0:00:01
976500 -- (-416.939) (-416.740) [-413.222] (-418.118) * (-417.863) [-417.740] (-418.499) (-417.383) -- 0:00:01
977000 -- (-413.515) (-415.230) [-418.745] (-418.651) * (-422.761) (-415.842) [-418.551] (-413.176) -- 0:00:01
977500 -- (-415.484) [-417.825] (-414.734) (-417.175) * (-413.949) [-417.398] (-417.137) (-414.627) -- 0:00:01
978000 -- [-414.976] (-413.346) (-415.969) (-414.733) * [-415.519] (-417.289) (-414.451) (-414.061) -- 0:00:01
978500 -- (-417.431) (-415.196) [-413.059] (-414.163) * (-414.724) [-413.839] (-414.822) (-415.750) -- 0:00:01
979000 -- (-415.403) (-418.701) (-414.647) [-416.999] * (-416.386) (-413.710) [-415.374] (-414.943) -- 0:00:01
979500 -- (-418.047) (-414.417) [-412.719] (-414.479) * (-415.403) (-415.362) [-414.622] (-414.406) -- 0:00:01
980000 -- (-415.291) [-414.237] (-414.342) (-416.485) * (-415.994) [-413.981] (-413.446) (-414.162) -- 0:00:01
Average standard deviation of split frequencies: 0.008472
980500 -- (-422.832) (-413.459) [-416.806] (-415.175) * (-414.400) [-414.122] (-413.512) (-415.053) -- 0:00:01
981000 -- (-416.706) (-414.447) [-415.253] (-416.504) * [-415.721] (-417.519) (-413.921) (-415.042) -- 0:00:01
981500 -- (-418.718) (-416.421) (-415.645) [-415.829] * (-415.838) (-418.838) (-413.343) [-413.511] -- 0:00:01
982000 -- (-416.999) [-415.898] (-415.898) (-415.482) * [-417.389] (-416.068) (-413.358) (-414.769) -- 0:00:01
982500 -- (-415.689) (-417.318) (-414.723) [-414.644] * (-414.549) (-416.678) [-414.762] (-414.026) -- 0:00:01
983000 -- (-417.973) (-416.104) (-414.734) [-414.161] * [-414.249] (-415.236) (-413.966) (-416.350) -- 0:00:01
983500 -- (-415.444) (-415.792) [-413.963] (-413.920) * [-414.522] (-413.170) (-413.980) (-417.632) -- 0:00:01
984000 -- (-415.208) (-414.841) (-417.112) [-416.387] * (-414.485) (-414.187) [-416.512] (-421.066) -- 0:00:00
984500 -- [-414.024] (-414.281) (-414.880) (-419.723) * (-415.341) (-415.001) (-421.146) [-417.083] -- 0:00:00
985000 -- (-417.804) (-413.704) (-414.577) [-416.187] * (-419.026) (-415.651) [-414.923] (-415.776) -- 0:00:00
Average standard deviation of split frequencies: 0.008550
985500 -- (-419.043) (-412.860) [-418.304] (-413.628) * [-418.418] (-415.884) (-420.895) (-414.671) -- 0:00:00
986000 -- (-419.819) [-414.847] (-419.607) (-416.133) * [-416.025] (-420.240) (-417.650) (-415.209) -- 0:00:00
986500 -- (-418.038) (-413.718) (-415.866) [-413.677] * [-414.557] (-416.467) (-415.199) (-416.643) -- 0:00:00
987000 -- (-416.870) (-414.886) [-414.315] (-413.788) * (-418.055) (-415.747) [-413.890] (-415.034) -- 0:00:00
987500 -- (-415.256) [-415.748] (-418.130) (-415.441) * [-413.505] (-413.272) (-413.693) (-415.589) -- 0:00:00
988000 -- (-417.180) [-414.343] (-415.585) (-416.268) * (-416.115) [-416.485] (-414.153) (-414.263) -- 0:00:00
988500 -- (-414.810) (-414.835) (-417.191) [-415.168] * [-414.159] (-413.624) (-414.710) (-414.964) -- 0:00:00
989000 -- (-414.600) (-414.483) (-413.582) [-416.033] * (-416.755) (-414.360) [-416.235] (-414.569) -- 0:00:00
989500 -- [-415.354] (-414.749) (-415.380) (-415.406) * (-416.318) [-415.023] (-414.838) (-413.537) -- 0:00:00
990000 -- [-414.863] (-413.186) (-418.973) (-417.626) * (-416.224) (-414.798) [-415.133] (-413.217) -- 0:00:00
Average standard deviation of split frequencies: 0.008789
990500 -- (-415.373) [-415.858] (-414.870) (-416.134) * (-416.634) [-414.829] (-414.014) (-414.160) -- 0:00:00
991000 -- [-415.038] (-416.311) (-414.445) (-415.860) * (-414.291) [-414.680] (-415.820) (-415.072) -- 0:00:00
991500 -- [-414.643] (-416.653) (-417.717) (-418.626) * (-414.586) (-418.176) [-414.309] (-415.497) -- 0:00:00
992000 -- (-414.585) (-415.531) [-415.639] (-416.337) * (-414.230) (-414.938) (-416.416) [-414.119] -- 0:00:00
