>C1
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C2
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C3
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C4
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C5
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C6
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=290
C1 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C2 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C3 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C4 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C5 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C6 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
**************************************************
C1 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C2 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C3 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C4 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C5 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C6 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
**************************************************
C1 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C2 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C3 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C4 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C5 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C6 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
**************************************************
C1 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C2 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C3 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C4 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C5 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C6 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
**************************************************
C1 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C2 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C3 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C4 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C5 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C6 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
**************************************************
C1 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C2 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C3 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C4 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C5 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C6 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 290 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 290 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8700]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8700]--->[8700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.504 Mb, Max= 30.850 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C2 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C3 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C4 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C5 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
C6 VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
**************************************************
C1 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C2 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C3 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C4 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C5 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
C6 AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
**************************************************
C1 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C2 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C3 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C4 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C5 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
C6 DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
**************************************************
C1 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C2 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C3 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C4 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C5 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
C6 DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
**************************************************
C1 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C2 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C3 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C4 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C5 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
C6 FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
**************************************************
C1 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C2 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C3 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C4 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C5 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
C6 AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
C2 GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
C3 GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
C4 GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
C5 GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
C6 GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
**************************************************
C1 CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
C2 CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
C3 CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
C4 CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
C5 CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
C6 CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
**************************************************
C1 TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
C2 TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
C3 TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
C4 TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
C5 TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
C6 TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
**************************************************
C1 GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
C2 GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
C3 GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
C4 GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
C5 GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
C6 GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
**************************************************
C1 CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
C2 CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
C3 CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
C4 CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
C5 CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
C6 CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
**************************************************
C1 GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
C2 GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
C3 GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
C4 GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
C5 GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
C6 GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
**************************************************
C1 GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
C2 GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
C3 GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
C4 GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
C5 GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
C6 GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
**************************************************
C1 GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
C2 GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
C3 GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
C4 GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
C5 GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
C6 GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
**************************************************
C1 ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
C2 ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
C3 ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
C4 ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
C5 ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
C6 ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
**************************************************
C1 GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
C2 GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
C3 GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
C4 GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
C5 GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
C6 GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
**************************************************
C1 GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
C2 GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
C3 GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
C4 GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
C5 GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
C6 GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
**************************************************
C1 GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
C2 GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
C3 GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
C4 GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
C5 GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
C6 GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
**************************************************
C1 TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
C2 TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
C3 TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
C4 TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
C5 TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
C6 TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
**************************************************
C1 CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
C2 CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
C3 CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
C4 CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
C5 CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
C6 CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
**************************************************
C1 ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
C2 ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
C3 ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
C4 ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
C5 ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
C6 ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
**************************************************
C1 GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
C2 GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
C3 GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
C4 GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
C5 GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
C6 GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
**************************************************
C1 ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
C2 ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
C3 ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
C4 ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
C5 ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
C6 ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
**************************************************
C1 CTGGAATCGAGGCGGCCGGG
C2 CTGGAATCGAGGCGGCCGGG
C3 CTGGAATCGAGGCGGCCGGG
C4 CTGGAATCGAGGCGGCCGGG
C5 CTGGAATCGAGGCGGCCGGG
C6 CTGGAATCGAGGCGGCCGGG
********************
>C1
GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
CTGGAATCGAGGCGGCCGGG
>C2
GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
CTGGAATCGAGGCGGCCGGG
>C3
GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
CTGGAATCGAGGCGGCCGGG
>C4
GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
CTGGAATCGAGGCGGCCGGG
>C5
GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
CTGGAATCGAGGCGGCCGGG
>C6
GTGAGCGAACTGCGCTTGATGGCGGTACACGCTCACCCTGACGACGAATC
CAGCAAGGGCGCTGCCACTCTCGCACGTTACGCCGACGAGGGCCATCGGG
TGCTGGTGGTGACGTTGACAGGCGGTGAACGTGGCGAAATTCTTAACCCG
GCAATGGACCTGCCTGATGTACATGGACATATTGCCGAAATTCGCCGCGA
CGAGATGGCGAAGGCAGCCGAGATCCTCGGCGTGGAGCACACTTGGCTGG
GCTTCATCGATTCCGGCTTACCCAAGGGTGACCCGCCGCCCCCGTTGCCC
GACGATTGCTTTGCGCTGGTGCCGCTGGAGGTGTGCACCGAGGCGTTGGT
GCGGGTGGTTCGCAAGTTTCGTCCGCACGTGCTGACCACTTACGATGAGA
ATGGCGGCTACCCGCATCCCGATCACATTCGCTGCCACCAGGTCTCGGTT
GATGCCTACGAGGCTGCCTGCGACTATCGGCGTTTTCCGGACGCCGGCAA
GCCGTGGACGGTGTCCAAGCTGTACTACAACCACGGCTTCCTGCGGGCTC
GGATGCAGTTGCTGCACGATGAATTTGCTAAGCATGGTCAAGCCGGCCCA
TTCGACAAGTGGCTCGCGCAATCGAACCCCGCGCACGACCCGTTTGAGTC
CCGGGTGACGACTCGGGTCGAGTGCTCGGCGTATTTCAGCCAGCGCGACG
ACGCTTTGCGGGCGCATGCTACCCAGATCGACCCCAAAGCCGAATTTTTC
GCAGCGCCAATATCCTGGCAGCAGCGGCTATGGCCGACCGAGGAATTCGA
ATTGGCCCGCTCGCGAGTCCCCACTCGGTTGCCGGAGCACGATTTGTTCG
CTGGAATCGAGGCGGCCGGG
>C1
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C2
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C3
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C4
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C5
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
>C6
VSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGHIAEIRRDEMAKAAEILGVEHTWLGFIDSGLPKGDPPPPLP
DDCFALVPLEVCTEALVRVVRKFRPHVLTTYDENGGYPHPDHIRCHQVSV
DAYEAACDYRRFPDAGKPWTVSKLYYNHGFLRARMQLLHDEFAKHGQAGP
FDKWLAQSNPAHDPFESRVTTRVECSAYFSQRDDALRAHATQIDPKAEFF
AAPISWQQRLWPTEEFELARSRVPTRLPEHDLFAGIEAAG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 870 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855942
Setting output file names to "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1824076166
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5102754715
Seed = 1207704054
Swapseed = 1579855942
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1947.101708 -- -24.965149
Chain 2 -- -1947.101596 -- -24.965149
Chain 3 -- -1947.101708 -- -24.965149
Chain 4 -- -1947.101596 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1947.101708 -- -24.965149
Chain 2 -- -1947.101708 -- -24.965149
Chain 3 -- -1947.101596 -- -24.965149
Chain 4 -- -1947.101596 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1947.102] (-1947.102) (-1947.102) (-1947.102) * [-1947.102] (-1947.102) (-1947.102) (-1947.102)
500 -- (-1191.999) (-1202.812) (-1203.951) [-1194.601] * (-1197.820) (-1203.068) (-1201.189) [-1199.953] -- 0:00:00
1000 -- (-1192.698) [-1202.790] (-1191.579) (-1192.242) * (-1197.957) (-1190.564) [-1186.150] (-1193.937) -- 0:00:00
1500 -- (-1190.789) (-1193.319) [-1195.354] (-1193.923) * (-1191.919) (-1190.116) [-1193.159] (-1188.384) -- 0:00:00
2000 -- [-1191.455] (-1193.799) (-1188.645) (-1192.087) * (-1191.119) [-1194.531] (-1196.700) (-1192.019) -- 0:00:00
2500 -- (-1195.183) (-1190.293) [-1189.058] (-1190.451) * [-1198.269] (-1196.052) (-1194.200) (-1201.658) -- 0:00:00
3000 -- (-1186.956) (-1193.874) (-1187.238) [-1189.050] * [-1196.430] (-1188.487) (-1189.001) (-1198.581) -- 0:00:00
3500 -- [-1194.910] (-1198.946) (-1192.439) (-1191.622) * (-1187.576) (-1193.639) [-1190.475] (-1196.016) -- 0:00:00
4000 -- (-1190.207) (-1200.017) (-1191.006) [-1186.991] * (-1188.394) [-1187.753] (-1193.714) (-1190.286) -- 0:00:00
4500 -- [-1193.036] (-1191.966) (-1186.497) (-1187.120) * (-1194.301) [-1207.755] (-1189.124) (-1197.156) -- 0:00:00
5000 -- (-1197.343) [-1190.145] (-1190.631) (-1191.762) * (-1186.156) (-1190.886) (-1194.024) [-1190.404] -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- (-1195.419) [-1194.189] (-1191.873) (-1195.737) * [-1190.568] (-1193.830) (-1185.541) (-1195.520) -- 0:00:00
6000 -- (-1191.592) (-1194.983) [-1189.150] (-1189.437) * [-1190.072] (-1188.562) (-1197.011) (-1187.887) -- 0:00:00
6500 -- (-1196.818) (-1185.723) (-1192.033) [-1195.969] * (-1192.361) (-1189.780) (-1192.886) [-1186.976] -- 0:00:00
7000 -- (-1188.242) (-1190.782) (-1192.726) [-1189.360] * (-1187.581) (-1195.161) (-1193.888) [-1190.854] -- 0:00:00
7500 -- (-1194.766) [-1189.561] (-1187.275) (-1191.549) * [-1191.863] (-1187.647) (-1188.121) (-1190.865) -- 0:00:00
8000 -- [-1185.917] (-1186.126) (-1194.770) (-1190.329) * (-1192.939) [-1187.206] (-1189.811) (-1187.927) -- 0:00:00
8500 -- (-1188.087) (-1188.595) (-1190.849) [-1185.051] * [-1195.433] (-1189.436) (-1190.874) (-1191.431) -- 0:00:00
9000 -- (-1192.981) [-1189.020] (-1194.296) (-1190.799) * (-1198.964) [-1188.161] (-1196.078) (-1191.799) -- 0:00:00
9500 -- [-1196.022] (-1200.267) (-1193.523) (-1196.128) * (-1190.522) (-1189.444) (-1194.213) [-1191.762] -- 0:00:00
10000 -- (-1199.654) [-1193.621] (-1190.347) (-1186.397) * (-1189.758) [-1192.267] (-1188.527) (-1197.930) -- 0:00:00
Average standard deviation of split frequencies: 0.088388
10500 -- (-1186.492) [-1192.708] (-1185.850) (-1192.710) * (-1201.312) (-1198.806) [-1191.954] (-1190.973) -- 0:00:00
11000 -- (-1194.393) (-1195.121) [-1187.257] (-1188.141) * (-1197.567) (-1192.378) (-1199.822) [-1189.736] -- 0:00:00
11500 -- (-1190.551) [-1186.550] (-1190.247) (-1186.602) * (-1190.384) (-1190.515) (-1196.262) [-1190.895] -- 0:00:00
12000 -- (-1190.155) [-1188.747] (-1201.143) (-1195.630) * (-1191.819) (-1199.191) [-1191.127] (-1192.227) -- 0:01:22
12500 -- (-1189.361) (-1195.352) [-1188.726] (-1189.398) * (-1198.725) [-1190.622] (-1194.343) (-1190.863) -- 0:01:19
13000 -- [-1187.265] (-1189.124) (-1190.527) (-1188.827) * [-1191.792] (-1196.785) (-1192.634) (-1196.884) -- 0:01:15
13500 -- [-1189.629] (-1193.123) (-1197.928) (-1194.975) * (-1192.654) (-1187.555) (-1190.403) [-1194.865] -- 0:01:13
14000 -- (-1188.022) [-1189.055] (-1188.259) (-1199.252) * (-1193.355) [-1190.611] (-1190.616) (-1186.609) -- 0:01:10
14500 -- (-1194.207) (-1202.724) (-1189.354) [-1192.241] * [-1190.097] (-1195.871) (-1194.573) (-1187.385) -- 0:01:07
15000 -- (-1192.092) (-1194.638) (-1193.284) [-1189.913] * (-1191.784) (-1190.053) (-1190.790) [-1190.674] -- 0:01:05
Average standard deviation of split frequencies: 0.081841
15500 -- (-1188.847) [-1188.828] (-1190.499) (-1198.357) * (-1190.234) (-1184.866) [-1195.142] (-1200.791) -- 0:01:03
16000 -- (-1192.049) (-1188.882) (-1202.928) [-1187.961] * (-1195.554) [-1187.332] (-1181.328) (-1192.628) -- 0:01:01
16500 -- (-1191.831) (-1191.048) (-1192.297) [-1189.705] * [-1191.760] (-1188.787) (-1181.534) (-1199.727) -- 0:00:59
17000 -- (-1190.374) (-1190.486) (-1197.218) [-1190.138] * [-1191.826] (-1191.484) (-1182.365) (-1191.949) -- 0:00:57
17500 -- (-1199.651) (-1197.343) [-1195.739] (-1188.574) * (-1199.041) (-1194.476) [-1181.304] (-1189.690) -- 0:00:56
18000 -- (-1198.099) [-1201.342] (-1191.594) (-1195.051) * (-1192.576) (-1184.534) (-1181.488) [-1194.051] -- 0:00:54
18500 -- (-1190.588) (-1207.781) (-1186.606) [-1191.467] * (-1188.239) (-1183.385) (-1183.914) [-1191.876] -- 0:00:53
19000 -- (-1196.814) (-1194.328) (-1196.403) [-1190.136] * (-1190.774) (-1183.406) [-1185.622] (-1193.250) -- 0:00:51
19500 -- (-1189.715) (-1203.295) (-1193.345) [-1187.184] * (-1199.898) [-1181.652] (-1183.263) (-1195.533) -- 0:00:50
20000 -- (-1192.301) (-1188.629) [-1190.300] (-1192.331) * (-1192.359) [-1183.070] (-1182.957) (-1194.367) -- 0:00:49
Average standard deviation of split frequencies: 0.073499
20500 -- (-1189.475) (-1196.342) (-1187.478) [-1191.396] * [-1195.837] (-1182.317) (-1182.764) (-1191.115) -- 0:00:47
21000 -- (-1186.866) [-1187.552] (-1190.448) (-1192.154) * (-1184.584) [-1183.570] (-1184.053) (-1187.939) -- 0:00:46
21500 -- (-1196.732) [-1188.987] (-1196.118) (-1191.208) * (-1196.245) [-1183.435] (-1184.261) (-1193.944) -- 0:00:45
22000 -- (-1197.050) [-1188.191] (-1182.253) (-1189.877) * (-1195.185) [-1185.610] (-1182.610) (-1194.507) -- 0:00:44
22500 -- (-1193.339) (-1196.360) (-1184.482) [-1192.070] * (-1195.703) (-1189.777) (-1183.582) [-1192.418] -- 0:00:43
23000 -- (-1186.964) (-1192.020) [-1183.522] (-1193.603) * [-1194.192] (-1182.397) (-1181.608) (-1194.589) -- 0:00:42
23500 -- [-1189.087] (-1196.301) (-1184.197) (-1190.517) * [-1191.259] (-1181.662) (-1186.241) (-1195.136) -- 0:00:41
24000 -- (-1194.330) (-1190.916) [-1180.462] (-1202.432) * (-1191.679) (-1183.076) [-1180.958] (-1193.228) -- 0:00:40
24500 -- (-1197.172) (-1187.685) [-1181.595] (-1185.006) * [-1190.272] (-1188.435) (-1181.283) (-1195.947) -- 0:00:39
25000 -- (-1190.826) [-1187.620] (-1181.340) (-1180.809) * (-1185.084) (-1183.383) (-1184.981) [-1189.046] -- 0:00:39
Average standard deviation of split frequencies: 0.060699
25500 -- (-1191.296) [-1190.936] (-1186.350) (-1180.804) * (-1199.349) (-1180.947) [-1181.332] (-1193.015) -- 0:00:38
26000 -- (-1191.059) (-1185.577) (-1182.080) [-1182.410] * (-1196.706) [-1181.396] (-1181.521) (-1217.666) -- 0:00:37
26500 -- (-1201.693) (-1195.688) (-1185.649) [-1181.865] * [-1187.403] (-1182.730) (-1181.503) (-1188.926) -- 0:00:36
27000 -- (-1186.853) (-1195.899) [-1184.671] (-1181.055) * (-1186.711) (-1181.372) (-1185.575) [-1185.065] -- 0:00:36
27500 -- (-1186.724) (-1194.557) (-1181.149) [-1183.822] * (-1187.106) [-1180.760] (-1181.823) (-1182.006) -- 0:00:35
28000 -- (-1197.660) [-1194.415] (-1182.790) (-1181.632) * (-1191.828) (-1180.754) (-1187.562) [-1181.328] -- 0:01:09
28500 -- (-1191.295) (-1192.549) (-1181.293) [-1182.130] * (-1200.815) [-1180.816] (-1183.226) (-1182.438) -- 0:01:08
29000 -- (-1186.271) (-1195.584) [-1181.291] (-1182.791) * [-1187.490] (-1181.185) (-1186.005) (-1183.938) -- 0:01:06
29500 -- (-1194.258) (-1194.441) (-1181.566) [-1182.552] * (-1185.304) [-1181.766] (-1181.456) (-1182.942) -- 0:01:05
30000 -- (-1192.724) (-1192.993) [-1182.324] (-1182.099) * (-1185.309) [-1180.939] (-1183.551) (-1181.643) -- 0:01:04
Average standard deviation of split frequencies: 0.050508
30500 -- [-1192.403] (-1192.724) (-1181.034) (-1182.755) * [-1189.536] (-1181.673) (-1181.746) (-1181.932) -- 0:01:03
31000 -- [-1189.792] (-1194.653) (-1183.047) (-1182.870) * (-1200.491) [-1182.723] (-1182.590) (-1184.486) -- 0:01:02
31500 -- (-1198.884) [-1184.605] (-1182.684) (-1185.069) * (-1193.040) (-1182.997) (-1181.691) [-1184.316] -- 0:01:01
32000 -- [-1184.920] (-1195.623) (-1184.127) (-1181.177) * (-1205.548) (-1184.356) (-1182.797) [-1185.829] -- 0:01:00
32500 -- (-1188.920) [-1202.661] (-1182.490) (-1181.374) * [-1191.918] (-1182.949) (-1182.311) (-1185.243) -- 0:00:59
33000 -- (-1194.552) (-1197.598) (-1182.341) [-1182.052] * (-1181.198) (-1182.642) (-1182.940) [-1184.287] -- 0:00:58
33500 -- (-1191.647) (-1200.103) [-1185.520] (-1182.316) * (-1183.099) (-1182.836) (-1181.204) [-1182.175] -- 0:00:57
34000 -- [-1194.185] (-1186.382) (-1183.726) (-1182.154) * (-1180.758) (-1184.030) [-1182.302] (-1180.850) -- 0:00:56
34500 -- (-1186.328) [-1190.684] (-1182.497) (-1180.702) * (-1182.621) (-1181.439) (-1180.551) [-1181.941] -- 0:00:55
35000 -- (-1202.958) [-1189.949] (-1188.700) (-1182.415) * (-1185.837) (-1182.443) (-1183.805) [-1182.224] -- 0:00:55
Average standard deviation of split frequencies: 0.044376
35500 -- (-1194.101) [-1191.076] (-1181.960) (-1181.049) * (-1186.033) [-1182.474] (-1182.763) (-1183.709) -- 0:00:54
36000 -- (-1198.359) [-1187.970] (-1185.704) (-1181.898) * [-1184.931] (-1181.885) (-1180.919) (-1182.912) -- 0:00:53
36500 -- (-1190.304) (-1186.871) [-1181.388] (-1181.983) * (-1184.502) (-1182.307) [-1180.597] (-1183.706) -- 0:00:52
37000 -- (-1182.035) [-1192.525] (-1184.006) (-1180.840) * [-1184.245] (-1181.487) (-1181.183) (-1181.742) -- 0:00:52
37500 -- [-1181.785] (-1192.005) (-1183.437) (-1187.611) * [-1183.506] (-1182.628) (-1181.295) (-1182.038) -- 0:00:51
38000 -- (-1182.326) (-1194.629) [-1181.533] (-1183.207) * (-1184.343) [-1181.614] (-1181.015) (-1183.026) -- 0:00:50
38500 -- (-1183.349) [-1189.429] (-1180.523) (-1182.408) * (-1188.280) (-1183.769) (-1182.092) [-1180.385] -- 0:00:49
39000 -- (-1185.070) [-1189.261] (-1182.391) (-1187.569) * (-1186.241) [-1181.557] (-1181.164) (-1180.449) -- 0:00:49
39500 -- [-1182.072] (-1190.125) (-1181.899) (-1183.440) * [-1182.394] (-1182.882) (-1180.656) (-1182.233) -- 0:00:48
40000 -- (-1185.561) (-1202.923) [-1180.680] (-1183.463) * (-1184.472) (-1183.104) [-1182.170] (-1183.120) -- 0:00:48
Average standard deviation of split frequencies: 0.032200
40500 -- (-1183.119) [-1191.848] (-1182.229) (-1185.832) * (-1182.842) (-1184.241) (-1182.052) [-1183.195] -- 0:00:47
41000 -- (-1184.373) (-1189.371) [-1181.980] (-1185.592) * (-1184.315) [-1183.187] (-1182.123) (-1183.194) -- 0:00:46
41500 -- (-1184.055) (-1189.939) [-1182.401] (-1185.608) * (-1183.549) (-1183.236) [-1181.994] (-1182.447) -- 0:00:46
42000 -- (-1182.741) [-1192.989] (-1182.948) (-1183.163) * [-1183.216] (-1185.701) (-1181.984) (-1181.539) -- 0:00:45
42500 -- (-1182.807) (-1188.559) [-1181.199] (-1182.792) * (-1181.007) (-1184.822) (-1186.340) [-1182.063] -- 0:00:45
43000 -- [-1185.438] (-1190.170) (-1182.086) (-1182.729) * [-1180.399] (-1185.110) (-1181.051) (-1182.526) -- 0:00:44
43500 -- [-1181.408] (-1190.156) (-1183.802) (-1186.724) * (-1183.294) (-1183.034) [-1183.253] (-1182.378) -- 0:00:43
44000 -- (-1182.030) (-1184.520) [-1181.178] (-1184.961) * (-1183.084) (-1182.455) [-1183.081] (-1181.652) -- 0:01:05
44500 -- (-1181.649) [-1187.969] (-1183.414) (-1185.545) * (-1186.587) (-1183.681) (-1186.334) [-1180.994] -- 0:01:04
45000 -- [-1182.679] (-1192.498) (-1181.088) (-1185.370) * (-1183.676) (-1181.278) (-1182.767) [-1181.374] -- 0:01:03
Average standard deviation of split frequencies: 0.037917
45500 -- (-1184.067) [-1195.536] (-1183.524) (-1182.614) * (-1183.668) (-1183.152) (-1182.560) [-1181.031] -- 0:01:02
46000 -- [-1182.026] (-1191.947) (-1185.450) (-1182.989) * [-1182.516] (-1181.831) (-1181.692) (-1184.320) -- 0:01:02
46500 -- (-1180.870) (-1188.506) (-1183.503) [-1184.132] * [-1183.262] (-1183.646) (-1182.799) (-1181.077) -- 0:01:01
47000 -- (-1181.348) (-1188.882) [-1181.847] (-1183.405) * (-1182.847) (-1181.983) [-1181.220] (-1182.805) -- 0:01:00
47500 -- [-1181.238] (-1190.301) (-1185.650) (-1183.043) * (-1183.836) (-1184.053) [-1182.085] (-1183.834) -- 0:01:00
48000 -- (-1184.986) (-1192.844) (-1181.192) [-1184.528] * (-1181.790) [-1181.625] (-1181.101) (-1183.911) -- 0:00:59
48500 -- [-1181.144] (-1209.366) (-1182.563) (-1182.698) * (-1183.259) [-1182.497] (-1181.358) (-1186.016) -- 0:00:58
49000 -- (-1181.601) (-1191.899) (-1183.700) [-1180.889] * (-1181.231) [-1180.515] (-1184.026) (-1180.291) -- 0:00:58
49500 -- (-1181.254) [-1192.544] (-1180.776) (-1180.919) * (-1182.458) [-1183.358] (-1185.453) (-1180.419) -- 0:00:57
50000 -- (-1184.103) [-1193.614] (-1181.076) (-1180.685) * (-1183.756) [-1187.308] (-1184.326) (-1183.247) -- 0:00:57
Average standard deviation of split frequencies: 0.036286
50500 -- (-1181.872) (-1191.247) [-1181.643] (-1181.226) * (-1187.412) (-1185.288) (-1184.753) [-1183.749] -- 0:00:56
51000 -- (-1185.074) (-1192.472) (-1182.018) [-1180.837] * (-1182.038) [-1181.330] (-1183.982) (-1184.337) -- 0:00:55
51500 -- (-1183.710) (-1198.609) [-1183.489] (-1181.470) * (-1181.680) [-1181.353] (-1182.717) (-1182.983) -- 0:00:55
52000 -- [-1184.925] (-1184.540) (-1184.479) (-1181.945) * [-1180.866] (-1182.928) (-1180.581) (-1182.150) -- 0:00:54
52500 -- [-1182.656] (-1194.094) (-1181.891) (-1181.301) * [-1181.440] (-1180.980) (-1180.643) (-1182.954) -- 0:00:54
53000 -- (-1182.438) [-1191.811] (-1180.618) (-1186.535) * [-1182.010] (-1181.754) (-1183.650) (-1181.799) -- 0:00:53
53500 -- [-1180.747] (-1187.451) (-1182.773) (-1182.715) * (-1184.579) [-1181.970] (-1188.518) (-1182.924) -- 0:00:53
54000 -- (-1182.507) (-1203.102) [-1184.819] (-1180.675) * (-1182.943) (-1181.687) (-1184.669) [-1184.021] -- 0:00:52
54500 -- (-1181.721) (-1193.001) (-1183.903) [-1181.028] * (-1182.286) [-1181.044] (-1185.409) (-1182.165) -- 0:00:52
55000 -- (-1183.558) [-1189.341] (-1191.481) (-1185.033) * [-1183.324] (-1182.615) (-1186.455) (-1183.912) -- 0:00:51
Average standard deviation of split frequencies: 0.031333
55500 -- [-1182.303] (-1189.236) (-1186.070) (-1182.112) * [-1181.248] (-1181.995) (-1189.979) (-1182.238) -- 0:00:51
56000 -- [-1182.892] (-1192.094) (-1181.442) (-1183.499) * (-1183.413) [-1181.964] (-1182.575) (-1181.634) -- 0:00:50
56500 -- (-1182.320) (-1189.205) (-1181.273) [-1185.702] * (-1182.913) (-1181.886) [-1182.155] (-1184.598) -- 0:00:50
57000 -- (-1182.696) (-1190.102) (-1183.684) [-1181.382] * (-1183.423) [-1182.209] (-1181.455) (-1184.598) -- 0:00:49
57500 -- (-1183.917) (-1192.255) (-1184.337) [-1181.875] * (-1184.871) [-1181.975] (-1181.599) (-1182.627) -- 0:00:49
58000 -- (-1184.486) (-1204.292) (-1181.287) [-1180.670] * (-1181.743) [-1181.359] (-1182.720) (-1184.745) -- 0:00:48
58500 -- (-1181.520) (-1188.525) [-1181.460] (-1181.689) * [-1181.185] (-1180.689) (-1186.610) (-1190.209) -- 0:00:48
59000 -- [-1181.476] (-1193.447) (-1183.927) (-1181.860) * [-1180.780] (-1181.883) (-1183.876) (-1185.105) -- 0:00:47
59500 -- [-1182.127] (-1196.127) (-1182.651) (-1184.505) * (-1181.105) (-1180.551) (-1182.565) [-1184.967] -- 0:00:47
60000 -- (-1181.887) [-1189.819] (-1183.016) (-1182.276) * (-1181.105) [-1181.321] (-1182.206) (-1181.286) -- 0:01:02
Average standard deviation of split frequencies: 0.027401
60500 -- [-1182.265] (-1192.633) (-1184.305) (-1181.484) * (-1187.111) (-1182.924) [-1181.016] (-1182.432) -- 0:01:02
61000 -- (-1182.095) (-1194.298) [-1184.995] (-1183.380) * (-1184.462) [-1181.836] (-1183.529) (-1180.840) -- 0:01:01
61500 -- (-1181.517) [-1188.195] (-1183.036) (-1183.454) * (-1184.882) (-1181.790) [-1184.030] (-1180.415) -- 0:01:01
62000 -- (-1181.740) (-1193.363) [-1182.360] (-1183.128) * [-1183.534] (-1185.159) (-1188.894) (-1180.781) -- 0:01:00
62500 -- (-1181.082) (-1186.280) [-1180.334] (-1182.338) * (-1183.600) [-1184.289] (-1184.392) (-1181.800) -- 0:01:00
63000 -- (-1182.448) (-1190.251) [-1186.356] (-1182.736) * (-1184.601) [-1183.487] (-1182.383) (-1181.409) -- 0:00:59
63500 -- (-1182.699) [-1193.923] (-1185.526) (-1185.325) * (-1184.525) [-1183.762] (-1182.428) (-1183.144) -- 0:00:58
64000 -- [-1181.445] (-1187.158) (-1182.985) (-1182.053) * (-1185.695) [-1183.104] (-1185.443) (-1181.253) -- 0:00:58
64500 -- (-1182.169) (-1192.257) (-1183.734) [-1181.860] * [-1184.359] (-1181.536) (-1183.835) (-1182.218) -- 0:00:58
65000 -- [-1182.818] (-1197.435) (-1185.889) (-1181.898) * (-1184.041) [-1182.158] (-1185.611) (-1185.028) -- 0:00:57
Average standard deviation of split frequencies: 0.027818
65500 -- (-1184.673) (-1188.138) (-1185.973) [-1184.824] * (-1185.448) [-1182.333] (-1183.330) (-1183.929) -- 0:00:57
66000 -- (-1181.511) [-1190.816] (-1183.500) (-1184.248) * (-1182.682) (-1183.372) [-1183.667] (-1184.265) -- 0:00:56
66500 -- (-1181.900) (-1190.019) [-1182.421] (-1185.101) * [-1185.957] (-1182.300) (-1183.319) (-1184.959) -- 0:00:56
67000 -- [-1184.648] (-1190.324) (-1182.336) (-1183.198) * (-1183.309) [-1183.549] (-1180.566) (-1183.008) -- 0:00:55
67500 -- (-1183.384) (-1192.158) (-1181.374) [-1182.274] * (-1187.347) (-1180.988) [-1180.542] (-1187.226) -- 0:00:55