992500 -- [-418.680] (-416.830) (-415.424) (-419.517) * [-417.335] (-415.068) (-421.053) (-415.555) -- 0:00:00
993000 -- (-417.209) [-413.600] (-412.853) (-415.567) * (-416.967) (-417.542) [-413.997] (-415.825) -- 0:00:00
993500 -- (-414.545) [-413.852] (-415.048) (-415.666) * (-414.493) (-413.639) (-415.884) [-417.011] -- 0:00:00
994000 -- (-415.040) (-413.661) (-413.752) [-415.071] * (-417.136) (-413.941) [-414.619] (-416.099) -- 0:00:00
994500 -- (-419.960) [-415.146] (-416.296) (-413.971) * (-413.917) (-415.281) [-413.335] (-415.246) -- 0:00:00
995000 -- (-418.348) (-414.864) (-415.084) [-414.227] * (-417.259) [-414.587] (-412.904) (-415.848) -- 0:00:00
Average standard deviation of split frequencies: 0.008881
995500 -- (-415.848) [-417.488] (-418.198) (-416.649) * (-415.087) (-414.027) (-416.198) [-415.949] -- 0:00:00
996000 -- [-415.100] (-413.789) (-416.881) (-414.661) * (-415.902) (-414.011) (-415.457) [-417.943] -- 0:00:00
996500 -- [-415.909] (-414.273) (-417.173) (-414.009) * (-421.528) [-414.580] (-414.017) (-416.216) -- 0:00:00
997000 -- (-415.168) (-416.186) [-414.438] (-415.557) * [-416.705] (-413.684) (-414.665) (-418.097) -- 0:00:00
997500 -- (-421.377) (-414.398) (-418.089) [-417.714] * (-417.946) [-413.189] (-416.153) (-414.289) -- 0:00:00
998000 -- (-415.653) [-414.761] (-414.126) (-413.163) * [-419.092] (-414.848) (-416.317) (-413.095) -- 0:00:00
998500 -- [-415.791] (-414.637) (-413.570) (-415.619) * [-415.644] (-413.536) (-417.134) (-413.837) -- 0:00:00
999000 -- (-414.576) [-415.383] (-416.968) (-414.614) * (-414.480) (-414.719) (-418.585) [-413.718] -- 0:00:00
999500 -- [-414.546] (-413.521) (-422.083) (-417.811) * (-417.633) (-414.143) [-416.523] (-416.203) -- 0:00:00
1000000 -- (-416.069) [-413.239] (-419.127) (-416.114) * [-415.015] (-415.228) (-418.004) (-416.848) -- 0:00:00
Average standard deviation of split frequencies: 0.008539
Analysis completed in 1 mins 1 seconds
Analysis used 59.54 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -412.70
Likelihood of best state for "cold" chain of run 2 was -412.70
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.1 % ( 25 %) Dirichlet(Pi{all})
38.0 % ( 28 %) Slider(Pi{all})
78.9 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 55 %) Multiplier(Alpha{3})
25.3 % ( 31 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.0 % ( 36 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.4 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.1 % ( 36 %) Dirichlet(Pi{all})
38.8 % ( 26 %) Slider(Pi{all})
78.4 % ( 56 %) Multiplier(Alpha{1,2})
77.5 % ( 50 %) Multiplier(Alpha{3})
26.6 % ( 31 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 19 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.6 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166629 0.82 0.67
3 | 166750 166929 0.84
4 | 167030 165867 166795
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166185 0.83 0.67
3 | 166768 166977 0.84
4 | 166563 167012 166495
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -414.44
| 2 |
| 2 11 |
| 1 1 1 1 2 1 1 |
| 22 2 1 1 2 1 1 * 1 1 |
|1 1 2 12 1 1 2 2 |
| 21 2 22 1 12 22 21 12 |
| 1 122 2 2 2 2 *2 *22 1 1 1 2 1 1 |
| 2 2 1 1 1 11 2 2*2 1* 12 **|
|2 1 1 21 11 2 2 1 |
| 1 2 2 22 12 12 |
| 1 2 2 * 1 2 2 |
| 1 2 1 |
| 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -416.16
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -414.44 -417.66
2 -414.43 -417.77
--------------------------------------
TOTAL -414.44 -417.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891645 0.087389 0.366327 1.489685 0.861442 1383.64 1442.32 1.000
r(A<->C){all} 0.155596 0.017293 0.000005 0.429578 0.120317 185.88 201.00 1.001