68000 -- (-1185.282) [-1190.045] (-1181.493) (-1184.103) * (-1186.562) (-1182.576) (-1181.960) [-1185.444] -- 0:00:54
68500 -- (-1185.045) (-1200.679) [-1180.989] (-1183.566) * (-1190.491) (-1181.451) [-1181.428] (-1182.391) -- 0:00:54
69000 -- (-1185.663) (-1196.183) (-1181.104) [-1181.997] * [-1181.261] (-1182.297) (-1183.481) (-1181.477) -- 0:00:53
69500 -- (-1185.198) (-1183.131) [-1180.503] (-1187.324) * (-1182.526) (-1189.417) (-1182.809) [-1180.548] -- 0:00:53
70000 -- (-1183.329) [-1180.857] (-1181.825) (-1185.613) * (-1182.661) [-1183.823] (-1184.933) (-1181.225) -- 0:00:53
Average standard deviation of split frequencies: 0.021283
70500 -- (-1182.134) (-1181.611) [-1181.916] (-1183.184) * (-1183.077) (-1186.230) (-1184.936) [-1180.577] -- 0:00:52
71000 -- [-1183.901] (-1181.394) (-1182.377) (-1181.883) * (-1181.414) (-1185.299) (-1183.661) [-1181.905] -- 0:00:52
71500 -- (-1185.454) (-1188.856) (-1181.308) [-1184.609] * (-1184.301) (-1184.047) (-1184.263) [-1184.617] -- 0:00:51
72000 -- (-1183.615) [-1181.613] (-1180.913) (-1184.876) * [-1182.387] (-1181.768) (-1183.776) (-1187.717) -- 0:00:51
72500 -- (-1184.461) [-1182.568] (-1180.913) (-1183.467) * (-1182.223) (-1182.297) [-1183.050] (-1182.015) -- 0:00:51
73000 -- [-1182.555] (-1184.072) (-1182.375) (-1186.628) * (-1181.523) (-1180.770) (-1184.347) [-1183.727] -- 0:00:50
73500 -- (-1181.535) [-1184.641] (-1182.221) (-1181.251) * (-1181.751) (-1181.683) [-1183.548] (-1181.348) -- 0:00:50
74000 -- (-1185.659) [-1182.058] (-1181.803) (-1182.014) * [-1181.679] (-1181.809) (-1182.038) (-1183.064) -- 0:00:50
74500 -- (-1183.577) (-1181.985) [-1181.941] (-1191.500) * (-1183.132) (-1181.678) (-1182.619) [-1181.787] -- 0:00:49
75000 -- [-1181.847] (-1183.175) (-1182.247) (-1187.838) * (-1183.949) (-1181.836) (-1182.202) [-1181.401] -- 0:00:49
Average standard deviation of split frequencies: 0.023965
75500 -- (-1180.933) (-1183.792) (-1185.144) [-1183.552] * (-1184.739) (-1182.836) (-1182.322) [-1182.212] -- 0:00:48
76000 -- (-1180.784) [-1184.046] (-1182.499) (-1185.330) * (-1183.031) (-1181.198) (-1182.285) [-1183.331] -- 0:01:00
76500 -- (-1181.295) [-1182.290] (-1180.457) (-1184.064) * (-1184.866) [-1183.097] (-1182.244) (-1186.564) -- 0:01:00
77000 -- [-1183.092] (-1181.385) (-1180.916) (-1183.802) * (-1184.581) (-1182.801) [-1182.397] (-1184.058) -- 0:00:59
77500 -- (-1181.870) (-1180.760) [-1180.941] (-1184.001) * [-1183.484] (-1182.586) (-1181.560) (-1185.466) -- 0:00:59
78000 -- (-1183.089) (-1182.702) [-1181.230] (-1183.014) * (-1184.571) (-1182.586) [-1182.911] (-1182.851) -- 0:00:59
78500 -- (-1183.341) (-1187.891) (-1182.905) [-1182.790] * (-1182.823) (-1182.233) [-1182.408] (-1183.261) -- 0:00:58
79000 -- (-1183.956) (-1187.477) [-1183.155] (-1184.737) * (-1183.044) (-1183.279) [-1182.990] (-1183.012) -- 0:00:58
79500 -- (-1182.463) (-1184.049) [-1180.859] (-1184.732) * (-1181.533) (-1181.227) (-1187.747) [-1182.881] -- 0:00:57
80000 -- (-1183.573) [-1183.231] (-1182.224) (-1184.501) * (-1183.637) (-1181.227) (-1183.035) [-1182.490] -- 0:00:57
Average standard deviation of split frequencies: 0.020871
80500 -- [-1181.725] (-1185.020) (-1182.895) (-1186.406) * [-1184.068] (-1181.241) (-1184.442) (-1182.854) -- 0:00:57
81000 -- (-1185.705) (-1182.701) [-1181.697] (-1186.948) * (-1186.432) (-1181.392) (-1184.697) [-1183.512] -- 0:00:56
81500 -- (-1186.109) [-1181.730] (-1182.796) (-1182.787) * (-1186.264) [-1181.392] (-1184.479) (-1184.332) -- 0:00:56
82000 -- (-1181.469) (-1184.370) (-1182.585) [-1182.899] * (-1184.447) (-1184.383) [-1182.750] (-1182.155) -- 0:00:55
82500 -- [-1182.348] (-1182.272) (-1184.530) (-1181.425) * (-1181.961) (-1184.947) [-1181.424] (-1181.973) -- 0:00:55
83000 -- [-1182.660] (-1183.751) (-1181.623) (-1182.570) * (-1182.831) (-1184.378) (-1183.116) [-1182.056] -- 0:00:55
83500 -- (-1181.592) (-1185.180) (-1183.861) [-1182.745] * (-1181.975) (-1187.335) [-1183.601] (-1190.486) -- 0:00:54
84000 -- (-1184.926) (-1183.078) (-1181.390) [-1180.871] * (-1182.861) (-1181.930) [-1182.335] (-1187.671) -- 0:00:54
84500 -- (-1184.248) [-1182.462] (-1182.433) (-1180.721) * (-1181.727) [-1183.454] (-1182.000) (-1182.393) -- 0:00:54
85000 -- (-1181.610) [-1180.902] (-1187.577) (-1180.665) * (-1181.359) [-1183.606] (-1180.566) (-1183.554) -- 0:00:53
Average standard deviation of split frequencies: 0.022175
85500 -- (-1181.582) (-1181.393) (-1183.087) [-1181.583] * (-1181.242) (-1182.277) (-1180.916) [-1181.018] -- 0:00:53
86000 -- (-1181.849) (-1184.838) (-1182.096) [-1181.408] * (-1183.675) [-1180.995] (-1181.674) (-1185.441) -- 0:00:53
86500 -- [-1181.679] (-1188.810) (-1181.709) (-1181.507) * [-1181.808] (-1181.906) (-1182.411) (-1184.265) -- 0:00:52
87000 -- (-1181.463) [-1183.468] (-1182.630) (-1182.484) * (-1181.403) (-1181.893) (-1182.716) [-1185.376] -- 0:00:52
87500 -- (-1183.596) (-1187.135) [-1183.206] (-1183.484) * (-1181.411) [-1181.271] (-1183.014) (-1185.667) -- 0:00:52
88000 -- [-1182.573] (-1190.697) (-1182.897) (-1185.076) * [-1183.723] (-1182.431) (-1184.239) (-1182.400) -- 0:00:51
88500 -- [-1183.621] (-1183.983) (-1184.001) (-1182.040) * (-1183.196) [-1181.009] (-1183.298) (-1183.061) -- 0:00:51
89000 -- (-1184.459) (-1182.138) (-1181.125) [-1181.240] * [-1182.797] (-1182.650) (-1182.186) (-1185.827) -- 0:00:51
89500 -- (-1181.331) [-1182.833] (-1180.711) (-1181.437) * (-1186.949) (-1181.784) [-1183.704] (-1182.817) -- 0:00:50
90000 -- (-1182.341) [-1182.436] (-1181.638) (-1181.698) * (-1187.254) [-1182.775] (-1183.157) (-1181.852) -- 0:00:50
Average standard deviation of split frequencies: 0.018718
90500 -- (-1185.044) (-1182.212) [-1180.983] (-1181.051) * [-1181.806] (-1181.844) (-1183.318) (-1186.317) -- 0:00:50
91000 -- (-1187.689) (-1181.817) (-1181.088) [-1184.341] * (-1181.388) (-1181.994) (-1182.274) [-1181.420] -- 0:00:49
91500 -- [-1183.976] (-1183.635) (-1181.380) (-1184.220) * (-1184.512) (-1184.639) (-1186.010) [-1180.944] -- 0:00:49
92000 -- (-1185.696) (-1183.991) [-1182.346] (-1181.061) * (-1182.747) (-1184.489) [-1183.319] (-1186.174) -- 0:00:59
92500 -- (-1182.534) (-1183.868) [-1181.920] (-1180.527) * [-1181.266] (-1185.664) (-1182.439) (-1182.634) -- 0:00:58
93000 -- [-1182.212] (-1184.468) (-1186.412) (-1182.585) * (-1181.663) (-1184.117) [-1180.472] (-1182.343) -- 0:00:58
93500 -- [-1181.880] (-1182.395) (-1181.263) (-1183.419) * (-1183.640) [-1181.582] (-1181.849) (-1182.764) -- 0:00:58
94000 -- (-1182.393) [-1182.070] (-1181.263) (-1181.722) * [-1182.362] (-1181.111) (-1181.433) (-1180.822) -- 0:00:57
94500 -- (-1184.511) (-1188.661) (-1183.571) [-1181.140] * (-1182.629) (-1181.473) [-1182.054] (-1181.973) -- 0:00:57
95000 -- [-1183.014] (-1187.588) (-1181.720) (-1181.541) * (-1183.866) (-1181.713) [-1182.476] (-1181.851) -- 0:00:57
Average standard deviation of split frequencies: 0.018660
95500 -- (-1183.815) (-1187.258) [-1180.553] (-1180.619) * (-1187.221) (-1180.800) (-1183.432) [-1182.006] -- 0:00:56
96000 -- (-1183.182) (-1182.101) [-1180.466] (-1180.632) * (-1186.738) (-1180.587) [-1182.988] (-1183.285) -- 0:00:56
96500 -- (-1183.785) [-1187.295] (-1181.015) (-1180.527) * [-1181.019] (-1184.764) (-1180.747) (-1183.303) -- 0:00:56
97000 -- (-1188.345) (-1184.170) [-1180.854] (-1183.965) * [-1182.190] (-1185.227) (-1187.600) (-1181.481) -- 0:00:55
97500 -- [-1185.466] (-1182.461) (-1182.305) (-1186.937) * (-1181.500) (-1181.872) [-1183.209] (-1183.805) -- 0:00:55
98000 -- [-1182.814] (-1182.646) (-1182.523) (-1185.961) * (-1181.889) (-1181.847) (-1181.403) [-1184.659] -- 0:00:55
98500 -- (-1184.264) (-1181.361) (-1182.791) [-1182.844] * (-1183.871) (-1182.973) (-1180.706) [-1183.047] -- 0:00:54
99000 -- [-1184.325] (-1183.730) (-1183.694) (-1183.977) * (-1184.517) (-1183.100) (-1181.489) [-1182.458] -- 0:00:54
99500 -- [-1180.425] (-1183.395) (-1185.207) (-1182.047) * (-1184.660) (-1182.029) [-1181.448] (-1182.361) -- 0:00:54
100000 -- [-1182.274] (-1182.550) (-1184.061) (-1183.172) * [-1184.262] (-1180.755) (-1183.849) (-1183.890) -- 0:00:54
Average standard deviation of split frequencies: 0.020604
100500 -- (-1182.954) (-1181.651) [-1180.746] (-1184.002) * (-1181.693) [-1181.198] (-1180.789) (-1182.690) -- 0:00:53
101000 -- (-1184.918) (-1182.209) [-1181.292] (-1182.596) * [-1180.312] (-1181.294) (-1180.988) (-1184.407) -- 0:00:53
101500 -- (-1182.299) (-1181.122) [-1181.542] (-1182.483) * (-1180.385) [-1182.077] (-1182.120) (-1183.057) -- 0:00:53
102000 -- [-1181.786] (-1181.459) (-1181.024) (-1182.540) * (-1181.564) [-1182.489] (-1182.809) (-1183.045) -- 0:00:52
102500 -- (-1182.702) (-1182.980) (-1180.742) [-1181.564] * [-1182.371] (-1181.813) (-1186.771) (-1184.432) -- 0:00:52
103000 -- (-1183.492) (-1180.628) (-1185.580) [-1181.709] * (-1181.890) [-1182.914] (-1181.981) (-1183.289) -- 0:00:52
103500 -- [-1181.249] (-1180.715) (-1187.803) (-1182.437) * [-1182.560] (-1191.813) (-1180.842) (-1185.458) -- 0:00:51
104000 -- (-1181.378) [-1180.499] (-1183.425) (-1183.283) * (-1184.193) [-1184.984] (-1181.159) (-1184.602) -- 0:00:51
104500 -- (-1180.939) (-1181.145) [-1183.427] (-1181.312) * [-1181.807] (-1182.016) (-1181.586) (-1183.047) -- 0:00:51
105000 -- (-1180.972) (-1180.921) [-1182.070] (-1180.610) * (-1182.259) (-1180.282) [-1181.609] (-1183.827) -- 0:00:51
Average standard deviation of split frequencies: 0.020902
105500 -- (-1181.236) [-1183.952] (-1181.020) (-1183.030) * (-1182.089) [-1182.401] (-1180.742) (-1183.250) -- 0:00:50
106000 -- (-1184.447) (-1181.435) [-1180.769] (-1184.009) * (-1184.569) (-1182.770) (-1186.155) [-1181.088] -- 0:00:50
106500 -- (-1185.087) [-1182.232] (-1183.137) (-1185.838) * (-1184.497) [-1184.789] (-1180.748) (-1186.675) -- 0:00:50
107000 -- [-1189.383] (-1181.801) (-1184.977) (-1182.563) * [-1183.494] (-1185.977) (-1183.499) (-1181.475) -- 0:00:50
107500 -- (-1189.227) [-1184.230] (-1182.120) (-1182.925) * (-1181.602) (-1184.308) (-1183.431) [-1181.919] -- 0:00:49
108000 -- (-1189.145) (-1185.769) (-1183.106) [-1183.797] * [-1181.424] (-1185.506) (-1185.756) (-1181.405) -- 0:00:57
108500 -- (-1186.365) (-1183.951) (-1182.279) [-1180.780] * (-1184.711) (-1182.508) [-1182.439] (-1181.820) -- 0:00:57
109000 -- (-1184.354) (-1180.920) (-1182.688) [-1180.795] * (-1184.440) [-1182.872] (-1180.504) (-1184.338) -- 0:00:57
109500 -- (-1180.988) [-1183.236] (-1185.092) (-1182.617) * (-1181.607) [-1182.833] (-1181.372) (-1183.320) -- 0:00:56
110000 -- (-1180.500) (-1184.823) [-1182.743] (-1182.399) * [-1181.973] (-1181.957) (-1180.769) (-1184.225) -- 0:00:56
Average standard deviation of split frequencies: 0.020402
110500 -- (-1181.593) (-1185.341) (-1183.103) [-1181.730] * (-1182.891) (-1182.189) [-1182.043] (-1182.762) -- 0:00:56
111000 -- (-1181.415) (-1185.143) (-1180.364) [-1181.076] * (-1182.493) [-1182.169] (-1183.469) (-1181.391) -- 0:00:56
111500 -- (-1181.875) [-1186.094] (-1181.226) (-1182.081) * (-1182.110) (-1180.663) (-1186.563) [-1181.555] -- 0:00:55
112000 -- (-1182.744) [-1184.559] (-1180.740) (-1180.356) * (-1184.207) [-1180.551] (-1189.402) (-1183.025) -- 0:00:55
112500 -- (-1183.743) (-1181.206) (-1187.746) [-1180.584] * [-1182.369] (-1180.644) (-1186.636) (-1182.970) -- 0:00:55
113000 -- (-1182.286) [-1181.314] (-1182.290) (-1182.302) * (-1182.654) (-1181.856) (-1185.248) [-1184.337] -- 0:00:54
113500 -- [-1181.625] (-1183.039) (-1181.190) (-1180.773) * (-1181.563) [-1182.167] (-1180.584) (-1184.232) -- 0:00:54
114000 -- (-1183.736) (-1182.970) [-1182.539] (-1180.759) * [-1183.112] (-1183.064) (-1180.612) (-1182.149) -- 0:00:54
114500 -- [-1182.187] (-1185.541) (-1185.248) (-1182.350) * [-1182.074] (-1181.773) (-1183.345) (-1184.175) -- 0:00:54
115000 -- (-1184.176) [-1181.806] (-1184.554) (-1181.621) * [-1181.559] (-1186.487) (-1180.677) (-1182.040) -- 0:00:53
Average standard deviation of split frequencies: 0.020105
115500 -- (-1182.964) [-1181.405] (-1181.277) (-1182.082) * (-1181.754) [-1182.745] (-1183.045) (-1181.523) -- 0:00:53
116000 -- (-1183.261) [-1182.360] (-1184.224) (-1181.473) * (-1185.444) (-1184.942) (-1182.658) [-1182.663] -- 0:00:53
116500 -- (-1186.798) (-1181.919) [-1181.964] (-1183.767) * (-1184.702) [-1182.626] (-1183.691) (-1180.544) -- 0:00:53
117000 -- (-1181.322) (-1183.285) [-1181.262] (-1180.639) * (-1185.190) (-1183.160) (-1183.191) [-1180.827] -- 0:00:52
117500 -- (-1182.246) (-1183.930) (-1183.191) [-1180.662] * (-1183.197) (-1183.348) [-1184.438] (-1181.613) -- 0:00:52
118000 -- [-1182.516] (-1185.289) (-1185.541) (-1182.479) * (-1184.434) (-1183.517) [-1181.056] (-1181.614) -- 0:00:52
118500 -- (-1181.600) [-1182.061] (-1182.037) (-1182.748) * [-1184.718] (-1188.146) (-1180.769) (-1182.278) -- 0:00:52
119000 -- [-1185.698] (-1184.325) (-1185.363) (-1182.976) * (-1183.194) (-1182.300) [-1181.382] (-1182.830) -- 0:00:51
119500 -- (-1183.235) [-1183.258] (-1182.281) (-1180.450) * (-1182.401) [-1184.532] (-1183.742) (-1180.769) -- 0:00:51
120000 -- (-1183.587) (-1182.050) [-1182.833] (-1180.425) * (-1180.585) (-1182.966) (-1185.178) [-1181.022] -- 0:00:51
Average standard deviation of split frequencies: 0.019739
120500 -- [-1183.733] (-1182.103) (-1185.887) (-1181.113) * (-1180.879) (-1181.294) [-1183.763] (-1181.198) -- 0:00:51
121000 -- [-1185.064] (-1181.501) (-1182.431) (-1180.825) * [-1182.554] (-1181.846) (-1182.254) (-1182.656) -- 0:00:50
121500 -- (-1184.744) (-1184.825) [-1182.970] (-1181.327) * (-1185.095) (-1180.527) (-1183.249) [-1182.170] -- 0:00:50
122000 -- [-1184.935] (-1182.417) (-1183.476) (-1180.926) * (-1181.559) (-1182.432) (-1187.207) [-1182.990] -- 0:00:50
122500 -- (-1183.739) [-1180.767] (-1183.948) (-1180.683) * (-1183.051) (-1181.438) [-1182.194] (-1181.868) -- 0:00:50
123000 -- (-1182.799) (-1186.511) [-1183.040] (-1181.622) * (-1184.649) [-1180.581] (-1185.009) (-1182.046) -- 0:00:49
123500 -- (-1185.285) (-1188.659) [-1181.837] (-1181.570) * [-1183.043] (-1182.283) (-1183.853) (-1182.939) -- 0:00:49
124000 -- (-1185.437) (-1181.571) (-1182.842) [-1181.544] * [-1182.316] (-1182.176) (-1181.434) (-1182.048) -- 0:00:56
124500 -- (-1183.272) [-1181.361] (-1181.401) (-1184.538) * (-1186.022) (-1183.348) (-1182.313) [-1183.716] -- 0:00:56
125000 -- (-1184.632) (-1184.212) [-1181.928] (-1183.070) * (-1180.559) (-1183.016) (-1184.501) [-1184.235] -- 0:00:56
Average standard deviation of split frequencies: 0.017722
125500 -- (-1182.063) (-1189.034) [-1181.268] (-1181.442) * (-1183.388) (-1183.276) (-1181.059) [-1184.563] -- 0:00:55
126000 -- (-1180.722) [-1188.750] (-1181.485) (-1182.091) * [-1189.647] (-1182.357) (-1181.960) (-1181.509) -- 0:00:55
126500 -- [-1182.588] (-1182.299) (-1181.439) (-1182.351) * (-1188.044) (-1183.505) [-1183.925] (-1181.733) -- 0:00:55
127000 -- (-1181.020) (-1184.387) [-1181.236] (-1182.859) * (-1185.498) (-1182.800) (-1183.925) [-1180.672] -- 0:00:54
127500 -- (-1180.496) (-1181.794) [-1185.442] (-1182.212) * (-1180.881) (-1185.312) (-1182.953) [-1180.686] -- 0:00:54
128000 -- (-1181.624) (-1181.794) [-1182.274] (-1182.425) * (-1184.559) [-1183.578] (-1183.812) (-1183.675) -- 0:00:54
128500 -- (-1181.274) (-1185.203) [-1183.610] (-1182.219) * (-1182.733) [-1184.232] (-1185.554) (-1182.636) -- 0:00:54
129000 -- [-1182.682] (-1180.409) (-1184.250) (-1184.740) * (-1182.390) [-1186.586] (-1183.110) (-1188.182) -- 0:00:54
129500 -- [-1180.633] (-1184.266) (-1183.586) (-1187.541) * (-1184.422) [-1184.399] (-1183.103) (-1183.527) -- 0:00:53
130000 -- (-1181.600) (-1180.697) (-1182.861) [-1180.772] * (-1181.389) [-1185.722] (-1183.775) (-1183.207) -- 0:00:53
Average standard deviation of split frequencies: 0.018988
130500 -- (-1182.386) [-1182.263] (-1181.881) (-1181.536) * (-1180.411) (-1182.274) (-1188.350) [-1182.963] -- 0:00:53