r(A<->G){all} 0.167994 0.021375 0.000174 0.456098 0.128872 154.08 176.73 1.003
r(A<->T){all} 0.167954 0.020527 0.000042 0.457870 0.130367 210.45 252.30 1.000
r(C<->G){all} 0.167804 0.020226 0.000044 0.446710 0.129266 122.73 150.28 1.000
r(C<->T){all} 0.169179 0.020782 0.000080 0.457266 0.130392 182.28 217.18 1.002
r(G<->T){all} 0.171474 0.021983 0.000078 0.470734 0.131847 203.52 266.70 1.001
pi(A){all} 0.175522 0.000461 0.136161 0.219480 0.174877 1349.80 1365.27 1.001
pi(C){all} 0.244964 0.000588 0.197077 0.291876 0.244144 1291.60 1396.30 1.000
pi(G){all} 0.328987 0.000709 0.273454 0.377725 0.328684 1332.55 1340.50 1.000
pi(T){all} 0.250527 0.000623 0.203839 0.300627 0.250206 1038.43 1186.35 1.000
alpha{1,2} 0.414210 0.228991 0.000376 1.392937 0.237317 814.86 839.22 1.000
alpha{3} 0.460864 0.246784 0.000243 1.449607 0.302296 1167.17 1334.09 1.000
pinvar{all} 0.994579 0.000047 0.981977 0.999996 0.996641 1248.62 1374.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .**...
9 -- ..*..*
10 -- .****.
11 -- ..*.*.
12 -- .**.**
13 -- .*.***
14 -- ...*.*
15 -- .*.*..
16 -- ..**..
17 -- .*...*
18 -- .*..*.
19 -- .***.*
20 -- ..****
21 -- ....**
22 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.008009 0.149900 0.161226 2
8 467 0.155563 0.005182 0.151899 0.159227 2
9 451 0.150233 0.011777 0.141905 0.158561 2
10 448 0.149234 0.015075 0.138574 0.159893 2
11 431 0.143571 0.001413 0.142572 0.144570 2
12 429 0.142905 0.000471 0.142572 0.143238 2
13 427 0.142239 0.011777 0.133911 0.150566 2
14 424 0.141239 0.004711 0.137908 0.144570 2
15 422 0.140573 0.005653 0.136576 0.144570 2
16 420 0.139907 0.009422 0.133245 0.146569 2
17 419 0.139574 0.011777 0.131246 0.147901 2
18 411 0.136909 0.012719 0.127915 0.145903 2
19 410 0.136576 0.007537 0.131246 0.141905 2
20 407 0.135576 0.001413 0.134577 0.136576 2
21 401 0.133578 0.016488 0.121919 0.145237 2
22 280 0.093271 0.013191 0.083944 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099548 0.009322 0.000016 0.297133 0.071054 1.000 2
length{all}[2] 0.097363 0.008714 0.000030 0.288754 0.068545 1.000 2
length{all}[3] 0.097464 0.009826 0.000032 0.292822 0.066881 1.000 2
length{all}[4] 0.097844 0.009124 0.000006 0.290959 0.067603 1.000 2
length{all}[5] 0.097888 0.009398 0.000071 0.302494 0.066429 1.000 2
length{all}[6] 0.100429 0.009835 0.000010 0.292924 0.069733 1.000 2
length{all}[7] 0.105239 0.009064 0.000215 0.305196 0.074461 1.009 2
length{all}[8] 0.102753 0.008994 0.000054 0.280766 0.076505 0.998 2
length{all}[9] 0.101564 0.011108 0.000016 0.315707 0.072907 0.998 2
length{all}[10] 0.101071 0.010114 0.000013 0.300537 0.070751 0.998 2
length{all}[11] 0.105256 0.011074 0.000642 0.335208 0.071744 1.008 2
length{all}[12] 0.094892 0.008103 0.000460 0.285591 0.068216 0.999 2
length{all}[13] 0.097127 0.009913 0.000044 0.302973 0.066579 1.000 2
length{all}[14] 0.102081 0.009920 0.000097 0.298009 0.070185 1.003 2
length{all}[15] 0.095579 0.009117 0.000017 0.311611 0.067919 1.006 2
length{all}[16] 0.102153 0.008848 0.000018 0.264840 0.076345 1.000 2
length{all}[17] 0.098750 0.009951 0.000431 0.303158 0.069129 0.999 2
length{all}[18] 0.099600 0.010231 0.001179 0.283688 0.068480 0.998 2
length{all}[19] 0.101241 0.011144 0.000191 0.287724 0.066335 1.000 2
length{all}[20] 0.097939 0.009345 0.000183 0.288579 0.065684 0.999 2
length{all}[21] 0.101738 0.009852 0.000022 0.307210 0.070799 0.998 2
length{all}[22] 0.099200 0.008935 0.000264 0.305744 0.073718 0.996 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008539
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 303