131000 -- [-1182.267] (-1182.914) (-1181.535) (-1181.344) * [-1180.557] (-1181.216) (-1191.276) (-1184.132) -- 0:00:53
131500 -- (-1181.700) [-1183.764] (-1185.032) (-1181.817) * (-1180.474) [-1180.597] (-1191.657) (-1184.227) -- 0:00:52
132000 -- (-1183.016) (-1185.741) (-1185.343) [-1180.570] * (-1180.619) [-1181.321] (-1185.606) (-1183.142) -- 0:00:52
132500 -- [-1180.714] (-1186.359) (-1180.702) (-1184.753) * (-1180.734) (-1183.278) (-1182.882) [-1184.197] -- 0:00:52
133000 -- (-1181.704) (-1181.549) [-1182.963] (-1186.294) * [-1183.168] (-1181.980) (-1184.936) (-1185.051) -- 0:00:52
133500 -- [-1180.754] (-1183.912) (-1182.506) (-1185.676) * (-1184.702) [-1182.114] (-1184.017) (-1182.726) -- 0:00:51
134000 -- (-1183.735) (-1182.283) [-1184.631] (-1182.303) * (-1183.706) (-1182.768) [-1183.055] (-1185.414) -- 0:00:51
134500 -- [-1181.714] (-1182.702) (-1182.925) (-1181.738) * [-1188.000] (-1183.396) (-1185.705) (-1186.676) -- 0:00:51
135000 -- (-1182.632) [-1181.835] (-1181.916) (-1185.000) * (-1181.520) (-1183.498) (-1185.883) [-1182.328] -- 0:00:51
Average standard deviation of split frequencies: 0.020186
135500 -- (-1185.632) [-1180.221] (-1182.631) (-1182.507) * (-1185.436) (-1182.823) (-1184.821) [-1182.679] -- 0:00:51
136000 -- (-1183.179) [-1180.396] (-1181.235) (-1183.048) * (-1182.519) [-1182.727] (-1184.307) (-1183.039) -- 0:00:50
136500 -- (-1186.737) (-1180.695) [-1183.172] (-1182.494) * (-1184.748) (-1183.199) [-1185.014] (-1184.198) -- 0:00:50
137000 -- (-1181.605) (-1181.512) (-1184.358) [-1182.934] * (-1183.397) (-1183.163) [-1182.008] (-1182.272) -- 0:00:50
137500 -- [-1181.094] (-1180.928) (-1182.043) (-1181.772) * (-1181.957) (-1183.209) (-1182.162) [-1182.016] -- 0:00:50
138000 -- (-1184.198) (-1182.114) (-1181.558) [-1182.786] * (-1183.926) [-1181.716] (-1181.018) (-1184.643) -- 0:00:49
138500 -- (-1180.638) [-1181.867] (-1182.799) (-1183.089) * (-1181.974) (-1184.092) (-1186.678) [-1186.235] -- 0:00:49
139000 -- (-1180.475) (-1181.421) [-1184.254] (-1180.855) * [-1182.148] (-1182.594) (-1185.271) (-1188.478) -- 0:00:49
139500 -- (-1182.132) (-1184.802) [-1183.401] (-1180.941) * [-1182.489] (-1183.743) (-1187.582) (-1184.923) -- 0:00:49
140000 -- [-1180.654] (-1182.579) (-1182.106) (-1181.190) * [-1182.458] (-1180.391) (-1185.160) (-1182.681) -- 0:00:55
Average standard deviation of split frequencies: 0.020699
140500 -- (-1181.403) (-1181.971) [-1184.390] (-1183.414) * (-1181.351) [-1180.189] (-1189.187) (-1187.425) -- 0:00:55
141000 -- (-1183.290) (-1183.767) (-1183.309) [-1180.642] * [-1181.145] (-1181.887) (-1186.472) (-1187.896) -- 0:00:54
141500 -- (-1182.490) (-1184.937) (-1182.620) [-1180.779] * [-1180.928] (-1182.274) (-1181.724) (-1184.012) -- 0:00:54
142000 -- [-1183.304] (-1184.190) (-1183.405) (-1181.980) * (-1180.623) (-1184.637) [-1181.907] (-1182.431) -- 0:00:54
142500 -- [-1184.067] (-1186.407) (-1183.674) (-1183.659) * (-1181.813) (-1188.150) [-1181.286] (-1182.039) -- 0:00:54
143000 -- (-1188.944) [-1182.835] (-1182.706) (-1183.003) * (-1185.497) (-1186.084) (-1180.948) [-1180.854] -- 0:00:53
143500 -- (-1185.776) (-1183.833) (-1185.388) [-1186.312] * (-1181.726) (-1184.060) [-1181.056] (-1182.921) -- 0:00:53
144000 -- (-1187.297) [-1183.038] (-1184.193) (-1183.551) * (-1181.090) (-1182.121) [-1183.064] (-1185.405) -- 0:00:53
144500 -- (-1182.616) [-1181.660] (-1184.241) (-1183.833) * (-1180.826) (-1181.937) [-1182.733] (-1183.875) -- 0:00:53
145000 -- [-1180.710] (-1183.423) (-1182.493) (-1183.123) * (-1180.950) (-1183.877) [-1180.671] (-1183.837) -- 0:00:53
Average standard deviation of split frequencies: 0.019563
145500 -- [-1185.485] (-1181.286) (-1180.771) (-1182.998) * [-1180.904] (-1180.782) (-1181.329) (-1183.530) -- 0:00:52
146000 -- [-1182.452] (-1182.862) (-1180.785) (-1184.853) * (-1184.875) (-1181.648) (-1183.726) [-1182.945] -- 0:00:52
146500 -- (-1182.229) [-1181.544] (-1181.358) (-1183.719) * (-1186.811) [-1181.101] (-1183.017) (-1181.783) -- 0:00:52
147000 -- (-1181.835) (-1183.173) [-1181.357] (-1182.474) * [-1181.680] (-1181.051) (-1185.052) (-1182.351) -- 0:00:52
147500 -- (-1180.852) [-1184.855] (-1181.304) (-1182.575) * (-1181.962) (-1185.442) [-1182.566] (-1182.499) -- 0:00:52
148000 -- (-1181.432) (-1184.996) (-1183.105) [-1181.582] * [-1183.355] (-1182.328) (-1183.172) (-1183.366) -- 0:00:51
148500 -- [-1181.963] (-1181.219) (-1182.389) (-1182.467) * (-1183.745) [-1183.405] (-1181.431) (-1183.686) -- 0:00:51
149000 -- (-1188.291) (-1181.312) (-1182.500) [-1190.200] * (-1183.044) (-1181.825) [-1182.743] (-1180.879) -- 0:00:51
149500 -- [-1182.581] (-1180.827) (-1182.331) (-1181.527) * (-1181.088) [-1182.188] (-1182.569) (-1181.220) -- 0:00:51
150000 -- (-1181.914) (-1183.087) (-1182.422) [-1183.106] * [-1182.055] (-1184.564) (-1181.666) (-1181.108) -- 0:00:51
Average standard deviation of split frequencies: 0.020511
150500 -- (-1183.429) [-1181.317] (-1181.410) (-1183.360) * [-1182.782] (-1181.942) (-1183.536) (-1183.240) -- 0:00:50
151000 -- (-1181.212) (-1186.525) [-1181.931] (-1180.827) * [-1182.698] (-1182.602) (-1182.372) (-1181.259) -- 0:00:50
151500 -- (-1180.998) (-1183.201) [-1182.815] (-1182.413) * (-1183.108) [-1182.816] (-1180.995) (-1180.854) -- 0:00:50
152000 -- [-1181.914] (-1183.829) (-1181.310) (-1182.148) * (-1182.965) (-1181.121) (-1180.993) [-1182.530] -- 0:00:50
152500 -- (-1181.780) (-1187.568) (-1184.174) [-1181.413] * (-1182.949) [-1187.627] (-1183.028) (-1183.608) -- 0:00:50
153000 -- (-1181.655) (-1183.449) [-1181.120] (-1183.651) * [-1182.614] (-1183.652) (-1182.172) (-1187.087) -- 0:00:49
153500 -- (-1181.286) (-1182.703) [-1181.546] (-1186.413) * (-1183.854) (-1184.349) (-1182.008) [-1185.565] -- 0:00:49
154000 -- (-1182.854) (-1186.497) (-1182.560) [-1182.360] * (-1184.690) (-1185.643) (-1185.353) [-1181.917] -- 0:00:49
154500 -- (-1181.764) (-1189.965) [-1181.079] (-1181.236) * (-1184.249) (-1181.421) (-1180.923) [-1181.541] -- 0:00:49
155000 -- (-1180.739) (-1183.573) [-1181.213] (-1180.396) * (-1182.607) [-1183.109] (-1180.932) (-1182.273) -- 0:00:49
Average standard deviation of split frequencies: 0.019562
155500 -- (-1182.529) (-1183.170) (-1180.662) [-1182.240] * (-1183.264) (-1180.912) (-1184.864) [-1182.200] -- 0:00:48
156000 -- (-1185.360) (-1183.948) (-1183.096) [-1183.025] * (-1180.779) (-1181.099) (-1180.641) [-1182.370] -- 0:00:54
156500 -- [-1182.766] (-1184.496) (-1182.594) (-1183.832) * (-1181.989) [-1181.022] (-1181.813) (-1180.922) -- 0:00:53
157000 -- (-1182.483) (-1184.280) (-1182.524) [-1183.340] * (-1180.278) (-1182.204) (-1181.219) [-1182.270] -- 0:00:53
157500 -- (-1182.292) [-1184.634] (-1181.400) (-1181.215) * (-1182.729) (-1181.898) [-1181.219] (-1183.958) -- 0:00:53
158000 -- [-1184.602] (-1183.731) (-1183.038) (-1183.039) * [-1186.073] (-1182.715) (-1183.158) (-1184.193) -- 0:00:53
158500 -- (-1186.337) [-1181.068] (-1187.210) (-1181.685) * (-1183.990) [-1181.593] (-1181.263) (-1184.224) -- 0:00:53
159000 -- (-1183.066) (-1185.831) (-1183.604) [-1181.702] * [-1183.104] (-1183.249) (-1182.862) (-1182.127) -- 0:00:52
159500 -- (-1184.845) (-1181.030) (-1182.140) [-1180.598] * (-1184.137) (-1181.875) [-1182.860] (-1182.047) -- 0:00:52
160000 -- [-1184.112] (-1181.460) (-1184.863) (-1180.561) * (-1181.224) (-1181.392) [-1182.690] (-1181.147) -- 0:00:52
Average standard deviation of split frequencies: 0.018582
160500 -- (-1183.176) [-1183.329] (-1184.749) (-1183.447) * (-1183.580) (-1181.409) (-1181.685) [-1180.703] -- 0:00:52
161000 -- (-1184.925) (-1182.849) [-1183.517] (-1185.357) * [-1186.292] (-1180.915) (-1181.670) (-1180.757) -- 0:00:52
161500 -- (-1185.419) (-1185.201) (-1185.405) [-1183.776] * [-1184.872] (-1182.746) (-1181.783) (-1180.768) -- 0:00:51
162000 -- [-1183.292] (-1183.534) (-1186.764) (-1183.829) * (-1181.888) (-1184.255) (-1181.201) [-1180.509] -- 0:00:51
162500 -- (-1181.273) [-1181.505] (-1184.842) (-1187.078) * (-1181.365) (-1187.156) [-1183.142] (-1182.940) -- 0:00:51
163000 -- (-1184.078) (-1181.658) (-1181.010) [-1183.480] * [-1182.040] (-1183.031) (-1184.074) (-1182.887) -- 0:00:51
163500 -- (-1184.984) [-1182.444] (-1180.932) (-1180.642) * (-1184.732) [-1181.140] (-1188.288) (-1185.477) -- 0:00:51
164000 -- (-1185.457) (-1180.440) (-1180.938) [-1180.445] * (-1181.835) (-1181.191) [-1183.645] (-1187.805) -- 0:00:50
164500 -- [-1180.900] (-1180.716) (-1181.692) (-1180.698) * (-1181.742) [-1185.553] (-1184.332) (-1184.236) -- 0:00:50
165000 -- (-1181.452) (-1180.802) (-1182.266) [-1183.111] * [-1180.895] (-1181.502) (-1181.811) (-1183.144) -- 0:00:50
Average standard deviation of split frequencies: 0.018085
165500 -- [-1182.818] (-1184.247) (-1181.776) (-1182.286) * (-1183.056) (-1181.759) (-1182.052) [-1181.306] -- 0:00:50
166000 -- (-1182.874) [-1183.614] (-1182.796) (-1182.417) * [-1182.679] (-1180.894) (-1185.248) (-1181.640) -- 0:00:50
166500 -- (-1182.142) (-1183.563) [-1182.631] (-1180.877) * [-1182.812] (-1183.116) (-1181.746) (-1181.559) -- 0:00:50
167000 -- (-1182.744) [-1181.274] (-1183.149) (-1180.969) * (-1183.485) [-1180.909] (-1181.194) (-1184.224) -- 0:00:49
167500 -- (-1186.991) [-1182.023] (-1184.311) (-1180.528) * (-1182.710) (-1180.526) (-1184.116) [-1185.777] -- 0:00:49
168000 -- [-1183.621] (-1182.284) (-1185.484) (-1181.595) * [-1182.118] (-1181.250) (-1186.498) (-1184.178) -- 0:00:49
168500 -- [-1183.315] (-1182.557) (-1182.963) (-1181.586) * [-1182.411] (-1183.615) (-1182.922) (-1184.911) -- 0:00:49
169000 -- (-1183.589) (-1183.098) (-1182.620) [-1181.183] * (-1183.942) (-1183.210) (-1182.498) [-1184.055] -- 0:00:49
169500 -- (-1184.212) (-1186.600) [-1184.363] (-1182.557) * (-1183.181) (-1184.527) (-1183.224) [-1188.698] -- 0:00:48
170000 -- (-1184.293) [-1183.764] (-1183.046) (-1183.990) * [-1184.946] (-1183.376) (-1181.519) (-1183.945) -- 0:00:48
Average standard deviation of split frequencies: 0.018414
170500 -- [-1182.203] (-1183.986) (-1181.426) (-1181.527) * [-1184.669] (-1182.880) (-1184.305) (-1181.551) -- 0:00:48
171000 -- (-1182.351) (-1183.246) [-1182.196] (-1181.070) * (-1183.461) [-1180.957] (-1183.818) (-1182.093) -- 0:00:48
171500 -- (-1182.334) (-1181.208) (-1182.534) [-1183.217] * (-1182.922) [-1181.638] (-1184.049) (-1183.794) -- 0:00:48
172000 -- (-1184.602) [-1182.147] (-1187.136) (-1181.165) * (-1181.809) (-1182.242) [-1180.585] (-1182.322) -- 0:00:52
172500 -- (-1181.983) (-1181.671) (-1186.099) [-1180.378] * (-1181.973) (-1181.823) [-1181.522] (-1181.862) -- 0:00:52
173000 -- [-1183.693] (-1181.446) (-1184.096) (-1181.580) * (-1181.455) [-1185.678] (-1181.644) (-1181.900) -- 0:00:52
173500 -- [-1185.972] (-1183.445) (-1183.105) (-1181.937) * (-1182.367) (-1182.043) [-1182.778] (-1184.844) -- 0:00:52
174000 -- [-1182.697] (-1182.556) (-1181.399) (-1187.029) * [-1184.792] (-1180.925) (-1181.425) (-1182.981) -- 0:00:52
174500 -- (-1182.993) (-1182.603) [-1181.377] (-1181.842) * (-1181.837) (-1181.226) (-1182.571) [-1183.548] -- 0:00:52
175000 -- (-1183.842) (-1181.431) (-1181.049) [-1184.368] * (-1185.189) (-1183.221) (-1182.353) [-1182.315] -- 0:00:51
Average standard deviation of split frequencies: 0.016963
175500 -- (-1182.468) (-1181.813) [-1180.838] (-1184.671) * (-1183.305) [-1183.047] (-1181.393) (-1182.176) -- 0:00:51
176000 -- (-1187.902) (-1185.907) [-1184.258] (-1182.003) * (-1183.038) (-1180.786) (-1181.018) [-1182.068] -- 0:00:51
176500 -- [-1182.083] (-1187.551) (-1182.547) (-1182.238) * (-1180.897) (-1180.742) (-1183.576) [-1180.688] -- 0:00:51
177000 -- [-1181.131] (-1183.512) (-1182.994) (-1183.036) * [-1181.208] (-1180.977) (-1181.470) (-1180.381) -- 0:00:51
177500 -- [-1180.960] (-1181.461) (-1183.421) (-1182.664) * (-1181.401) (-1182.604) [-1182.184] (-1184.279) -- 0:00:50
178000 -- (-1181.687) [-1182.931] (-1181.889) (-1181.179) * (-1181.122) (-1185.709) [-1184.134] (-1181.789) -- 0:00:50
178500 -- (-1182.701) (-1184.456) (-1181.235) [-1181.216] * (-1182.412) (-1181.975) [-1184.359] (-1180.640) -- 0:00:50
179000 -- (-1181.541) [-1187.421] (-1185.883) (-1182.820) * (-1183.904) [-1182.762] (-1184.050) (-1180.640) -- 0:00:50
179500 -- (-1181.747) (-1183.222) (-1184.498) [-1180.940] * [-1183.248] (-1189.926) (-1181.615) (-1180.588) -- 0:00:50
180000 -- (-1181.710) [-1181.820] (-1183.316) (-1181.621) * (-1184.645) (-1186.214) (-1183.345) [-1183.240] -- 0:00:50
Average standard deviation of split frequencies: 0.014786
180500 -- (-1181.003) [-1182.117] (-1185.332) (-1181.433) * (-1183.181) (-1182.639) (-1181.018) [-1181.511] -- 0:00:49
181000 -- [-1182.749] (-1181.634) (-1184.181) (-1182.159) * (-1184.090) (-1182.347) [-1180.527] (-1180.853) -- 0:00:49
181500 -- [-1181.129] (-1182.784) (-1184.831) (-1185.573) * (-1185.558) (-1181.201) [-1181.109] (-1183.253) -- 0:00:49
182000 -- (-1184.267) [-1182.095] (-1184.749) (-1185.161) * (-1185.170) (-1181.477) [-1181.931] (-1182.041) -- 0:00:49
182500 -- (-1182.221) (-1182.201) [-1183.201] (-1182.108) * (-1182.157) (-1181.574) (-1182.222) [-1182.981] -- 0:00:49
183000 -- (-1181.512) (-1183.009) [-1183.732] (-1182.703) * (-1182.927) (-1180.453) (-1183.839) [-1183.402] -- 0:00:49
183500 -- [-1182.428] (-1182.159) (-1185.071) (-1183.748) * (-1182.912) (-1181.558) (-1183.603) [-1181.510] -- 0:00:48
184000 -- (-1184.127) (-1182.733) (-1185.402) [-1181.418] * (-1181.707) (-1184.757) [-1180.546] (-1181.076) -- 0:00:48
184500 -- (-1187.353) (-1180.708) (-1185.418) [-1182.330] * [-1182.321] (-1183.454) (-1182.456) (-1181.963) -- 0:00:48
185000 -- (-1182.989) (-1180.440) (-1183.871) [-1181.874] * (-1182.405) (-1185.175) [-1181.515] (-1181.498) -- 0:00:48
Average standard deviation of split frequencies: 0.016051
185500 -- (-1181.617) (-1181.639) [-1183.637] (-1182.161) * (-1181.237) (-1182.109) [-1185.642] (-1180.548) -- 0:00:48
186000 -- (-1183.725) [-1180.822] (-1183.914) (-1184.504) * (-1181.775) [-1181.992] (-1188.786) (-1180.901) -- 0:00:48
186500 -- (-1182.703) (-1180.489) [-1184.035] (-1184.243) * [-1182.755] (-1184.176) (-1183.839) (-1180.926) -- 0:00:47
187000 -- (-1183.394) [-1181.664] (-1182.365) (-1184.171) * [-1181.386] (-1186.146) (-1181.284) (-1182.699) -- 0:00:47
187500 -- (-1182.444) (-1182.807) [-1180.757] (-1183.236) * [-1180.467] (-1181.919) (-1180.935) (-1181.730) -- 0:00:47
188000 -- (-1181.472) (-1183.321) (-1181.037) [-1181.038] * (-1184.432) [-1181.658] (-1184.391) (-1184.133) -- 0:00:51
188500 -- (-1183.472) (-1182.858) (-1184.407) [-1181.072] * (-1182.630) [-1182.998] (-1183.815) (-1183.832) -- 0:00:51
189000 -- (-1183.266) [-1182.306] (-1185.724) (-1181.484) * (-1182.882) (-1183.732) [-1182.757] (-1183.847) -- 0:00:51
189500 -- (-1181.516) [-1183.108] (-1186.731) (-1182.281) * [-1181.423] (-1183.011) (-1184.130) (-1189.249) -- 0:00:51
190000 -- (-1181.495) (-1184.011) [-1182.374] (-1185.449) * [-1181.828] (-1181.627) (-1184.536) (-1182.426) -- 0:00:51
Average standard deviation of split frequencies: 0.014010
190500 -- [-1181.521] (-1181.903) (-1184.192) (-1181.986) * [-1182.945] (-1181.915) (-1181.823) (-1183.449) -- 0:00:50
191000 -- [-1181.197] (-1182.394) (-1182.865) (-1182.395) * (-1189.338) [-1181.465] (-1180.856) (-1184.070) -- 0:00:50
191500 -- (-1182.675) [-1181.276] (-1183.308) (-1181.842) * [-1185.594] (-1182.845) (-1182.817) (-1183.239) -- 0:00:50
192000 -- [-1182.869] (-1181.765) (-1181.923) (-1185.729) * (-1181.855) (-1182.463) (-1181.850) [-1181.162] -- 0:00:50
192500 -- [-1182.771] (-1182.471) (-1182.500) (-1182.707) * (-1181.380) (-1181.765) (-1181.466) [-1181.700] -- 0:00:50
193000 -- (-1183.578) (-1181.360) (-1181.227) [-1185.643] * (-1180.284) (-1184.705) [-1181.547] (-1182.299) -- 0:00:50
193500 -- (-1182.683) [-1181.570] (-1180.413) (-1185.704) * (-1184.524) (-1183.378) (-1185.423) [-1181.952] -- 0:00:50