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 101 / 101 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 101 / 101 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029741 0.016355 0.043893 0.048735 0.022395 0.014983 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -411.994265
Iterating by ming2
Initial: fx= 411.994265
x= 0.02974 0.01636 0.04389 0.04874 0.02239 0.01498 0.30000 1.30000
1 h-m-p 0.0000 0.0002 243.6064 ++ 403.068224 m 0.0002 13 | 1/8
2 h-m-p 0.0014 0.0972 23.1037 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 222.9082 ++ 402.384385 m 0.0000 44 | 2/8
4 h-m-p 0.0002 0.1150 20.6367 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 199.2733 ++ 399.974586 m 0.0001 74 | 3/8
6 h-m-p 0.0006 0.1440 16.7970 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 172.6240 ++ 397.771635 m 0.0001 105 | 4/8
8 h-m-p 0.0008 0.1910 13.1521 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 140.9968 ++ 394.930714 m 0.0001 136 | 5/8
10 h-m-p 0.0015 0.2825 9.3576 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 99.9296 ++ 394.442368 m 0.0000 167 | 6/8
12 h-m-p 0.4504 8.0000 0.0000 Y 394.442368 0 0.1250 178 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 --------------N 394.442368 0 0.0000 205
Out..
lnL = -394.442368
206 lfun, 206 eigenQcodon, 1236 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079326 0.089489 0.014621 0.109399 0.031572 0.084632 0.300025 0.666522 0.514466
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.536737
np = 9
lnL0 = -434.293757
Iterating by ming2
Initial: fx= 434.293757
x= 0.07933 0.08949 0.01462 0.10940 0.03157 0.08463 0.30003 0.66652 0.51447
1 h-m-p 0.0000 0.0002 234.5034 ++ 425.958861 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0004 170.9140 ++ 417.695411 m 0.0004 26 | 2/9
3 h-m-p 0.0002 0.0008 143.9282 ++ 399.765302 m 0.0008 38 | 3/9
4 h-m-p 0.0003 0.0013 46.3042 ++ 397.168389 m 0.0013 50 | 4/9
5 h-m-p 0.0000 0.0000 1563.4861 ++ 396.160410 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 2508.4709 ++ 394.442345 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 394.442345 m 8.0000 86 | 6/9
8 h-m-p 0.0084 1.9901 0.1162 ++++ 394.442318 m 1.9901 103 | 7/9
9 h-m-p 0.7018 5.2588 0.1721 -------------Y 394.442318 0 0.0000 131 | 7/9
10 h-m-p 0.0160 8.0000 0.0024 +++++ 394.442314 m 8.0000 148 | 7/9
11 h-m-p 0.0852 4.0016 0.2211 -----------Y 394.442314 0 0.0000 173 | 7/9
12 h-m-p 0.0160 8.0000 0.0006 +++++ 394.442313 m 8.0000 190 | 7/9
13 h-m-p 0.0240 4.3024 0.2073 ----------C 394.442313 0 0.0000 214 | 7/9
14 h-m-p 0.0160 8.0000 0.0008 +++++ 394.442312 m 8.0000 231 | 7/9
15 h-m-p 0.0289 4.1208 0.2177 -------------N 394.442312 0 0.0000 258 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 -----N 394.442312 0 0.0000 277 | 7/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 394.442312 m 8.0000 294 | 7/9
18 h-m-p 0.0087 4.3449 0.2057 ---------C 394.442312 0 0.0000 317 | 7/9
19 h-m-p 0.0160 8.0000 0.0004 -------N 394.442312 0 0.0000 338 | 7/9
20 h-m-p 0.0160 8.0000 0.0002 +++++ 394.442312 m 8.0000 355 | 7/9
21 h-m-p 0.0096 4.7769 0.1980 ------------C 394.442312 0 0.0000 381 | 7/9
22 h-m-p 0.0160 8.0000 0.0000 -----Y 394.442312 0 0.0000 400 | 7/9
23 h-m-p 0.0160 8.0000 0.0000 +++++ 394.442312 m 8.0000 417 | 7/9
24 h-m-p 0.0093 4.6269 0.1983 ----------Y 394.442312 0 0.0000 441 | 7/9
25 h-m-p 0.0160 8.0000 0.0000 +++++ 394.442312 m 8.0000 458 | 7/9
26 h-m-p 0.0096 4.7769 0.1978 -----------Y 394.442312 0 0.0000 483 | 7/9
27 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
28 h-m-p 0.0160 8.0000 0.0002 +++++ 394.442311 m 8.0000 525 | 7/9
29 h-m-p 0.0097 4.8683 0.1979 ----------C 394.442311 0 0.0000 549 | 7/9
30 h-m-p 0.0160 8.0000 0.0002 +++++ 394.442311 m 8.0000 566 | 7/9
31 h-m-p 0.0024 0.4901 0.6021 ---------Y 394.442311 0 0.0000 589 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
33 h-m-p 0.0160 8.0000 0.0002 +++++ 394.442311 m 8.0000 631 | 7/9
34 h-m-p 0.0098 4.8994 0.1972 ------------Y 394.442311 0 0.0000 657 | 7/9
35 h-m-p 0.0160 8.0000 0.0015 +++++ 394.442309 m 8.0000 674 | 7/9
36 h-m-p 0.0567 4.4271 0.2058 --------------.. | 7/9
37 h-m-p 0.0160 8.0000 0.0002 +++++ 394.442308 m 8.0000 717 | 7/9
38 h-m-p 0.0102 5.1054 0.1918 -------------.. | 7/9
39 h-m-p 0.0160 8.0000 0.0002 +++++ 394.442308 m 8.0000 759 | 7/9
40 h-m-p 0.0103 5.1322 0.1911 ----------C 394.442308 0 0.0000 783 | 7/9
41 h-m-p 0.0160 8.0000 0.0028 +++++ 394.442303 m 8.0000 800 | 7/9
42 h-m-p 0.1114 4.7506 0.1977 -----------C 394.442303 0 0.0000 825 | 7/9
43 h-m-p 0.0160 8.0000 0.0005 -------------.. | 7/9
44 h-m-p 0.0160 8.0000 0.0003 +++++ 394.442302 m 8.0000 867 | 7/9
45 h-m-p 0.0111 5.5425 0.1811 -------------.. | 7/9
46 h-m-p 0.0160 8.0000 0.0003 +++++ 394.442302 m 8.0000 909 | 7/9
47 h-m-p 0.0113 5.5790 0.1802 ----------Y 394.442302 0 0.0000 933 | 7/9
48 h-m-p 0.0159 7.9471 0.0077 +++++ 394.442283 m 7.9471 950 | 8/9
49 h-m-p 0.2563 8.0000 0.0418 -----------Y 394.442283 0 0.0000 975 | 8/9
50 h-m-p 0.0160 8.0000 1.8088 -------------.. | 8/9
51 h-m-p 0.0160 8.0000 0.0001 +++++ 394.442283 m 8.0000 1014 | 8/9
52 h-m-p 0.0064 1.3591 0.1551 ++++ 394.442254 m 1.3591 1029 | 9/9
53 h-m-p 0.0160 8.0000 0.0000 N 394.442254 0 0.0160 1042 | 9/9
54 h-m-p 0.0160 8.0000 0.0000 N 394.442254 0 0.0160 1054
Out..
lnL = -394.442254
1055 lfun, 3165 eigenQcodon, 12660 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063326 0.088948 0.095516 0.083048 0.045325 0.046468 0.000100 1.567460 0.431136 0.282729 1.378027
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.129420
np = 11
lnL0 = -433.654915
Iterating by ming2
Initial: fx= 433.654915
x= 0.06333 0.08895 0.09552 0.08305 0.04532 0.04647 0.00011 1.56746 0.43114 0.28273 1.37803
1 h-m-p 0.0000 0.0000 213.4691 ++ 433.434869 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0011 188.5637 ++++ 408.560952 m 0.0011 32 | 2/11
3 h-m-p 0.0000 0.0000 613.6291 ++ 408.075194 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0013 93.6796 +++ 401.290329 m 0.0013 61 | 4/11
5 h-m-p 0.0000 0.0000 1219.3615 ++ 401.257411 m 0.0000 75 | 5/11
6 h-m-p 0.0001 0.0414 5.9396 ---------.. | 5/11
7 h-m-p 0.0000 0.0002 159.6027 +++ 396.120716 m 0.0002 111 | 6/11
8 h-m-p 0.0160 8.0000 3.5030 -------------.. | 6/11
9 h-m-p 0.0000 0.0001 137.1869 ++ 395.047228 m 0.0001 150 | 7/11
10 h-m-p 0.0158 7.8826 1.6728 -------------.. | 7/11
11 h-m-p 0.0000 0.0001 97.9962 ++ 394.442339 m 0.0001 189 | 8/11
12 h-m-p 0.1176 8.0000 0.0000 ++++ 394.442339 m 8.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0038 +++++ 394.442339 m 8.0000 225 | 8/11
14 h-m-p 0.0160 8.0000 4.4754 ----------C 394.442339 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 394.442339 m 8.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 0.0045 +++++ 394.442339 m 8.0000 289 | 8/11
17 h-m-p 0.1119 2.2218 0.3242 +Y 394.442338 0 0.9872 307 | 8/11
18 h-m-p 1.6000 8.0000 0.0017 Y 394.442338 0 1.0857 324 | 8/11
19 h-m-p 1.6000 8.0000 0.0001 ++ 394.442338 m 8.0000 341 | 8/11
20 h-m-p 0.5980 8.0000 0.0011 +Y 394.442338 0 4.2768 359 | 8/11
21 h-m-p 1.6000 8.0000 0.0000 ++ 394.442338 m 8.0000 376 | 8/11
22 h-m-p 0.0000 0.0044 50.2410 +++++ 394.442338 m 0.0044 396 | 9/11
23 h-m-p 0.0524 8.0000 1.3373 ++++ 394.442256 m 8.0000 412 | 9/11
24 h-m-p 1.6000 8.0000 0.3463 ++ 394.442255 m 8.0000 426 | 9/11
25 h-m-p 1.4810 8.0000 1.8709 ++ 394.442254 m 8.0000 442 | 9/11
26 h-m-p 1.6000 8.0000 0.0000 Y 394.442254 0 1.6000 456 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 Y 394.442254 0 0.0160 472
Out..