194000 -- [-1181.782] (-1181.553) (-1182.425) (-1183.202) * (-1181.495) (-1188.493) (-1181.177) [-1181.830] -- 0:00:49
194500 -- (-1184.886) (-1184.159) (-1185.089) [-1181.476] * [-1180.860] (-1182.845) (-1181.219) (-1181.234) -- 0:00:49
195000 -- [-1182.456] (-1184.893) (-1185.117) (-1182.878) * (-1181.376) [-1181.983] (-1180.309) (-1182.340) -- 0:00:49
Average standard deviation of split frequencies: 0.012694
195500 -- (-1182.196) (-1185.231) [-1183.910] (-1185.425) * (-1183.088) (-1181.661) (-1185.814) [-1183.856] -- 0:00:49
196000 -- [-1182.533] (-1182.657) (-1184.656) (-1185.903) * [-1183.545] (-1181.948) (-1186.179) (-1185.283) -- 0:00:49
196500 -- [-1183.775] (-1183.325) (-1184.696) (-1181.302) * (-1190.736) (-1181.268) (-1184.510) [-1183.996] -- 0:00:49
197000 -- (-1183.426) (-1185.268) [-1182.440] (-1184.559) * (-1185.766) (-1183.994) [-1189.953] (-1181.371) -- 0:00:48
197500 -- [-1183.508] (-1181.833) (-1182.701) (-1182.878) * (-1182.348) (-1181.882) (-1184.191) [-1181.117] -- 0:00:48
198000 -- (-1181.959) [-1182.398] (-1183.390) (-1184.307) * (-1184.397) (-1181.997) [-1187.188] (-1184.630) -- 0:00:48
198500 -- (-1181.238) [-1180.479] (-1183.338) (-1183.783) * (-1183.773) [-1182.242] (-1185.278) (-1182.813) -- 0:00:48
199000 -- [-1181.513] (-1181.074) (-1181.926) (-1184.121) * (-1183.116) (-1181.063) (-1181.659) [-1181.480] -- 0:00:48
199500 -- (-1181.501) (-1183.523) [-1184.164] (-1183.768) * (-1184.022) (-1180.762) [-1181.240] (-1182.283) -- 0:00:48
200000 -- (-1181.334) [-1181.468] (-1181.714) (-1184.758) * (-1184.717) (-1180.890) [-1181.723] (-1182.062) -- 0:00:48
Average standard deviation of split frequencies: 0.013312
200500 -- (-1183.431) (-1181.466) (-1181.597) [-1182.454] * (-1182.027) (-1183.197) (-1181.600) [-1180.830] -- 0:00:47
201000 -- (-1182.627) (-1181.475) [-1181.970] (-1183.762) * [-1180.810] (-1184.739) (-1181.475) (-1181.080) -- 0:00:47
201500 -- (-1180.302) [-1180.795] (-1184.683) (-1187.060) * [-1182.918] (-1190.114) (-1182.353) (-1182.322) -- 0:00:47
202000 -- (-1181.678) [-1181.021] (-1181.418) (-1184.885) * [-1182.499] (-1188.937) (-1182.232) (-1181.753) -- 0:00:47
202500 -- (-1184.021) (-1181.660) [-1180.212] (-1184.260) * (-1184.415) (-1185.691) (-1182.410) [-1183.415] -- 0:00:47
203000 -- (-1190.196) (-1182.514) (-1180.212) [-1182.668] * (-1181.856) (-1183.892) [-1184.544] (-1181.173) -- 0:00:47
203500 -- [-1181.558] (-1181.251) (-1183.988) (-1183.091) * (-1180.819) (-1182.729) (-1184.777) [-1181.548] -- 0:00:50
204000 -- [-1181.245] (-1183.339) (-1182.539) (-1183.395) * [-1181.135] (-1183.351) (-1181.089) (-1185.261) -- 0:00:50
204500 -- (-1183.828) [-1181.735] (-1182.549) (-1183.479) * (-1183.184) [-1183.647] (-1181.471) (-1190.484) -- 0:00:50
205000 -- [-1184.659] (-1185.853) (-1182.975) (-1181.654) * (-1182.019) [-1181.676] (-1181.753) (-1185.497) -- 0:00:50
Average standard deviation of split frequencies: 0.013603
205500 -- (-1184.186) (-1186.223) (-1182.357) [-1182.217] * [-1182.882] (-1181.984) (-1181.188) (-1180.904) -- 0:00:50
206000 -- [-1182.538] (-1181.681) (-1181.719) (-1184.658) * [-1182.042] (-1181.374) (-1182.607) (-1183.189) -- 0:00:50
206500 -- (-1182.316) (-1182.642) (-1183.527) [-1181.089] * (-1186.734) (-1181.381) (-1182.559) [-1184.493] -- 0:00:49
207000 -- (-1182.547) (-1182.347) [-1180.560] (-1182.841) * (-1181.474) [-1182.562] (-1181.311) (-1182.918) -- 0:00:49
207500 -- (-1182.553) [-1181.478] (-1180.348) (-1182.371) * (-1181.295) (-1181.363) [-1180.610] (-1181.050) -- 0:00:49
208000 -- [-1181.874] (-1182.060) (-1183.446) (-1182.036) * [-1183.250] (-1181.506) (-1180.957) (-1181.813) -- 0:00:49
208500 -- (-1182.725) (-1184.860) (-1183.509) [-1180.968] * (-1183.137) (-1182.205) (-1181.401) [-1181.653] -- 0:00:49
209000 -- (-1182.932) (-1184.119) (-1182.987) [-1181.455] * (-1183.732) (-1186.949) [-1180.957] (-1181.190) -- 0:00:49
209500 -- (-1182.854) (-1182.403) (-1183.280) [-1181.158] * (-1182.254) [-1182.442] (-1180.890) (-1183.982) -- 0:00:49
210000 -- (-1184.360) (-1182.640) [-1181.475] (-1180.368) * [-1183.032] (-1181.827) (-1184.085) (-1184.245) -- 0:00:48
Average standard deviation of split frequencies: 0.014172
210500 -- (-1181.852) [-1182.239] (-1183.191) (-1184.025) * (-1184.119) (-1182.185) [-1184.178] (-1181.934) -- 0:00:48
211000 -- (-1184.765) [-1182.750] (-1186.376) (-1182.643) * (-1183.641) (-1182.894) [-1187.407] (-1182.073) -- 0:00:48
211500 -- (-1180.865) (-1183.808) (-1186.982) [-1180.503] * (-1182.080) (-1182.458) [-1185.735] (-1182.558) -- 0:00:48
212000 -- (-1184.754) (-1182.850) [-1182.839] (-1180.657) * (-1186.483) [-1184.325] (-1182.555) (-1184.759) -- 0:00:48
212500 -- (-1183.880) (-1185.011) [-1184.130] (-1182.964) * (-1181.809) (-1185.165) [-1182.554] (-1182.300) -- 0:00:48
213000 -- (-1187.702) (-1184.111) [-1183.657] (-1180.999) * [-1180.988] (-1188.965) (-1181.789) (-1180.754) -- 0:00:48
213500 -- [-1182.672] (-1187.367) (-1182.742) (-1180.660) * (-1183.926) (-1185.562) (-1182.056) [-1181.903] -- 0:00:47
214000 -- [-1181.123] (-1183.543) (-1182.766) (-1182.051) * [-1185.010] (-1186.721) (-1183.251) (-1181.517) -- 0:00:47
214500 -- (-1180.939) (-1186.614) (-1181.012) [-1180.986] * (-1183.738) [-1185.330] (-1184.020) (-1182.757) -- 0:00:47
215000 -- (-1182.983) (-1185.761) (-1182.646) [-1181.022] * (-1186.329) (-1180.287) (-1187.333) [-1180.854] -- 0:00:47
Average standard deviation of split frequencies: 0.014307
215500 -- (-1185.920) [-1181.123] (-1186.229) (-1182.041) * (-1184.618) (-1181.824) (-1184.780) [-1181.601] -- 0:00:47
216000 -- (-1180.801) (-1180.906) [-1182.892] (-1181.575) * [-1184.153] (-1186.307) (-1182.013) (-1184.312) -- 0:00:47
216500 -- [-1182.721] (-1181.717) (-1184.814) (-1184.673) * (-1184.151) (-1180.856) (-1182.805) [-1181.969] -- 0:00:47
217000 -- [-1180.580] (-1181.989) (-1184.827) (-1180.963) * (-1186.189) (-1180.581) [-1182.235] (-1182.887) -- 0:00:46
217500 -- [-1180.705] (-1183.211) (-1180.573) (-1182.388) * (-1186.160) (-1181.153) [-1180.510] (-1183.513) -- 0:00:46
218000 -- [-1181.138] (-1186.000) (-1180.406) (-1184.320) * (-1182.349) [-1182.217] (-1180.824) (-1181.029) -- 0:00:46
218500 -- (-1181.644) (-1181.765) [-1181.112] (-1185.507) * (-1181.557) (-1183.595) [-1182.353] (-1181.220) -- 0:00:46
219000 -- (-1181.643) (-1182.080) (-1181.995) [-1182.789] * (-1181.599) (-1181.914) (-1182.428) [-1180.656] -- 0:00:46
219500 -- (-1183.465) (-1181.812) (-1184.481) [-1181.027] * (-1183.812) [-1180.698] (-1185.540) (-1181.437) -- 0:00:46
220000 -- [-1182.040] (-1181.004) (-1182.084) (-1181.778) * (-1181.379) (-1182.199) (-1183.610) [-1181.638] -- 0:00:49
Average standard deviation of split frequencies: 0.012818
220500 -- (-1181.423) (-1181.344) (-1180.712) [-1180.825] * (-1181.224) (-1180.819) (-1182.908) [-1183.087] -- 0:00:49
221000 -- (-1184.172) (-1181.469) [-1189.680] (-1180.820) * [-1181.166] (-1181.963) (-1191.432) (-1181.557) -- 0:00:49
221500 -- [-1181.529] (-1182.506) (-1181.659) (-1186.672) * (-1185.062) (-1183.665) [-1183.351] (-1183.393) -- 0:00:49
222000 -- [-1181.275] (-1183.263) (-1181.778) (-1186.895) * (-1184.061) [-1181.341] (-1182.551) (-1181.930) -- 0:00:49
222500 -- [-1181.316] (-1181.469) (-1186.700) (-1184.087) * (-1183.192) (-1180.624) (-1181.932) [-1181.126] -- 0:00:48
223000 -- (-1181.303) (-1180.679) [-1183.763] (-1185.039) * (-1183.222) [-1181.829] (-1185.186) (-1182.088) -- 0:00:48
223500 -- (-1180.604) (-1183.547) [-1185.088] (-1187.188) * (-1182.218) [-1181.238] (-1182.080) (-1181.869) -- 0:00:48
224000 -- (-1181.529) (-1183.664) [-1183.555] (-1183.686) * [-1183.033] (-1182.194) (-1183.707) (-1180.844) -- 0:00:48
224500 -- (-1181.000) [-1185.628] (-1183.746) (-1182.654) * (-1181.879) (-1182.708) [-1181.325] (-1181.958) -- 0:00:48
225000 -- (-1184.981) (-1191.554) (-1183.868) [-1182.913] * (-1181.009) (-1184.812) [-1182.707] (-1182.669) -- 0:00:48
Average standard deviation of split frequencies: 0.011356
225500 -- (-1183.722) (-1183.758) [-1181.228] (-1184.564) * [-1183.528] (-1183.990) (-1182.946) (-1186.166) -- 0:00:48
226000 -- (-1182.230) [-1183.692] (-1181.211) (-1181.023) * [-1182.074] (-1187.590) (-1183.287) (-1182.585) -- 0:00:47
226500 -- (-1181.704) (-1185.592) (-1183.390) [-1184.735] * (-1182.451) [-1186.033] (-1181.971) (-1182.143) -- 0:00:47
227000 -- (-1182.958) (-1182.300) (-1182.238) [-1182.623] * (-1181.433) (-1182.635) (-1181.558) [-1183.137] -- 0:00:47
227500 -- (-1182.516) (-1183.900) [-1180.762] (-1183.348) * (-1181.473) [-1181.998] (-1181.568) (-1185.526) -- 0:00:47
228000 -- [-1184.717] (-1183.332) (-1181.895) (-1184.148) * [-1182.362] (-1181.873) (-1186.611) (-1182.897) -- 0:00:47
228500 -- (-1182.242) (-1182.570) [-1180.845] (-1183.946) * (-1182.363) (-1182.245) (-1185.345) [-1184.638] -- 0:00:47
229000 -- (-1182.106) (-1181.626) (-1181.046) [-1182.652] * (-1183.023) (-1181.021) (-1180.573) [-1185.363] -- 0:00:47
229500 -- (-1182.462) (-1181.898) (-1186.442) [-1184.412] * [-1184.695] (-1181.945) (-1181.605) (-1183.406) -- 0:00:47
230000 -- (-1183.683) (-1181.507) (-1182.965) [-1181.066] * (-1182.860) (-1184.992) (-1181.184) [-1182.862] -- 0:00:46
Average standard deviation of split frequencies: 0.012716
230500 -- (-1184.032) (-1181.283) (-1181.644) [-1180.990] * (-1180.261) [-1186.170] (-1181.650) (-1184.455) -- 0:00:46
231000 -- (-1183.729) (-1183.054) (-1188.155) [-1181.445] * (-1180.456) [-1186.512] (-1180.358) (-1183.693) -- 0:00:46
231500 -- [-1182.904] (-1183.493) (-1185.381) (-1182.180) * [-1180.226] (-1180.600) (-1180.694) (-1181.691) -- 0:00:46
232000 -- (-1184.334) [-1183.085] (-1184.663) (-1183.733) * (-1180.463) (-1184.168) [-1180.699] (-1184.184) -- 0:00:46
232500 -- (-1184.742) [-1184.408] (-1185.415) (-1184.915) * (-1180.359) (-1181.363) (-1182.570) [-1181.876] -- 0:00:46
233000 -- (-1189.548) (-1183.110) [-1183.072] (-1184.695) * (-1182.992) [-1183.085] (-1182.849) (-1181.216) -- 0:00:46
233500 -- (-1181.409) (-1181.007) [-1181.772] (-1183.503) * (-1182.946) (-1182.162) [-1182.360] (-1182.571) -- 0:00:45
234000 -- (-1181.931) (-1180.968) (-1180.775) [-1184.200] * (-1186.082) [-1181.786] (-1182.149) (-1182.079) -- 0:00:45
234500 -- [-1181.274] (-1182.216) (-1181.713) (-1187.759) * (-1184.350) [-1182.356] (-1183.505) (-1184.791) -- 0:00:45
235000 -- (-1182.140) [-1182.655] (-1181.523) (-1188.628) * (-1181.936) (-1181.880) [-1181.340] (-1181.971) -- 0:00:45
Average standard deviation of split frequencies: 0.012207
235500 -- (-1186.485) [-1183.477] (-1184.183) (-1181.893) * (-1184.052) (-1181.836) (-1184.286) [-1185.854] -- 0:00:48
236000 -- [-1181.448] (-1183.090) (-1184.558) (-1180.777) * (-1184.109) (-1180.368) [-1182.913] (-1181.900) -- 0:00:48
236500 -- (-1181.495) (-1183.667) (-1182.695) [-1183.138] * [-1181.815] (-1181.351) (-1186.101) (-1182.043) -- 0:00:48
237000 -- (-1180.875) (-1184.022) [-1182.489] (-1183.743) * [-1181.942] (-1180.750) (-1189.640) (-1182.512) -- 0:00:48
237500 -- (-1182.101) (-1187.434) [-1182.698] (-1182.795) * (-1184.306) [-1180.750] (-1183.188) (-1183.149) -- 0:00:48
238000 -- (-1182.373) (-1190.149) (-1186.289) [-1182.345] * (-1181.452) [-1181.702] (-1182.703) (-1182.272) -- 0:00:48
238500 -- (-1183.950) (-1187.497) (-1183.008) [-1182.784] * (-1182.608) [-1182.756] (-1182.172) (-1189.600) -- 0:00:47
239000 -- (-1182.005) (-1185.792) [-1182.119] (-1183.053) * (-1184.221) (-1183.517) (-1183.337) [-1180.901] -- 0:00:47
239500 -- (-1183.079) (-1184.437) [-1182.493] (-1182.175) * (-1183.047) (-1183.452) (-1182.490) [-1188.048] -- 0:00:47
240000 -- [-1185.247] (-1183.456) (-1182.615) (-1181.902) * (-1183.435) (-1186.020) [-1181.405] (-1185.343) -- 0:00:47
Average standard deviation of split frequencies: 0.013167
240500 -- (-1184.742) (-1182.537) (-1188.661) [-1181.508] * [-1182.014] (-1189.021) (-1182.735) (-1184.785) -- 0:00:47
241000 -- (-1184.981) (-1183.042) [-1183.328] (-1180.543) * (-1184.070) (-1180.346) (-1182.536) [-1180.886] -- 0:00:47
241500 -- (-1184.090) (-1180.891) [-1181.723] (-1183.140) * [-1180.400] (-1181.649) (-1181.150) (-1182.061) -- 0:00:47
242000 -- (-1180.783) (-1180.512) (-1181.214) [-1182.015] * (-1182.924) (-1184.079) [-1186.204] (-1187.790) -- 0:00:46
242500 -- (-1181.669) (-1185.188) [-1182.066] (-1182.504) * (-1182.072) (-1181.101) (-1184.515) [-1183.867] -- 0:00:46
243000 -- (-1181.076) [-1184.362] (-1183.357) (-1181.222) * [-1181.901] (-1186.105) (-1183.774) (-1181.759) -- 0:00:46
243500 -- (-1183.375) (-1183.814) (-1184.852) [-1182.349] * (-1181.176) (-1182.708) [-1183.229] (-1183.892) -- 0:00:46
244000 -- (-1180.581) (-1183.238) [-1182.885] (-1181.180) * (-1181.618) (-1183.827) [-1183.539] (-1182.055) -- 0:00:46
244500 -- (-1180.508) (-1184.482) (-1181.461) [-1181.740] * (-1183.907) (-1185.650) (-1182.147) [-1184.633] -- 0:00:46
245000 -- [-1182.045] (-1182.604) (-1182.446) (-1181.491) * (-1184.857) [-1182.497] (-1183.392) (-1184.124) -- 0:00:46
Average standard deviation of split frequencies: 0.012910
245500 -- (-1181.457) [-1183.414] (-1180.834) (-1185.265) * (-1185.884) (-1181.065) (-1181.545) [-1186.232] -- 0:00:46
246000 -- (-1180.540) (-1183.650) [-1182.614] (-1182.828) * (-1182.211) (-1182.475) (-1181.899) [-1181.936] -- 0:00:45
246500 -- [-1185.404] (-1185.140) (-1183.974) (-1182.183) * (-1181.772) [-1182.925] (-1182.740) (-1181.785) -- 0:00:45
247000 -- (-1185.437) (-1182.748) (-1180.901) [-1182.864] * [-1184.123] (-1187.500) (-1181.496) (-1181.950) -- 0:00:45
247500 -- [-1181.521] (-1184.009) (-1184.517) (-1182.008) * [-1182.057] (-1183.210) (-1181.497) (-1181.026) -- 0:00:45
248000 -- (-1181.478) [-1181.931] (-1183.066) (-1180.890) * (-1183.775) (-1184.925) (-1182.710) [-1182.268] -- 0:00:45
248500 -- (-1181.716) [-1181.463] (-1183.906) (-1184.489) * (-1181.851) (-1182.720) (-1181.911) [-1183.775] -- 0:00:45
249000 -- (-1180.688) (-1180.589) (-1181.701) [-1181.151] * (-1182.300) [-1182.382] (-1181.171) (-1182.858) -- 0:00:45
249500 -- (-1184.250) [-1180.567] (-1180.845) (-1185.773) * (-1181.977) (-1181.786) (-1183.916) [-1183.067] -- 0:00:48
250000 -- (-1180.513) [-1180.656] (-1186.303) (-1184.962) * (-1184.540) (-1181.330) (-1182.114) [-1182.348] -- 0:00:48
Average standard deviation of split frequencies: 0.013164
250500 -- (-1184.202) (-1182.388) (-1185.329) [-1181.543] * (-1183.461) [-1182.443] (-1183.600) (-1184.489) -- 0:00:47
251000 -- (-1183.978) [-1181.473] (-1182.392) (-1182.060) * (-1183.544) [-1181.345] (-1186.370) (-1181.781) -- 0:00:47
251500 -- (-1182.455) [-1182.530] (-1184.468) (-1181.599) * (-1181.610) (-1181.826) (-1183.477) [-1184.268] -- 0:00:47
252000 -- (-1184.665) [-1181.311] (-1181.360) (-1184.084) * (-1183.936) (-1180.610) (-1187.250) [-1182.656] -- 0:00:47
252500 -- (-1181.858) [-1183.580] (-1182.734) (-1181.859) * (-1187.081) (-1180.517) (-1184.400) [-1182.140] -- 0:00:47
253000 -- [-1181.590] (-1182.020) (-1182.919) (-1181.861) * (-1187.597) (-1181.077) [-1182.497] (-1182.433) -- 0:00:47
253500 -- [-1180.764] (-1181.525) (-1181.136) (-1180.472) * [-1180.674] (-1185.119) (-1186.177) (-1186.267) -- 0:00:47
254000 -- (-1181.547) (-1185.058) (-1180.741) [-1181.124] * (-1183.846) (-1183.057) [-1182.878] (-1185.674) -- 0:00:46
254500 -- [-1185.696] (-1185.684) (-1182.436) (-1182.013) * (-1190.273) (-1182.437) (-1181.660) [-1180.802] -- 0:00:46
255000 -- (-1188.772) (-1185.410) [-1185.590] (-1185.958) * [-1188.476] (-1181.953) (-1182.772) (-1182.533) -- 0:00:46
Average standard deviation of split frequencies: 0.013299
255500 -- [-1181.982] (-1183.005) (-1182.140) (-1186.180) * (-1184.762) [-1182.895] (-1182.899) (-1182.885) -- 0:00:46
256000 -- (-1181.663) (-1182.915) (-1183.282) [-1185.765] * (-1182.105) [-1182.603] (-1181.406) (-1181.391) -- 0:00:46
256500 -- (-1185.008) (-1184.608) [-1180.753] (-1184.138) * (-1181.672) (-1181.543) [-1181.876] (-1182.385) -- 0:00:46
257000 -- (-1183.031) (-1182.549) (-1181.766) [-1182.393] * [-1181.300] (-1181.975) (-1180.728) (-1183.249) -- 0:00:46
257500 -- (-1184.295) (-1182.546) [-1180.416] (-1187.181) * (-1182.117) (-1183.828) (-1181.451) [-1185.517] -- 0:00:46
258000 -- (-1184.752) [-1183.461] (-1183.055) (-1184.087) * [-1182.355] (-1185.818) (-1184.912) (-1184.818) -- 0:00:46
258500 -- (-1182.657) (-1185.914) (-1182.499) [-1183.741] * (-1182.156) [-1184.020] (-1183.454) (-1182.255) -- 0:00:45
259000 -- (-1182.657) (-1181.388) [-1182.079] (-1183.949) * [-1183.937] (-1180.761) (-1184.868) (-1182.550) -- 0:00:45
259500 -- [-1185.195] (-1183.163) (-1181.130) (-1189.351) * (-1184.850) (-1184.607) (-1183.445) [-1184.242] -- 0:00:45
260000 -- (-1183.679) (-1183.706) [-1181.269] (-1184.519) * [-1182.938] (-1181.441) (-1182.794) (-1181.390) -- 0:00:45
Average standard deviation of split frequencies: 0.012446
260500 -- [-1181.534] (-1181.929) (-1181.791) (-1180.946) * (-1183.655) [-1185.833] (-1182.792) (-1182.136) -- 0:00:45
261000 -- (-1183.090) [-1181.126] (-1180.855) (-1183.126) * [-1182.039] (-1183.089) (-1183.268) (-1183.991) -- 0:00:45
261500 -- (-1187.300) [-1183.628] (-1182.804) (-1182.641) * (-1184.266) (-1183.589) [-1183.000] (-1182.869) -- 0:00:45
262000 -- (-1183.383) (-1182.144) [-1180.477] (-1184.564) * (-1182.974) [-1182.873] (-1184.363) (-1181.652) -- 0:00:45
262500 -- [-1183.472] (-1182.708) (-1180.972) (-1183.917) * (-1182.655) (-1181.481) (-1184.358) [-1181.776] -- 0:00:44
263000 -- (-1188.650) (-1180.740) [-1180.743] (-1181.874) * (-1185.094) [-1191.857] (-1181.352) (-1181.385) -- 0:00:44
263500 -- (-1186.243) [-1182.537] (-1180.743) (-1182.686) * (-1183.386) (-1183.583) [-1182.906] (-1181.462) -- 0:00:47
264000 -- [-1183.771] (-1182.517) (-1181.378) (-1183.108) * (-1183.269) (-1181.962) [-1180.512] (-1181.901) -- 0:00:47
264500 -- (-1181.121) [-1185.029] (-1183.037) (-1185.137) * (-1182.106) [-1184.487] (-1180.894) (-1183.919) -- 0:00:47
265000 -- (-1180.372) (-1184.708) (-1182.900) [-1185.588] * (-1181.282) [-1181.320] (-1183.204) (-1184.276) -- 0:00:47
Average standard deviation of split frequencies: 0.011988
265500 -- [-1182.607] (-1181.158) (-1184.093) (-1185.984) * (-1185.117) (-1185.856) (-1180.401) [-1182.291] -- 0:00:47
266000 -- (-1186.220) (-1181.385) (-1182.488) [-1182.935] * (-1183.840) (-1185.597) (-1180.607) [-1182.309] -- 0:00:46
266500 -- (-1188.010) (-1182.723) (-1181.777) [-1185.191] * [-1184.671] (-1183.023) (-1181.462) (-1182.386) -- 0:00:46
267000 -- (-1191.913) (-1182.557) (-1181.776) [-1185.152] * [-1181.994] (-1183.419) (-1184.090) (-1183.770) -- 0:00:46
267500 -- [-1184.121] (-1182.206) (-1182.313) (-1187.672) * (-1181.887) (-1182.977) [-1184.444] (-1183.879) -- 0:00:46
268000 -- [-1180.878] (-1182.929) (-1183.693) (-1181.933) * (-1185.913) (-1183.806) (-1180.985) [-1181.849] -- 0:00:46
268500 -- (-1180.878) (-1183.751) (-1183.088) [-1184.753] * (-1181.310) (-1183.828) (-1181.675) [-1183.658] -- 0:00:46
269000 -- (-1182.868) (-1182.352) (-1183.059) [-1184.111] * [-1181.678] (-1185.490) (-1182.793) (-1185.425) -- 0:00:46
269500 -- (-1184.216) (-1183.519) [-1181.133] (-1184.157) * (-1182.114) [-1183.205] (-1182.373) (-1183.840) -- 0:00:46
270000 -- (-1186.208) [-1185.852] (-1183.830) (-1186.148) * [-1182.048] (-1183.650) (-1186.165) (-1184.941) -- 0:00:45
Average standard deviation of split frequencies: 0.010740
270500 -- (-1191.921) (-1186.003) [-1182.169] (-1187.444) * [-1184.491] (-1183.252) (-1181.722) (-1184.573) -- 0:00:45
271000 -- (-1180.513) [-1183.912] (-1184.309) (-1187.573) * (-1184.654) [-1181.193] (-1184.519) (-1183.732) -- 0:00:45
271500 -- (-1184.069) (-1181.660) [-1182.932] (-1182.855) * (-1182.245) [-1181.364] (-1183.070) (-1181.195) -- 0:00:45
272000 -- (-1187.950) (-1181.853) (-1183.594) [-1182.553] * (-1182.262) (-1181.333) (-1184.946) [-1181.507] -- 0:00:45
272500 -- (-1182.839) (-1184.805) (-1182.058) [-1184.067] * (-1181.458) (-1182.731) (-1181.952) [-1183.827] -- 0:00:45
273000 -- [-1183.117] (-1181.400) (-1182.049) (-1183.641) * [-1180.660] (-1184.113) (-1184.748) (-1183.636) -- 0:00:45
273500 -- (-1182.961) [-1182.768] (-1182.507) (-1183.608) * (-1184.311) [-1183.289] (-1184.158) (-1183.398) -- 0:00:45
274000 -- [-1182.814] (-1184.599) (-1183.436) (-1186.126) * (-1184.553) (-1185.891) (-1182.702) [-1182.198] -- 0:00:45
274500 -- (-1185.431) (-1183.938) [-1183.170] (-1186.364) * (-1180.653) [-1182.529] (-1181.045) (-1182.464) -- 0:00:44
275000 -- (-1184.648) (-1181.239) [-1180.916] (-1180.637) * [-1180.562] (-1184.732) (-1181.102) (-1183.517) -- 0:00:44
Average standard deviation of split frequencies: 0.011102
275500 -- [-1185.579] (-1185.280) (-1180.825) (-1180.531) * (-1180.695) (-1185.368) [-1183.661] (-1182.316) -- 0:00:44
276000 -- [-1182.786] (-1184.760) (-1180.608) (-1180.399) * [-1181.634] (-1183.568) (-1183.661) (-1184.271) -- 0:00:44
276500 -- (-1181.957) (-1183.171) [-1184.611] (-1180.439) * (-1182.170) [-1182.253] (-1181.318) (-1182.153) -- 0:00:44
277000 -- (-1185.953) (-1182.941) (-1183.145) [-1181.535] * [-1188.288] (-1181.911) (-1180.928) (-1183.251) -- 0:00:46
277500 -- (-1182.405) (-1184.657) [-1181.452] (-1181.698) * (-1184.094) (-1186.192) (-1188.487) [-1183.572] -- 0:00:46
278000 -- (-1181.157) (-1181.285) [-1181.403] (-1181.312) * [-1182.324] (-1184.783) (-1185.276) (-1182.633) -- 0:00:46
278500 -- [-1182.892] (-1184.243) (-1181.021) (-1182.687) * (-1185.203) (-1182.456) [-1182.315] (-1181.049) -- 0:00:46
279000 -- [-1184.362] (-1185.561) (-1181.054) (-1183.828) * (-1183.244) (-1184.728) (-1181.626) [-1185.006] -- 0:00:46
279500 -- (-1182.700) [-1183.547] (-1181.453) (-1182.666) * (-1182.588) [-1183.801] (-1180.926) (-1186.417) -- 0:00:46
280000 -- (-1181.989) (-1182.491) (-1181.989) [-1182.756] * (-1183.036) [-1182.850] (-1180.984) (-1184.897) -- 0:00:46
Average standard deviation of split frequencies: 0.011263
280500 -- (-1182.751) (-1181.698) [-1181.762] (-1181.144) * (-1185.547) (-1183.944) (-1180.851) [-1185.225] -- 0:00:46
281000 -- (-1181.485) (-1181.485) (-1182.856) [-1180.864] * (-1182.993) [-1182.157] (-1183.189) (-1180.437) -- 0:00:46
281500 -- (-1182.692) (-1183.524) (-1185.772) [-1183.406] * (-1184.427) (-1181.119) [-1182.822] (-1182.993) -- 0:00:45
282000 -- [-1183.170] (-1181.905) (-1181.723) (-1184.074) * (-1181.953) (-1184.505) (-1182.729) [-1183.008] -- 0:00:45
282500 -- (-1184.217) [-1181.185] (-1187.007) (-1186.756) * (-1183.489) (-1183.685) (-1183.001) [-1181.275] -- 0:00:45
283000 -- (-1183.488) (-1184.775) [-1184.092] (-1187.198) * (-1182.327) (-1181.636) (-1181.276) [-1180.772] -- 0:00:45
283500 -- (-1181.207) (-1184.107) (-1182.171) [-1189.526] * (-1183.293) (-1187.476) [-1180.929] (-1185.236) -- 0:00:45
284000 -- (-1181.026) (-1183.440) [-1183.062] (-1184.016) * (-1182.559) [-1182.902] (-1181.655) (-1181.927) -- 0:00:45
284500 -- (-1180.683) (-1181.188) [-1182.858] (-1181.613) * (-1180.755) (-1183.621) (-1184.238) [-1182.162] -- 0:00:45
285000 -- (-1182.540) [-1181.418] (-1184.116) (-1182.551) * (-1180.610) (-1184.883) (-1184.675) [-1182.297] -- 0:00:45
Average standard deviation of split frequencies: 0.011172
285500 -- [-1181.181] (-1181.358) (-1182.149) (-1184.820) * (-1183.102) (-1181.600) (-1186.051) [-1181.978] -- 0:00:45
286000 -- (-1184.061) (-1184.661) [-1181.642] (-1183.443) * (-1185.331) [-1181.889] (-1185.327) (-1182.212) -- 0:00:44
286500 -- [-1182.834] (-1184.345) (-1182.133) (-1183.044) * (-1183.024) (-1181.668) (-1183.786) [-1181.209] -- 0:00:44
287000 -- (-1183.036) (-1183.768) [-1184.672] (-1190.287) * (-1180.978) (-1183.107) [-1183.651] (-1182.604) -- 0:00:44
287500 -- [-1180.801] (-1182.617) (-1182.709) (-1181.754) * [-1181.886] (-1181.488) (-1184.471) (-1183.221) -- 0:00:44
288000 -- [-1182.367] (-1182.335) (-1182.598) (-1181.949) * [-1180.685] (-1183.984) (-1182.308) (-1185.225) -- 0:00:44
288500 -- (-1187.221) [-1184.014] (-1182.924) (-1186.143) * (-1180.783) (-1185.694) [-1181.076] (-1183.136) -- 0:00:44
289000 -- (-1187.267) (-1182.374) (-1183.966) [-1182.056] * [-1180.885] (-1181.968) (-1183.422) (-1182.682) -- 0:00:44
289500 -- (-1187.177) (-1183.588) (-1185.087) [-1183.142] * (-1183.090) (-1181.254) [-1182.658] (-1182.456) -- 0:00:44
290000 -- (-1182.668) [-1187.691] (-1186.410) (-1184.704) * (-1182.707) [-1181.325] (-1184.592) (-1184.462) -- 0:00:44
Average standard deviation of split frequencies: 0.012402
290500 -- (-1182.977) [-1181.994] (-1180.772) (-1182.375) * (-1181.069) (-1181.732) (-1182.385) [-1181.964] -- 0:00:43
291000 -- (-1183.061) (-1181.184) (-1184.374) [-1181.353] * (-1183.095) [-1184.258] (-1183.622) (-1181.206) -- 0:00:43
291500 -- (-1181.403) [-1181.951] (-1183.009) (-1181.246) * (-1182.377) (-1184.820) (-1186.873) [-1180.798] -- 0:00:43
292000 -- (-1181.106) (-1182.089) (-1184.865) [-1180.896] * (-1181.654) (-1183.980) [-1184.703] (-1181.511) -- 0:00:43
292500 -- (-1183.195) [-1185.094] (-1186.001) (-1181.074) * (-1184.578) (-1181.783) (-1182.453) [-1181.122] -- 0:00:43
293000 -- (-1183.989) (-1186.826) (-1181.293) [-1183.638] * [-1182.008] (-1181.382) (-1183.182) (-1181.410) -- 0:00:45
293500 -- [-1181.715] (-1185.385) (-1181.690) (-1182.097) * (-1183.233) [-1182.642] (-1181.948) (-1182.498) -- 0:00:45
294000 -- (-1182.317) (-1183.466) [-1180.491] (-1182.067) * (-1183.231) (-1184.214) (-1183.314) [-1183.359] -- 0:00:45
294500 -- [-1181.995] (-1183.623) (-1180.871) (-1182.157) * (-1180.557) [-1181.397] (-1182.263) (-1186.032) -- 0:00:45
295000 -- (-1182.540) (-1184.632) (-1182.155) [-1181.154] * (-1182.454) (-1181.024) (-1184.178) [-1185.023] -- 0:00:45
Average standard deviation of split frequencies: 0.012366
295500 -- [-1181.345] (-1185.360) (-1182.474) (-1186.313) * (-1186.807) (-1183.920) [-1181.348] (-1182.069) -- 0:00:45
296000 -- (-1181.722) (-1182.625) [-1181.391] (-1186.221) * (-1184.421) (-1183.259) (-1182.776) [-1182.481] -- 0:00:45
296500 -- (-1185.380) (-1181.924) [-1183.765] (-1183.382) * (-1182.582) [-1183.606] (-1185.177) (-1184.661) -- 0:00:45
297000 -- (-1183.645) [-1181.974] (-1181.956) (-1185.643) * (-1180.630) (-1183.603) [-1183.977] (-1184.231) -- 0:00:44
297500 -- (-1182.453) (-1185.737) [-1184.761] (-1182.901) * [-1181.501] (-1183.963) (-1181.542) (-1182.553) -- 0:00:44
298000 -- (-1182.284) (-1183.115) (-1184.059) [-1183.033] * (-1182.439) (-1181.801) [-1181.382] (-1183.643) -- 0:00:44
298500 -- (-1183.296) (-1181.457) [-1186.327] (-1186.353) * [-1181.243] (-1183.836) (-1183.355) (-1183.204) -- 0:00:44
299000 -- (-1183.858) (-1182.835) (-1183.369) [-1183.044] * (-1185.167) (-1184.899) [-1182.835] (-1183.430) -- 0:00:44
299500 -- (-1184.007) [-1181.314] (-1180.637) (-1185.317) * [-1186.176] (-1181.223) (-1182.765) (-1183.839) -- 0:00:44
300000 -- (-1186.850) [-1181.213] (-1181.365) (-1180.461) * (-1180.614) (-1181.403) [-1182.030] (-1184.521) -- 0:00:44
Average standard deviation of split frequencies: 0.011857
300500 -- (-1183.948) [-1182.991] (-1181.794) (-1186.996) * (-1180.547) (-1183.962) [-1183.343] (-1183.462) -- 0:00:44
301000 -- [-1183.178] (-1181.213) (-1183.489) (-1182.394) * [-1182.983] (-1180.590) (-1184.271) (-1183.688) -- 0:00:44
301500 -- [-1183.036] (-1181.229) (-1183.610) (-1185.641) * (-1181.990) [-1181.770] (-1183.725) (-1184.741) -- 0:00:44
302000 -- (-1184.143) (-1181.229) [-1182.985] (-1182.867) * [-1181.836] (-1181.703) (-1181.632) (-1182.055) -- 0:00:43
302500 -- [-1183.917] (-1181.948) (-1186.890) (-1180.864) * (-1184.244) [-1180.604] (-1182.782) (-1181.452) -- 0:00:43
303000 -- [-1182.019] (-1181.675) (-1183.960) (-1180.680) * (-1180.925) (-1181.497) (-1181.719) [-1182.437] -- 0:00:43
303500 -- (-1181.474) (-1181.675) (-1181.304) [-1182.965] * [-1180.809] (-1182.358) (-1183.418) (-1187.145) -- 0:00:43
304000 -- [-1180.781] (-1182.816) (-1182.960) (-1182.189) * (-1182.197) [-1183.603] (-1183.606) (-1183.929) -- 0:00:43
304500 -- (-1181.178) (-1182.596) [-1182.336] (-1181.697) * (-1180.604) (-1181.519) (-1183.909) [-1184.905] -- 0:00:43
305000 -- (-1185.098) (-1184.645) (-1182.977) [-1184.316] * [-1181.976] (-1181.757) (-1181.257) (-1183.260) -- 0:00:43
Average standard deviation of split frequencies: 0.012730
305500 -- [-1183.862] (-1183.739) (-1182.144) (-1184.600) * (-1182.664) [-1181.711] (-1180.618) (-1183.363) -- 0:00:43
306000 -- (-1184.251) (-1181.878) [-1181.008] (-1184.511) * (-1181.066) (-1180.661) [-1180.289] (-1182.727) -- 0:00:43
306500 -- (-1189.552) [-1180.515] (-1184.048) (-1185.380) * (-1181.642) (-1185.496) (-1180.289) [-1182.208] -- 0:00:42
307000 -- (-1187.958) (-1186.276) (-1186.315) [-1181.737] * [-1181.755] (-1181.783) (-1181.042) (-1182.417) -- 0:00:42
307500 -- (-1187.890) (-1186.462) (-1183.518) [-1182.644] * [-1180.709] (-1183.817) (-1184.803) (-1180.584) -- 0:00:42
308000 -- (-1183.987) (-1182.395) [-1184.202] (-1180.967) * (-1183.573) [-1186.969] (-1187.352) (-1186.359) -- 0:00:42
308500 -- [-1185.248] (-1182.101) (-1183.791) (-1184.350) * (-1186.473) [-1180.870] (-1181.128) (-1184.544) -- 0:00:42
309000 -- (-1184.533) [-1181.577] (-1185.185) (-1184.249) * [-1183.904] (-1181.673) (-1192.682) (-1185.536) -- 0:00:44
309500 -- (-1182.497) (-1182.146) [-1182.571] (-1182.045) * (-1183.088) (-1181.699) (-1183.247) [-1181.048] -- 0:00:44
310000 -- [-1183.231] (-1184.621) (-1181.786) (-1181.640) * (-1181.362) (-1183.161) [-1181.717] (-1181.226) -- 0:00:44
Average standard deviation of split frequencies: 0.011157
310500 -- (-1181.292) [-1183.604] (-1181.216) (-1182.882) * (-1182.998) (-1184.015) (-1181.582) [-1183.287] -- 0:00:44
311000 -- (-1181.785) (-1182.701) [-1182.949] (-1183.697) * (-1187.018) [-1181.169] (-1182.008) (-1188.409) -- 0:00:44
311500 -- (-1184.642) [-1181.956] (-1181.224) (-1182.084) * (-1180.924) (-1186.291) (-1182.617) [-1181.891] -- 0:00:44
312000 -- (-1183.052) (-1182.295) [-1183.060] (-1184.214) * (-1182.651) [-1181.554] (-1183.329) (-1181.345) -- 0:00:44
312500 -- (-1182.752) (-1187.568) (-1183.892) [-1181.706] * (-1184.141) (-1181.041) (-1184.706) [-1180.896] -- 0:00:44
313000 -- (-1181.753) (-1183.369) [-1183.359] (-1181.821) * (-1184.111) [-1181.353] (-1182.621) (-1182.132) -- 0:00:43
313500 -- (-1183.564) (-1182.743) (-1182.853) [-1181.234] * (-1182.735) [-1181.650] (-1184.489) (-1181.859) -- 0:00:43
314000 -- (-1185.191) [-1181.659] (-1182.883) (-1181.058) * (-1181.203) (-1181.299) (-1183.902) [-1180.752] -- 0:00:43
314500 -- [-1183.015] (-1183.337) (-1182.803) (-1181.141) * [-1180.798] (-1182.599) (-1185.737) (-1181.282) -- 0:00:43
315000 -- (-1181.406) [-1184.461] (-1182.623) (-1182.205) * (-1181.957) (-1184.314) [-1184.710] (-1180.462) -- 0:00:43
Average standard deviation of split frequencies: 0.011671
315500 -- (-1184.883) (-1183.263) [-1182.064] (-1183.625) * [-1181.803] (-1182.379) (-1186.679) (-1180.465) -- 0:00:43
316000 -- (-1183.234) (-1183.309) [-1181.172] (-1185.749) * (-1185.894) [-1181.156] (-1182.678) (-1182.671) -- 0:00:43
316500 -- (-1181.956) (-1183.182) (-1180.911) [-1181.668] * (-1183.302) [-1181.559] (-1180.971) (-1181.375) -- 0:00:43
317000 -- (-1180.947) (-1182.026) (-1181.483) [-1182.057] * (-1183.844) (-1185.105) [-1184.377] (-1181.974) -- 0:00:43
317500 -- (-1182.219) (-1181.751) [-1181.365] (-1183.116) * (-1181.346) (-1185.368) (-1183.626) [-1182.114] -- 0:00:42
318000 -- (-1182.193) (-1184.378) [-1183.778] (-1182.028) * (-1182.104) [-1184.674] (-1182.694) (-1183.202) -- 0:00:42
318500 -- [-1181.917] (-1183.133) (-1183.757) (-1186.211) * [-1181.681] (-1181.520) (-1181.608) (-1184.584) -- 0:00:42
319000 -- (-1185.449) (-1182.665) [-1182.824] (-1183.167) * (-1181.456) [-1180.875] (-1184.086) (-1185.811) -- 0:00:42
319500 -- (-1181.275) (-1181.391) (-1184.647) [-1182.465] * (-1182.352) (-1183.404) [-1182.117] (-1182.237) -- 0:00:42