lnL = -394.442254
473 lfun, 1892 eigenQcodon, 8514 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -394.462782 S = -394.442666 -0.007715
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:05
did 20 / 46 patterns 0:05
did 30 / 46 patterns 0:05
did 40 / 46 patterns 0:05
did 46 / 46 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020016 0.019934 0.017800 0.023497 0.051637 0.026473 0.000100 0.915341 1.877937
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.142721
np = 9
lnL0 = -409.824904
Iterating by ming2
Initial: fx= 409.824904
x= 0.02002 0.01993 0.01780 0.02350 0.05164 0.02647 0.00011 0.91534 1.87794
1 h-m-p 0.0000 0.0000 232.2486 ++ 409.143862 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0674 13.6588 ----------.. | 1/9
3 h-m-p 0.0000 0.0002 232.6440 +++ 399.606621 m 0.0002 47 | 2/9
4 h-m-p 0.0034 0.0859 10.8321 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 217.3168 ++ 398.564433 m 0.0000 81 | 3/9
6 h-m-p 0.0006 0.1259 7.6438 -----------.. | 3/9
7 h-m-p 0.0000 0.0000 194.7421 ++ 398.532158 m 0.0000 114 | 4/9
8 h-m-p 0.0003 0.1388 6.9887 ----------.. | 4/9
9 h-m-p 0.0000 0.0000 168.4383 ++ 397.511172 m 0.0000 146 | 5/9
10 h-m-p 0.0008 0.1580 6.1940 -----------.. | 5/9
11 h-m-p 0.0000 0.0000 137.6891 ++ 396.928648 m 0.0000 179 | 6/9
12 h-m-p 0.0006 0.1980 5.0000 -----------.. | 6/9
13 h-m-p 0.0000 0.0003 97.0929 +++ 394.442332 m 0.0003 213 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 394.442332 m 8.0000 225 | 7/9
15 h-m-p 0.0789 8.0000 0.0002 -------C 394.442332 0 0.0000 246
Out..
lnL = -394.442332
247 lfun, 2717 eigenQcodon, 14820 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030656 0.026366 0.027320 0.066297 0.020901 0.034947 0.000100 0.900000 0.579240 1.709399 1.299982
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.358534
np = 11
lnL0 = -413.809452
Iterating by ming2
Initial: fx= 413.809452
x= 0.03066 0.02637 0.02732 0.06630 0.02090 0.03495 0.00011 0.90000 0.57924 1.70940 1.29998
1 h-m-p 0.0000 0.0000 219.4822 ++ 413.434713 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0076 42.8991 ++++ 401.608317 m 0.0076 32 | 2/11
3 h-m-p 0.0000 0.0000 45533928.1270 ++ 399.115991 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0005 34.2738 ++ 399.035578 m 0.0005 60 | 4/11
5 h-m-p 0.0000 0.0000 1414.5608 ++ 398.780032 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0002 1272.6594 ++ 397.734790 m 0.0002 88 | 6/11
7 h-m-p 0.0022 0.0108 51.1138 ++ 395.879639 m 0.0108 102 | 7/11
8 h-m-p 0.0011 0.0055 17.3778 ++ 394.442319 m 0.0055 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 --------C 394.442319 0 0.0000 138
Out..
lnL = -394.442319
139 lfun, 1668 eigenQcodon, 9174 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -394.456244 S = -394.441482 -0.006483
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:12
did 20 / 46 patterns 0:12
did 30 / 46 patterns 0:12
did 40 / 46 patterns 0:12
did 46 / 46 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=101
NC_011896_1_WP_010908865_1_2555_MLBR_RS12170 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
NC_002677_1_NP_302545_1_1417_ML2388 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI
**************************************************
NC_011896_1_WP_010908865_1_2555_MLBR_RS12170 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
NC_002677_1_NP_302545_1_1417_ML2388 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465 VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY
**************************************************
NC_011896_1_WP_010908865_1_2555_MLBR_RS12170 L
NC_002677_1_NP_302545_1_1417_ML2388 L
NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520 L
NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865 L
NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145 L
NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465 L
*
>NC_011896_1_WP_010908865_1_2555_MLBR_RS12170 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC CTG >NC_002677_1_NP_302545_1_1417_ML2388 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC CTG >NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC CTG >NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC CTG >NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC CTG >NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465 GTGGCGGCTGGAGACAACCGATTGATTGGCAACGACACCCCCGAGATCGC AGTGGGAGCCATCGGCGGGGTGGCCACCGGCTACGTACTCTGGCTTGTGG TCATGTCGATCGGATATAACATCACGACAGTCAGTCAGTGGAGCCTGATC GTGTTGATCCTGTCGATGGTGTCGGTATTCTGCTCCGGGATGTGCGGATG GTGGTTACGTCAGCGCCGTAAGCATGCCTGGGGGGCGTTCACTTTCGGTC TACCGGTATTTCCGGTGGTCCTGACATTGGCAGTGTTGGCCAAAATTTAC CTG
>NC_011896_1_WP_010908865_1_2555_MLBR_RS12170 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY L >NC_002677_1_NP_302545_1_1417_ML2388 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY L >NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY L >NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY L >NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY L >NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465 VAAGDNRLIGNDTPEIAVGAIGGVATGYVLWLVVMSIGYNITTVSQWSLI VLILSMVSVFCSGMCGWWLRQRRKHAWGAFTFGLPVFPVVLTLAVLAKIY L
#NEXUS
[ID: 5580586718]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908865_1_2555_MLBR_RS12170
NC_002677_1_NP_302545_1_1417_ML2388
NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520
NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865
NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145
NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908865_1_2555_MLBR_RS12170,
2 NC_002677_1_NP_302545_1_1417_ML2388,
3 NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520,
4 NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865,
5 NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145,
6 NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07105363,2:0.068545,3:0.06688099,4:0.0676028,5:0.06642922,6:0.06973307);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07105363,2:0.068545,3:0.06688099,4:0.0676028,5:0.06642922,6:0.06973307);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -414.44 -417.66
2 -414.43 -417.77
--------------------------------------
TOTAL -414.44 -417.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2388/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891645 0.087389 0.366327 1.489685 0.861442 1383.64 1442.32 1.000
r(A<->C){all} 0.155596 0.017293 0.000005 0.429578 0.120317 185.88 201.00 1.001
r(A<->G){all} 0.167994 0.021375 0.000174 0.456098 0.128872 154.08 176.73 1.003
r(A<->T){all} 0.167954 0.020527 0.000042 0.457870 0.130367 210.45 252.30 1.000
r(C<->G){all} 0.167804 0.020226 0.000044 0.446710 0.129266 122.73 150.28 1.000
r(C<->T){all} 0.169179 0.020782 0.000080 0.457266 0.130392 182.28 217.18 1.002
r(G<->T){all} 0.171474 0.021983 0.000078 0.470734 0.131847 203.52 266.70 1.001
pi(A){all} 0.175522 0.000461 0.136161 0.219480 0.174877 1349.80 1365.27 1.001
pi(C){all} 0.244964 0.000588 0.197077 0.291876 0.244144 1291.60 1396.30 1.000
pi(G){all} 0.328987 0.000709 0.273454 0.377725 0.328684 1332.55 1340.50 1.000
pi(T){all} 0.250527 0.000623 0.203839 0.300627 0.250206 1038.43 1186.35 1.000
alpha{1,2} 0.414210 0.228991 0.000376 1.392937 0.237317 814.86 839.22 1.000
alpha{3} 0.460864 0.246784 0.000243 1.449607 0.302296 1167.17 1334.09 1.000
pinvar{all} 0.994579 0.000047 0.981977 0.999996 0.996641 1248.62 1374.81 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2388/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 101
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 2 2 2 2 2 2 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 0 0 0 0 0 0 | Gly GGT 1 1 1 1 1 1
GTC 3 3 3 3 3 3 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 3 3 3 3 3 3
GTA 3 3 3 3 3 3 | GCA 2 2 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 4 4 4 4 4 4
GTG 8 8 8 8 8 8 | GCG 2 2 2 2 2 2 | GAG 1 1 1 1 1 1 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908865_1_2555_MLBR_RS12170
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
#2: NC_002677_1_NP_302545_1_1417_ML2388
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