320000 -- (-1182.903) [-1182.916] (-1183.370) (-1180.973) * (-1182.596) [-1182.445] (-1182.128) (-1182.170) -- 0:00:42
Average standard deviation of split frequencies: 0.011209
320500 -- (-1182.533) [-1185.792] (-1183.397) (-1181.069) * (-1182.297) [-1182.056] (-1182.695) (-1180.328) -- 0:00:42
321000 -- [-1181.584] (-1185.294) (-1186.906) (-1183.601) * (-1183.231) (-1182.038) (-1184.697) [-1180.869] -- 0:00:42
321500 -- (-1182.051) (-1185.469) (-1181.123) [-1183.491] * [-1182.017] (-1181.649) (-1186.641) (-1182.447) -- 0:00:42
322000 -- (-1181.533) (-1183.374) [-1182.116] (-1182.312) * (-1183.283) (-1183.925) [-1183.694] (-1182.467) -- 0:00:42
322500 -- (-1183.026) (-1183.657) (-1180.977) [-1181.523] * [-1183.252] (-1183.350) (-1185.500) (-1182.768) -- 0:00:42
323000 -- (-1184.191) (-1181.907) [-1183.822] (-1182.426) * [-1182.223] (-1182.584) (-1181.804) (-1181.891) -- 0:00:41
323500 -- [-1183.350] (-1184.422) (-1182.828) (-1181.186) * [-1182.745] (-1181.487) (-1182.103) (-1182.982) -- 0:00:41
324000 -- (-1182.322) (-1183.343) (-1187.635) [-1182.633] * [-1182.257] (-1181.415) (-1181.672) (-1182.826) -- 0:00:41
324500 -- (-1180.780) [-1181.876] (-1183.768) (-1184.276) * (-1181.571) [-1181.556] (-1182.440) (-1184.529) -- 0:00:41
325000 -- (-1186.208) (-1181.267) [-1182.390] (-1182.809) * (-1182.091) (-1181.580) [-1181.802] (-1182.134) -- 0:00:41
Average standard deviation of split frequencies: 0.011568
325500 -- (-1182.588) (-1183.602) (-1184.132) [-1181.759] * (-1182.372) (-1184.152) (-1183.937) [-1181.686] -- 0:00:43
326000 -- (-1182.187) (-1187.035) [-1183.354] (-1182.979) * [-1182.214] (-1188.460) (-1184.558) (-1184.348) -- 0:00:43
326500 -- (-1181.355) (-1186.052) [-1183.735] (-1182.271) * (-1184.267) [-1182.138] (-1182.913) (-1183.763) -- 0:00:43
327000 -- [-1182.630] (-1182.007) (-1183.606) (-1184.904) * (-1188.091) (-1182.878) (-1183.051) [-1182.029] -- 0:00:43
327500 -- (-1181.998) (-1181.042) (-1182.670) [-1183.131] * (-1183.335) (-1182.734) (-1181.909) [-1180.532] -- 0:00:43
328000 -- [-1180.695] (-1186.564) (-1185.353) (-1184.494) * (-1184.946) [-1181.705] (-1183.303) (-1180.991) -- 0:00:43
328500 -- (-1182.601) (-1184.392) (-1184.973) [-1187.277] * (-1184.279) [-1184.232] (-1183.283) (-1182.508) -- 0:00:42
329000 -- (-1182.297) (-1184.381) [-1186.805] (-1184.725) * (-1183.636) [-1181.421] (-1185.245) (-1181.740) -- 0:00:42
329500 -- [-1182.944] (-1181.935) (-1183.122) (-1182.176) * (-1181.019) (-1181.728) (-1185.217) [-1183.632] -- 0:00:42
330000 -- (-1191.418) (-1181.552) [-1182.751] (-1181.263) * (-1180.495) (-1181.647) [-1181.245] (-1183.930) -- 0:00:42
Average standard deviation of split frequencies: 0.011563
330500 -- (-1185.174) [-1181.893] (-1181.991) (-1182.612) * (-1181.405) [-1185.870] (-1182.051) (-1180.536) -- 0:00:42
331000 -- [-1183.078] (-1182.645) (-1182.327) (-1181.410) * (-1181.160) (-1182.952) (-1182.520) [-1181.991] -- 0:00:42
331500 -- [-1182.064] (-1183.088) (-1180.950) (-1181.796) * (-1185.576) [-1181.495] (-1181.585) (-1182.426) -- 0:00:42
332000 -- (-1189.677) [-1183.322] (-1181.874) (-1181.745) * [-1183.868] (-1184.024) (-1187.778) (-1180.783) -- 0:00:42
332500 -- [-1180.451] (-1184.453) (-1181.771) (-1180.916) * (-1181.405) [-1181.145] (-1181.237) (-1182.065) -- 0:00:42
333000 -- (-1180.597) [-1183.556] (-1185.811) (-1184.613) * [-1181.466] (-1181.952) (-1181.397) (-1182.872) -- 0:00:42
333500 -- (-1180.617) (-1181.295) (-1186.558) [-1184.826] * (-1181.183) [-1181.575] (-1181.124) (-1182.237) -- 0:00:41
334000 -- [-1180.615] (-1181.973) (-1183.438) (-1184.484) * (-1182.723) [-1184.067] (-1183.668) (-1184.482) -- 0:00:41
334500 -- [-1185.107] (-1180.629) (-1182.083) (-1193.673) * (-1182.992) (-1182.175) (-1182.913) [-1183.207] -- 0:00:41
335000 -- (-1188.042) [-1183.227] (-1183.003) (-1181.270) * (-1181.593) (-1184.141) (-1181.422) [-1184.141] -- 0:00:41
Average standard deviation of split frequencies: 0.012549
335500 -- (-1182.965) (-1181.487) [-1182.519] (-1188.453) * (-1182.741) (-1183.554) [-1181.748] (-1183.918) -- 0:00:41
336000 -- (-1183.516) (-1181.276) (-1182.559) [-1181.858] * [-1181.393] (-1183.923) (-1181.439) (-1182.912) -- 0:00:41
336500 -- (-1183.881) (-1182.565) (-1182.169) [-1184.263] * (-1181.901) [-1182.380] (-1185.777) (-1182.772) -- 0:00:41
337000 -- (-1184.629) (-1182.764) (-1183.654) [-1181.335] * [-1181.718] (-1185.234) (-1187.231) (-1185.017) -- 0:00:41
337500 -- (-1185.390) (-1181.488) (-1183.511) [-1182.276] * (-1183.104) [-1183.293] (-1185.430) (-1181.748) -- 0:00:41
338000 -- (-1184.355) (-1181.313) [-1185.125] (-1183.234) * (-1182.169) (-1183.371) (-1183.003) [-1185.929] -- 0:00:41
338500 -- (-1182.318) (-1183.832) [-1181.457] (-1180.804) * (-1182.057) [-1182.870] (-1182.767) (-1185.236) -- 0:00:41
339000 -- (-1183.260) [-1183.830] (-1181.990) (-1181.717) * (-1181.083) [-1183.871] (-1182.729) (-1183.796) -- 0:00:40
339500 -- (-1190.270) (-1182.947) (-1181.991) [-1181.772] * (-1181.989) [-1182.669] (-1184.196) (-1181.202) -- 0:00:40
340000 -- (-1187.906) (-1184.040) (-1182.740) [-1184.768] * (-1181.337) (-1189.030) (-1182.915) [-1181.305] -- 0:00:40
Average standard deviation of split frequencies: 0.012070
340500 -- (-1183.917) (-1183.989) (-1187.233) [-1181.735] * (-1185.599) (-1184.144) [-1181.701] (-1182.978) -- 0:00:40
341000 -- (-1181.881) [-1180.605] (-1183.902) (-1183.807) * (-1184.435) (-1184.082) [-1181.171] (-1181.092) -- 0:00:40
341500 -- (-1180.367) (-1180.846) (-1185.091) [-1183.445] * (-1185.363) (-1184.313) (-1183.599) [-1181.427] -- 0:00:42
342000 -- (-1180.618) (-1180.708) [-1182.125] (-1184.834) * (-1183.037) (-1185.216) (-1183.686) [-1181.699] -- 0:00:42
342500 -- [-1181.313] (-1181.133) (-1185.662) (-1181.822) * (-1180.776) (-1181.851) [-1184.999] (-1185.616) -- 0:00:42
343000 -- (-1181.684) (-1182.618) (-1181.068) [-1182.848] * (-1180.976) [-1181.495] (-1182.102) (-1183.953) -- 0:00:42
343500 -- (-1182.214) [-1183.092] (-1183.860) (-1181.787) * (-1182.926) [-1180.865] (-1182.700) (-1181.935) -- 0:00:42
344000 -- (-1182.124) [-1181.731] (-1183.505) (-1184.015) * (-1184.697) [-1181.944] (-1182.950) (-1180.627) -- 0:00:41
344500 -- (-1181.022) [-1181.191] (-1183.156) (-1184.280) * (-1182.937) (-1180.953) (-1188.592) [-1180.720] -- 0:00:41
345000 -- (-1180.972) [-1182.763] (-1181.994) (-1183.799) * (-1183.697) (-1181.103) [-1183.200] (-1182.288) -- 0:00:41
Average standard deviation of split frequencies: 0.012477
345500 -- [-1180.926] (-1187.305) (-1180.831) (-1183.959) * (-1183.662) (-1181.621) [-1183.471] (-1182.046) -- 0:00:41
346000 -- (-1181.491) [-1183.089] (-1181.858) (-1181.849) * (-1183.458) (-1181.369) [-1181.751] (-1181.170) -- 0:00:41
346500 -- (-1182.527) (-1182.944) (-1184.841) [-1181.937] * (-1185.134) (-1182.659) [-1181.221] (-1181.380) -- 0:00:41
347000 -- (-1183.194) (-1182.947) [-1181.303] (-1185.284) * (-1183.424) (-1182.612) (-1185.440) [-1181.368] -- 0:00:41
347500 -- (-1184.397) (-1186.454) (-1185.003) [-1182.243] * (-1183.247) (-1183.642) [-1185.655] (-1183.040) -- 0:00:41
348000 -- (-1180.667) (-1186.054) [-1183.583] (-1181.188) * (-1181.753) [-1185.115] (-1182.502) (-1182.531) -- 0:00:41
348500 -- [-1182.033] (-1184.037) (-1182.150) (-1182.285) * (-1182.602) [-1190.226] (-1182.227) (-1192.951) -- 0:00:41
349000 -- (-1182.555) [-1184.357] (-1182.032) (-1181.798) * (-1183.487) (-1182.461) [-1180.784] (-1184.664) -- 0:00:41
349500 -- (-1182.503) (-1184.134) [-1184.580] (-1182.401) * [-1181.087] (-1181.337) (-1183.554) (-1181.079) -- 0:00:40
350000 -- (-1184.077) (-1184.219) [-1183.607] (-1182.070) * (-1182.242) (-1181.015) (-1180.858) [-1181.127] -- 0:00:40
Average standard deviation of split frequencies: 0.011725
350500 -- (-1184.699) (-1184.143) (-1182.819) [-1180.461] * [-1181.864] (-1181.913) (-1181.762) (-1182.956) -- 0:00:40
351000 -- (-1183.659) (-1189.102) (-1181.474) [-1181.784] * (-1183.601) (-1181.836) (-1181.762) [-1184.568] -- 0:00:40
351500 -- (-1182.279) [-1181.574] (-1181.534) (-1185.778) * (-1181.571) (-1184.639) [-1181.296] (-1181.687) -- 0:00:40
352000 -- (-1184.236) [-1182.954] (-1183.254) (-1182.462) * (-1180.837) (-1183.875) [-1183.131] (-1182.946) -- 0:00:40
352500 -- (-1184.571) [-1181.179] (-1183.244) (-1185.668) * (-1180.891) [-1181.435] (-1181.880) (-1188.380) -- 0:00:40
353000 -- (-1182.437) [-1181.151] (-1182.486) (-1185.755) * (-1181.844) (-1181.537) [-1184.121] (-1185.292) -- 0:00:40
353500 -- (-1187.992) [-1181.585] (-1181.993) (-1187.880) * (-1183.242) (-1181.521) (-1181.157) [-1183.990] -- 0:00:40
354000 -- [-1181.742] (-1182.024) (-1181.866) (-1182.990) * [-1186.779] (-1181.674) (-1181.438) (-1182.355) -- 0:00:40
354500 -- [-1181.398] (-1182.032) (-1183.496) (-1183.333) * (-1181.034) (-1184.112) [-1184.885] (-1183.535) -- 0:00:40
355000 -- [-1184.996] (-1180.907) (-1181.991) (-1181.847) * (-1184.634) [-1182.289] (-1181.213) (-1181.690) -- 0:00:39
Average standard deviation of split frequencies: 0.011697
355500 -- (-1181.802) [-1181.037] (-1185.122) (-1181.510) * (-1181.551) [-1181.072] (-1180.944) (-1181.971) -- 0:00:39
356000 -- [-1181.473] (-1181.417) (-1183.461) (-1183.259) * (-1182.414) (-1181.508) [-1182.420] (-1184.175) -- 0:00:39
356500 -- (-1181.742) (-1183.151) (-1186.630) [-1183.281] * [-1183.317] (-1180.323) (-1181.023) (-1182.941) -- 0:00:39
357000 -- (-1185.867) (-1182.923) (-1181.446) [-1182.182] * (-1184.973) [-1181.562] (-1182.407) (-1182.874) -- 0:00:39
357500 -- (-1189.667) (-1183.489) [-1181.299] (-1182.683) * (-1185.524) (-1181.339) [-1185.487] (-1180.973) -- 0:00:39
358000 -- (-1184.687) (-1185.489) [-1183.236] (-1182.691) * (-1185.373) [-1183.044] (-1181.368) (-1183.031) -- 0:00:41
358500 -- [-1182.121] (-1181.600) (-1183.676) (-1181.952) * (-1182.616) [-1184.151] (-1181.629) (-1182.725) -- 0:00:41
359000 -- (-1180.486) [-1182.788] (-1182.213) (-1183.727) * (-1182.111) [-1181.736] (-1181.346) (-1185.585) -- 0:00:41
359500 -- (-1180.918) (-1182.801) [-1182.584] (-1188.068) * (-1180.635) (-1181.529) [-1181.362] (-1183.668) -- 0:00:40
360000 -- (-1184.424) [-1183.197] (-1181.146) (-1190.734) * (-1183.411) [-1180.452] (-1182.139) (-1187.778) -- 0:00:40
Average standard deviation of split frequencies: 0.010918
360500 -- [-1184.948] (-1182.501) (-1186.337) (-1184.496) * [-1184.317] (-1182.234) (-1182.184) (-1187.501) -- 0:00:40
361000 -- (-1181.893) [-1181.085] (-1183.415) (-1182.066) * (-1183.353) (-1185.113) [-1182.259] (-1184.408) -- 0:00:40
361500 -- [-1181.754] (-1181.044) (-1181.294) (-1182.748) * (-1183.683) (-1182.078) [-1180.738] (-1181.786) -- 0:00:40
362000 -- (-1182.816) [-1183.718] (-1183.343) (-1184.968) * (-1181.044) (-1185.515) (-1180.947) [-1187.295] -- 0:00:40
362500 -- (-1183.881) [-1181.094] (-1182.524) (-1181.828) * (-1181.664) (-1182.387) [-1181.699] (-1181.499) -- 0:00:40
363000 -- (-1181.980) (-1181.320) (-1182.842) [-1186.116] * (-1181.642) (-1182.324) (-1181.679) [-1183.955] -- 0:00:40
363500 -- (-1181.641) [-1182.436] (-1185.021) (-1186.134) * [-1184.303] (-1182.162) (-1183.963) (-1185.331) -- 0:00:40
364000 -- [-1183.129] (-1181.467) (-1181.848) (-1184.002) * (-1180.723) (-1181.646) [-1182.069] (-1187.487) -- 0:00:40
364500 -- (-1186.152) (-1182.598) [-1182.930] (-1184.761) * (-1184.216) [-1182.522] (-1182.215) (-1182.416) -- 0:00:40
365000 -- (-1185.754) (-1182.146) [-1180.957] (-1181.225) * (-1182.093) [-1181.635] (-1185.451) (-1183.141) -- 0:00:40
Average standard deviation of split frequencies: 0.012122
365500 -- (-1182.429) (-1182.340) (-1182.378) [-1181.919] * (-1182.126) [-1183.734] (-1181.593) (-1181.665) -- 0:00:39
366000 -- (-1184.934) [-1181.049] (-1184.596) (-1181.923) * (-1181.076) [-1183.515] (-1183.312) (-1180.769) -- 0:00:39
366500 -- (-1183.426) (-1181.735) (-1181.886) [-1182.477] * (-1181.500) (-1182.562) (-1181.732) [-1180.837] -- 0:00:39
367000 -- (-1182.937) (-1183.177) (-1188.069) [-1184.000] * (-1183.337) (-1181.460) (-1181.612) [-1180.831] -- 0:00:39
367500 -- (-1183.344) (-1184.975) (-1185.013) [-1182.251] * [-1183.924] (-1181.918) (-1181.779) (-1182.752) -- 0:00:39
368000 -- (-1184.957) (-1182.430) [-1182.385] (-1181.931) * (-1183.317) (-1182.950) [-1181.831] (-1190.435) -- 0:00:39
368500 -- (-1183.412) (-1188.772) [-1181.308] (-1181.964) * (-1181.209) (-1185.918) (-1185.189) [-1183.035] -- 0:00:39
369000 -- (-1184.634) (-1182.139) [-1182.765] (-1182.419) * (-1180.889) (-1184.427) (-1183.911) [-1182.329] -- 0:00:39
369500 -- [-1181.071] (-1180.809) (-1182.402) (-1181.822) * (-1183.993) (-1184.248) [-1181.911] (-1181.935) -- 0:00:39
370000 -- (-1181.478) [-1180.610] (-1182.002) (-1182.232) * [-1181.884] (-1181.341) (-1181.011) (-1180.953) -- 0:00:39
Average standard deviation of split frequencies: 0.010333
370500 -- (-1181.821) [-1183.339] (-1184.270) (-1182.653) * (-1181.653) [-1181.565] (-1180.737) (-1181.300) -- 0:00:39
371000 -- (-1182.249) (-1181.626) [-1183.393] (-1183.200) * (-1181.521) [-1180.526] (-1182.522) (-1184.398) -- 0:00:38
371500 -- (-1183.271) (-1186.376) (-1181.832) [-1181.872] * (-1183.974) [-1180.822] (-1183.225) (-1180.452) -- 0:00:38
372000 -- (-1181.686) [-1183.205] (-1181.220) (-1181.661) * (-1182.663) (-1181.580) (-1187.068) [-1180.585] -- 0:00:38
372500 -- (-1185.630) (-1181.606) [-1182.431] (-1180.713) * (-1182.705) [-1180.715] (-1184.604) (-1182.440) -- 0:00:38
373000 -- [-1183.342] (-1184.934) (-1182.054) (-1184.221) * [-1180.744] (-1183.224) (-1183.567) (-1186.244) -- 0:00:38
373500 -- (-1183.645) (-1184.943) (-1182.340) [-1182.861] * (-1181.878) (-1185.597) [-1182.747] (-1183.956) -- 0:00:40
374000 -- [-1183.768] (-1183.672) (-1183.179) (-1183.147) * (-1182.596) [-1180.802] (-1182.552) (-1185.884) -- 0:00:40
374500 -- (-1182.067) (-1185.188) [-1183.316] (-1183.060) * (-1181.505) [-1182.047] (-1181.940) (-1181.226) -- 0:00:40
375000 -- [-1184.000] (-1181.647) (-1181.857) (-1181.730) * (-1180.925) (-1182.952) [-1181.176] (-1181.765) -- 0:00:40
Average standard deviation of split frequencies: 0.010735
375500 -- [-1186.132] (-1182.370) (-1184.150) (-1183.686) * [-1181.403] (-1182.715) (-1182.491) (-1182.238) -- 0:00:39
376000 -- (-1181.670) (-1182.084) (-1183.728) [-1181.389] * (-1181.371) [-1181.322] (-1181.303) (-1182.269) -- 0:00:39
376500 -- (-1184.110) [-1182.720] (-1183.874) (-1184.258) * (-1181.466) [-1182.585] (-1181.716) (-1181.971) -- 0:00:39
377000 -- (-1189.274) (-1184.430) [-1181.514] (-1185.917) * (-1184.148) (-1185.034) (-1186.441) [-1184.051] -- 0:00:39
377500 -- (-1183.446) (-1182.519) [-1181.833] (-1180.825) * (-1184.357) (-1181.532) [-1181.639] (-1183.560) -- 0:00:39
378000 -- (-1182.551) (-1181.233) (-1183.689) [-1181.070] * (-1181.628) (-1181.675) [-1181.601] (-1192.374) -- 0:00:39
378500 -- (-1181.873) (-1182.234) [-1182.187] (-1181.960) * (-1181.686) [-1182.421] (-1183.911) (-1182.958) -- 0:00:39
379000 -- [-1183.549] (-1183.071) (-1181.432) (-1182.400) * (-1182.157) [-1182.885] (-1182.388) (-1184.662) -- 0:00:39
379500 -- (-1184.392) (-1186.125) [-1186.630] (-1185.046) * [-1182.782] (-1181.644) (-1182.748) (-1182.125) -- 0:00:39
380000 -- [-1183.208] (-1182.036) (-1182.310) (-1187.284) * (-1183.894) (-1185.795) [-1180.957] (-1185.489) -- 0:00:39
Average standard deviation of split frequencies: 0.009907
380500 -- (-1182.328) (-1181.482) (-1180.887) [-1182.812] * [-1184.538] (-1182.056) (-1184.176) (-1184.194) -- 0:00:39
381000 -- (-1180.454) (-1181.533) (-1181.657) [-1181.950] * (-1182.073) [-1183.027] (-1183.460) (-1180.893) -- 0:00:38
381500 -- (-1182.532) (-1182.497) (-1182.734) [-1182.501] * (-1181.827) (-1181.726) (-1184.211) [-1180.845] -- 0:00:38
382000 -- (-1180.966) (-1185.522) (-1182.010) [-1181.369] * (-1182.585) (-1181.909) (-1182.399) [-1181.454] -- 0:00:38