#3: NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
#4: NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
#5: NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
#6: NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 12 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 12
CTC 6 | CCC 6 | CAC 0 | CGC 6
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 6
CTG 24 | CCG 12 | CAG 12 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 36 | ACC 12 | AAC 18 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 0 | Gly G GGT 6
GTC 18 | GCC 24 | GAC 12 | GGC 18
GTA 18 | GCA 12 | Glu E GAA 0 | GGA 24
GTG 48 | GCG 12 | GAG 6 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22772 C:0.16832 A:0.23762 G:0.36634
position 2: T:0.40594 C:0.21782 A:0.13861 G:0.23762
position 3: T:0.11881 C:0.34653 A:0.14851 G:0.38614
Average T:0.25083 C:0.24422 A:0.17492 G:0.33003
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -394.442368 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300025 1.299982
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908865_1_2555_MLBR_RS12170: 0.000004, NC_002677_1_NP_302545_1_1417_ML2388: 0.000004, NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520: 0.000004, NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865: 0.000004, NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145: 0.000004, NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30003
omega (dN/dS) = 1.29998
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 231.8 71.2 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 231.8 71.2 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 231.8 71.2 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 231.8 71.2 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 231.8 71.2 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 231.8 71.2 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -394.442254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908865_1_2555_MLBR_RS12170: 0.000004, NC_002677_1_NP_302545_1_1417_ML2388: 0.000004, NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520: 0.000004, NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865: 0.000004, NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145: 0.000004, NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -394.442254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908865_1_2555_MLBR_RS12170: 0.000004, NC_002677_1_NP_302545_1_1417_ML2388: 0.000004, NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520: 0.000004, NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865: 0.000004, NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145: 0.000004, NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99999 0.00000 0.00001
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 234.0 69.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908865_1_2555_MLBR_RS12170)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -394.442332 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.915268 1.877971
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908865_1_2555_MLBR_RS12170: 0.000004, NC_002677_1_NP_302545_1_1417_ML2388: 0.000004, NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520: 0.000004, NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865: 0.000004, NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145: 0.000004, NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.91527 q = 1.87797
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02005 0.06809 0.12212 0.18167 0.24726 0.32011 0.40234 0.49789 0.61545 0.78437
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.0 69.0 0.3259 0.0000 0.0000 0.0 0.0
7..2 0.000 234.0 69.0 0.3259 0.0000 0.0000 0.0 0.0
7..3 0.000 234.0 69.0 0.3259 0.0000 0.0000 0.0 0.0
7..4 0.000 234.0 69.0 0.3259 0.0000 0.0000 0.0 0.0
7..5 0.000 234.0 69.0 0.3259 0.0000 0.0000 0.0 0.0
7..6 0.000 234.0 69.0 0.3259 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -394.442319 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.524981 1.726768 1.295576
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908865_1_2555_MLBR_RS12170: 0.000004, NC_002677_1_NP_302545_1_1417_ML2388: 0.000004, NZ_LVXE01000079_1_WP_010908865_1_2679_A3216_RS13520: 0.000004, NZ_LYPH01000081_1_WP_010908865_1_2673_A8144_RS12865: 0.000004, NZ_CP029543_1_WP_010908865_1_2580_DIJ64_RS13145: 0.000004, NZ_AP014567_1_WP_010908865_1_2644_JK2ML_RS13465: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.52498 q = 1.72677
(p1 = 0.00001) w = 1.29558
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00176 0.01433 0.03835 0.07407 0.12246 0.18531 0.26577 0.36961 0.50932 0.72568 1.29558
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.0 69.0 0.2307 0.0000 0.0000 0.0 0.0
7..2 0.000 234.0 69.0 0.2307 0.0000 0.0000 0.0 0.0
7..3 0.000 234.0 69.0 0.2307 0.0000 0.0000 0.0 0.0
7..4 0.000 234.0 69.0 0.2307 0.0000 0.0000 0.0 0.0
7..5 0.000 234.0 69.0 0.2307 0.0000 0.0000 0.0 0.0
7..6 0.000 234.0 69.0 0.2307 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908865_1_2555_MLBR_RS12170)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:12
Model 1: NearlyNeutral -394.442254 Model 2: PositiveSelection -394.442254 Model 0: one-ratio -394.442368 Model 7: beta -394.442332 Model 8: beta&w>1 -394.442319 Model 0 vs 1 2.2799999999278953E-4 Model 2 vs 1 0.0 Model 8 vs 7 2.6000000048043148E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