382500 -- (-1184.205) [-1183.414] (-1180.572) (-1181.022) * (-1182.708) [-1181.696] (-1180.458) (-1182.698) -- 0:00:38
383000 -- (-1184.428) (-1181.941) (-1180.732) [-1182.981] * (-1181.763) [-1183.091] (-1187.305) (-1180.748) -- 0:00:38
383500 -- (-1183.323) (-1181.276) [-1181.810] (-1184.638) * [-1183.205] (-1181.461) (-1184.157) (-1183.779) -- 0:00:38
384000 -- (-1184.238) [-1181.229] (-1181.582) (-1184.087) * [-1180.316] (-1182.301) (-1187.234) (-1182.714) -- 0:00:38
384500 -- [-1182.674] (-1181.261) (-1180.898) (-1181.674) * (-1185.609) [-1181.850] (-1187.922) (-1183.710) -- 0:00:38
385000 -- (-1180.872) (-1182.073) (-1181.708) [-1182.194] * [-1186.523] (-1182.207) (-1181.366) (-1181.926) -- 0:00:38
Average standard deviation of split frequencies: 0.009312
385500 -- (-1181.090) [-1181.885] (-1187.154) (-1181.430) * (-1185.846) [-1182.358] (-1185.879) (-1184.210) -- 0:00:38
386000 -- (-1180.606) (-1186.302) (-1182.172) [-1182.376] * [-1184.110] (-1189.229) (-1182.077) (-1182.938) -- 0:00:38
386500 -- (-1180.491) [-1183.081] (-1181.962) (-1183.134) * (-1181.930) (-1181.253) [-1181.465] (-1183.240) -- 0:00:38
387000 -- (-1181.890) (-1182.197) [-1181.418] (-1184.622) * [-1180.305] (-1182.173) (-1182.207) (-1181.716) -- 0:00:38
387500 -- (-1182.723) [-1183.996] (-1189.819) (-1182.325) * [-1181.580] (-1183.801) (-1181.571) (-1181.566) -- 0:00:37
388000 -- (-1182.351) [-1183.726] (-1185.971) (-1181.003) * (-1183.487) (-1181.203) [-1181.555] (-1181.336) -- 0:00:37
388500 -- (-1182.912) (-1181.271) [-1182.247] (-1182.806) * (-1182.385) (-1182.139) [-1182.916] (-1181.610) -- 0:00:37
389000 -- [-1181.280] (-1183.996) (-1181.423) (-1183.762) * [-1182.880] (-1182.136) (-1183.358) (-1181.056) -- 0:00:39
389500 -- (-1182.191) [-1185.751] (-1181.418) (-1183.871) * (-1183.287) (-1182.157) [-1184.645] (-1181.140) -- 0:00:39
390000 -- [-1182.595] (-1181.511) (-1182.305) (-1183.020) * [-1183.934] (-1182.567) (-1187.996) (-1181.703) -- 0:00:39
Average standard deviation of split frequencies: 0.010332
390500 -- (-1182.716) (-1187.048) (-1185.505) [-1180.992] * (-1182.770) [-1183.789] (-1182.414) (-1182.291) -- 0:00:39
391000 -- (-1182.177) (-1185.509) (-1184.002) [-1180.575] * (-1183.029) (-1182.101) (-1182.700) [-1182.222] -- 0:00:38
391500 -- (-1183.043) [-1185.554] (-1182.534) (-1180.713) * (-1186.833) (-1182.406) [-1180.733] (-1182.123) -- 0:00:38
392000 -- (-1182.952) [-1181.245] (-1180.332) (-1182.368) * (-1181.112) (-1186.087) (-1181.441) [-1180.815] -- 0:00:38
392500 -- [-1180.965] (-1182.226) (-1191.063) (-1181.715) * (-1181.679) (-1181.224) [-1182.050] (-1181.864) -- 0:00:38
393000 -- (-1181.223) (-1180.863) (-1181.640) [-1182.181] * (-1181.367) (-1183.962) (-1180.868) [-1180.515] -- 0:00:38
393500 -- [-1181.162] (-1180.993) (-1182.475) (-1185.357) * (-1181.977) [-1182.070] (-1184.842) (-1180.515) -- 0:00:38
394000 -- (-1181.345) (-1186.344) [-1182.080] (-1184.414) * (-1183.973) (-1180.306) [-1183.838] (-1181.216) -- 0:00:38
394500 -- (-1180.918) (-1185.876) (-1182.175) [-1182.305] * (-1191.131) [-1180.472] (-1184.353) (-1180.995) -- 0:00:38
395000 -- (-1180.909) [-1181.047] (-1181.784) (-1181.946) * [-1183.830] (-1181.849) (-1182.198) (-1180.978) -- 0:00:38
Average standard deviation of split frequencies: 0.011838
395500 -- (-1182.239) (-1180.979) (-1182.699) [-1180.805] * (-1181.945) (-1182.006) [-1182.823] (-1181.254) -- 0:00:38
396000 -- (-1181.407) [-1181.365] (-1184.193) (-1181.540) * (-1181.919) (-1183.062) (-1180.857) [-1181.485] -- 0:00:38
396500 -- (-1181.122) [-1182.857] (-1181.449) (-1182.748) * (-1182.386) (-1188.799) [-1181.491] (-1182.070) -- 0:00:38
397000 -- (-1181.122) (-1182.120) (-1182.823) [-1181.881] * (-1181.690) [-1180.970] (-1181.107) (-1185.705) -- 0:00:37
397500 -- (-1182.879) [-1180.931] (-1181.679) (-1180.811) * (-1182.624) (-1180.460) [-1181.853] (-1181.711) -- 0:00:37
398000 -- (-1180.911) [-1183.171] (-1181.403) (-1184.395) * [-1182.606] (-1182.049) (-1182.339) (-1182.639) -- 0:00:37
398500 -- (-1184.547) (-1182.608) (-1182.986) [-1184.745] * (-1180.360) [-1180.787] (-1185.322) (-1181.481) -- 0:00:37
399000 -- (-1181.993) [-1181.680] (-1184.107) (-1182.464) * (-1180.288) [-1181.526] (-1182.163) (-1182.043) -- 0:00:37
399500 -- (-1183.034) (-1182.002) (-1188.101) [-1181.380] * [-1180.626] (-1182.285) (-1186.377) (-1182.939) -- 0:00:37
400000 -- [-1182.221] (-1182.164) (-1185.445) (-1184.911) * (-1181.964) (-1182.626) (-1184.162) [-1181.551] -- 0:00:37
Average standard deviation of split frequencies: 0.011004
400500 -- [-1182.918] (-1180.810) (-1184.787) (-1183.284) * (-1184.240) [-1182.754] (-1181.177) (-1182.549) -- 0:00:37
401000 -- (-1183.800) (-1180.836) [-1181.114] (-1183.490) * (-1186.724) (-1182.753) [-1181.115] (-1181.524) -- 0:00:37
401500 -- (-1182.818) [-1181.518] (-1183.585) (-1187.769) * (-1186.537) (-1182.154) (-1182.887) [-1183.494] -- 0:00:37
402000 -- (-1181.894) [-1182.433] (-1186.684) (-1185.096) * (-1186.468) [-1181.916] (-1181.669) (-1186.383) -- 0:00:37
402500 -- [-1180.522] (-1184.336) (-1184.924) (-1183.694) * [-1181.715] (-1182.798) (-1181.101) (-1184.787) -- 0:00:37
403000 -- (-1183.190) (-1182.718) (-1182.473) [-1184.563] * [-1185.363] (-1184.747) (-1183.251) (-1181.975) -- 0:00:37
403500 -- (-1183.547) (-1182.753) [-1183.301] (-1185.012) * [-1183.039] (-1182.263) (-1181.185) (-1182.239) -- 0:00:36
404000 -- (-1188.879) (-1182.754) [-1182.741] (-1181.382) * (-1182.639) (-1183.001) [-1183.539] (-1182.059) -- 0:00:36
404500 -- (-1184.203) (-1185.428) (-1182.295) [-1181.526] * (-1181.744) (-1181.818) (-1183.787) [-1180.607] -- 0:00:36
405000 -- (-1183.764) (-1182.320) [-1183.809] (-1186.868) * (-1181.148) (-1181.534) (-1184.735) [-1183.703] -- 0:00:36
Average standard deviation of split frequencies: 0.011482
405500 -- [-1184.142] (-1182.344) (-1192.359) (-1183.370) * (-1181.590) (-1182.525) [-1181.829] (-1181.087) -- 0:00:38
406000 -- (-1182.876) (-1183.923) (-1185.495) [-1181.151] * (-1180.609) (-1181.370) (-1181.346) [-1180.750] -- 0:00:38
406500 -- (-1183.397) [-1181.157] (-1182.888) (-1183.946) * [-1180.580] (-1181.770) (-1181.654) (-1180.775) -- 0:00:37
407000 -- (-1182.829) (-1183.538) [-1181.825] (-1180.520) * [-1181.594] (-1184.968) (-1180.515) (-1184.507) -- 0:00:37
407500 -- (-1181.375) [-1184.711] (-1183.352) (-1180.384) * (-1184.818) (-1185.288) [-1182.102] (-1182.782) -- 0:00:37
408000 -- (-1181.671) [-1183.118] (-1186.355) (-1181.771) * (-1183.605) (-1182.453) (-1183.016) [-1186.364] -- 0:00:37
408500 -- [-1181.607] (-1183.267) (-1182.565) (-1182.663) * (-1182.618) [-1185.978] (-1181.921) (-1182.277) -- 0:00:37
409000 -- (-1182.592) (-1184.733) [-1181.754] (-1181.578) * [-1182.650] (-1183.888) (-1181.518) (-1182.089) -- 0:00:37
409500 -- (-1183.486) (-1182.022) (-1181.382) [-1182.796] * (-1183.431) (-1184.939) (-1181.430) [-1181.322] -- 0:00:37
410000 -- [-1182.285] (-1186.977) (-1181.460) (-1183.485) * (-1184.546) (-1184.548) [-1185.554] (-1181.805) -- 0:00:37
Average standard deviation of split frequencies: 0.011006
410500 -- (-1182.882) (-1181.685) [-1181.384] (-1181.243) * [-1181.365] (-1183.370) (-1184.092) (-1185.203) -- 0:00:37
411000 -- (-1182.294) [-1181.706] (-1180.505) (-1184.736) * [-1183.134] (-1183.859) (-1185.867) (-1183.985) -- 0:00:37
411500 -- [-1181.775] (-1182.167) (-1182.237) (-1185.537) * (-1184.896) (-1181.196) [-1182.787] (-1181.472) -- 0:00:37
412000 -- [-1181.662] (-1181.384) (-1181.141) (-1185.951) * (-1185.108) [-1180.490] (-1180.981) (-1183.865) -- 0:00:37
412500 -- [-1182.170] (-1183.180) (-1182.152) (-1186.278) * (-1185.756) [-1181.000] (-1182.558) (-1184.571) -- 0:00:37
413000 -- (-1185.873) (-1181.497) (-1183.206) [-1184.387] * (-1182.126) (-1183.067) [-1181.627] (-1182.688) -- 0:00:36
413500 -- [-1183.620] (-1183.433) (-1181.456) (-1183.139) * [-1181.672] (-1182.403) (-1181.869) (-1181.042) -- 0:00:36
414000 -- (-1182.732) (-1183.407) (-1183.304) [-1188.407] * [-1180.207] (-1183.033) (-1181.404) (-1183.589) -- 0:00:36
414500 -- (-1182.732) (-1183.264) [-1183.486] (-1182.359) * [-1182.286] (-1183.192) (-1185.963) (-1183.305) -- 0:00:36
415000 -- [-1180.975] (-1183.064) (-1182.884) (-1180.653) * [-1180.874] (-1184.382) (-1186.362) (-1184.825) -- 0:00:36
Average standard deviation of split frequencies: 0.010932
415500 -- (-1184.893) (-1181.150) (-1181.874) [-1181.089] * [-1183.175] (-1183.076) (-1182.693) (-1184.053) -- 0:00:36
416000 -- (-1185.408) (-1181.471) [-1182.579] (-1185.261) * (-1181.985) [-1181.551] (-1181.271) (-1186.882) -- 0:00:36
416500 -- (-1182.195) (-1181.616) (-1181.923) [-1181.917] * (-1181.838) (-1182.581) [-1182.033] (-1181.767) -- 0:00:36
417000 -- (-1181.183) (-1181.615) (-1182.518) [-1181.260] * [-1181.387] (-1180.802) (-1184.583) (-1182.632) -- 0:00:36
417500 -- (-1182.705) [-1184.950] (-1183.549) (-1183.068) * [-1181.655] (-1181.320) (-1181.600) (-1184.131) -- 0:00:36
418000 -- [-1182.759] (-1184.335) (-1183.249) (-1182.734) * [-1183.851] (-1182.261) (-1181.215) (-1183.004) -- 0:00:36
418500 -- [-1181.961] (-1190.788) (-1184.205) (-1185.994) * (-1182.048) [-1181.479] (-1181.229) (-1182.307) -- 0:00:36
419000 -- (-1186.724) [-1186.049] (-1181.042) (-1181.682) * [-1182.173] (-1184.966) (-1182.590) (-1185.880) -- 0:00:36
419500 -- (-1182.744) [-1183.255] (-1183.017) (-1181.550) * [-1183.123] (-1181.968) (-1183.976) (-1182.375) -- 0:00:35
420000 -- (-1186.991) (-1180.904) (-1182.654) [-1181.460] * (-1182.002) [-1183.724] (-1184.869) (-1186.152) -- 0:00:35
Average standard deviation of split frequencies: 0.011733
420500 -- (-1182.048) (-1182.084) [-1180.454] (-1181.289) * (-1181.970) (-1182.626) [-1184.228] (-1185.213) -- 0:00:35
421000 -- [-1181.423] (-1182.138) (-1184.133) (-1181.550) * (-1182.043) [-1183.218] (-1180.525) (-1184.765) -- 0:00:35
421500 -- (-1184.465) [-1181.488] (-1186.056) (-1181.560) * (-1181.718) (-1182.846) [-1183.974] (-1184.165) -- 0:00:37
422000 -- [-1182.104] (-1183.431) (-1186.705) (-1183.126) * (-1182.112) [-1183.011] (-1181.602) (-1185.476) -- 0:00:36
422500 -- (-1182.984) (-1181.430) (-1183.276) [-1182.857] * (-1182.013) [-1183.493] (-1181.828) (-1185.815) -- 0:00:36
423000 -- (-1181.049) [-1182.233] (-1183.696) (-1183.686) * (-1181.903) [-1182.307] (-1182.927) (-1183.131) -- 0:00:36
423500 -- (-1180.812) (-1181.837) (-1183.713) [-1184.467] * (-1184.115) (-1181.698) [-1181.646] (-1182.290) -- 0:00:36
424000 -- [-1183.563] (-1183.243) (-1181.839) (-1185.165) * (-1181.722) (-1181.638) (-1181.632) [-1180.912] -- 0:00:36
424500 -- (-1181.255) (-1181.237) (-1182.668) [-1181.795] * [-1186.565] (-1185.855) (-1182.440) (-1180.912) -- 0:00:36
425000 -- (-1183.506) (-1181.300) (-1184.557) [-1183.179] * [-1181.510] (-1185.615) (-1182.571) (-1182.213) -- 0:00:36
Average standard deviation of split frequencies: 0.011587
425500 -- (-1182.807) [-1180.938] (-1182.625) (-1184.299) * (-1184.592) [-1187.033] (-1181.092) (-1183.820) -- 0:00:36
426000 -- [-1181.697] (-1181.213) (-1184.034) (-1185.224) * [-1180.587] (-1180.893) (-1182.686) (-1183.097) -- 0:00:36
426500 -- (-1182.481) (-1181.279) [-1183.148] (-1184.928) * (-1181.230) [-1180.816] (-1182.488) (-1181.932) -- 0:00:36
427000 -- (-1183.720) (-1181.446) (-1181.920) [-1183.631] * (-1181.182) [-1181.432] (-1182.044) (-1181.865) -- 0:00:36
427500 -- (-1183.427) [-1183.569] (-1180.990) (-1183.624) * (-1181.030) (-1182.366) [-1181.325] (-1181.129) -- 0:00:36
428000 -- (-1180.649) (-1181.561) [-1180.896] (-1182.359) * (-1181.030) (-1181.896) (-1185.352) [-1180.834] -- 0:00:36
428500 -- (-1181.211) (-1182.469) (-1182.700) [-1182.601] * (-1182.102) [-1183.348] (-1182.635) (-1181.684) -- 0:00:36
429000 -- (-1186.762) (-1181.489) [-1181.130] (-1180.567) * [-1182.706] (-1181.056) (-1181.314) (-1182.281) -- 0:00:35
429500 -- (-1181.488) (-1181.433) (-1185.912) [-1180.539] * (-1183.620) [-1180.691] (-1182.194) (-1183.236) -- 0:00:35
430000 -- (-1182.722) (-1183.158) (-1182.148) [-1182.854] * (-1183.364) (-1180.444) (-1187.720) [-1181.463] -- 0:00:35
Average standard deviation of split frequencies: 0.011203
430500 -- (-1183.150) (-1182.401) [-1181.739] (-1182.105) * [-1180.485] (-1182.922) (-1180.908) (-1183.180) -- 0:00:35
431000 -- [-1182.050] (-1182.684) (-1181.981) (-1181.637) * (-1181.305) (-1183.463) [-1182.860] (-1183.820) -- 0:00:35
431500 -- (-1182.426) (-1189.378) [-1181.825] (-1182.193) * (-1182.543) (-1184.919) (-1182.453) [-1183.551] -- 0:00:35
432000 -- (-1183.008) (-1182.562) (-1183.252) [-1183.139] * [-1182.014] (-1183.467) (-1189.015) (-1184.259) -- 0:00:35
432500 -- (-1184.720) (-1182.621) (-1183.300) [-1184.243] * (-1181.490) [-1184.717] (-1185.919) (-1185.099) -- 0:00:35
433000 -- (-1182.992) (-1183.370) (-1184.703) [-1182.759] * [-1187.272] (-1181.418) (-1186.367) (-1181.552) -- 0:00:35
433500 -- (-1183.738) [-1181.808] (-1183.401) (-1183.506) * (-1186.573) (-1182.374) [-1185.543] (-1181.183) -- 0:00:35
434000 -- (-1181.521) (-1186.894) [-1182.010] (-1185.126) * (-1181.842) (-1183.169) (-1184.751) [-1182.232] -- 0:00:35
434500 -- [-1180.866] (-1184.934) (-1181.563) (-1183.213) * (-1183.122) (-1182.802) [-1180.945] (-1181.062) -- 0:00:35
435000 -- (-1181.483) (-1182.895) (-1184.843) [-1184.443] * (-1181.841) (-1183.156) (-1185.538) [-1182.702] -- 0:00:35
Average standard deviation of split frequencies: 0.010069
435500 -- (-1188.243) [-1182.694] (-1181.950) (-1184.295) * [-1181.640] (-1182.937) (-1186.005) (-1182.468) -- 0:00:34
436000 -- [-1183.992] (-1181.689) (-1180.672) (-1182.453) * (-1180.828) [-1182.269] (-1183.350) (-1182.383) -- 0:00:34
436500 -- (-1183.597) [-1183.416] (-1181.138) (-1182.272) * (-1180.788) (-1184.998) (-1181.124) [-1182.722] -- 0:00:34
437000 -- [-1181.008] (-1183.849) (-1184.736) (-1181.709) * [-1181.205] (-1188.720) (-1181.220) (-1183.735) -- 0:00:34
437500 -- (-1181.170) (-1180.924) (-1184.427) [-1181.709] * [-1180.610] (-1183.337) (-1180.789) (-1183.510) -- 0:00:36
438000 -- (-1182.150) (-1181.082) (-1182.632) [-1181.453] * (-1181.152) (-1185.736) (-1182.948) [-1189.172] -- 0:00:35
438500 -- (-1180.625) [-1182.154] (-1184.619) (-1183.829) * (-1182.410) (-1181.999) [-1180.814] (-1183.226) -- 0:00:35
439000 -- [-1182.546] (-1183.625) (-1183.882) (-1188.391) * (-1182.754) [-1181.598] (-1182.974) (-1184.108) -- 0:00:35
439500 -- (-1183.164) (-1181.960) (-1183.807) [-1182.717] * (-1181.900) (-1186.173) [-1181.440] (-1183.440) -- 0:00:35
440000 -- (-1180.690) (-1181.404) [-1181.910] (-1180.830) * (-1181.038) (-1187.963) [-1181.616] (-1182.844) -- 0:00:35
Average standard deviation of split frequencies: 0.010497
440500 -- (-1181.839) [-1181.363] (-1180.975) (-1183.786) * (-1183.001) [-1180.970] (-1182.619) (-1180.563) -- 0:00:35
441000 -- [-1184.264] (-1182.896) (-1180.669) (-1183.941) * (-1185.748) (-1184.045) [-1180.604] (-1186.102) -- 0:00:35
441500 -- [-1185.785] (-1183.318) (-1184.380) (-1183.405) * [-1181.653] (-1182.902) (-1191.157) (-1181.991) -- 0:00:35
442000 -- (-1182.767) (-1190.038) [-1181.431] (-1182.357) * (-1183.032) [-1181.244] (-1180.736) (-1185.943) -- 0:00:35
442500 -- (-1182.708) (-1181.704) [-1181.100] (-1182.219) * (-1183.640) (-1181.269) (-1182.240) [-1181.619] -- 0:00:35
443000 -- [-1185.840] (-1181.538) (-1182.486) (-1183.547) * (-1183.783) (-1182.585) (-1184.625) [-1180.935] -- 0:00:35
443500 -- (-1184.867) (-1181.248) [-1182.934] (-1183.844) * (-1181.014) [-1182.344] (-1183.404) (-1182.808) -- 0:00:35
444000 -- (-1183.345) (-1181.098) [-1184.214] (-1182.091) * (-1183.691) [-1185.052] (-1183.576) (-1181.251) -- 0:00:35
444500 -- (-1182.322) (-1182.615) [-1181.183] (-1182.368) * (-1186.361) [-1180.665] (-1182.185) (-1184.377) -- 0:00:34
445000 -- (-1181.989) (-1183.081) (-1182.928) [-1185.209] * (-1183.126) (-1183.942) (-1182.317) [-1185.778] -- 0:00:34
Average standard deviation of split frequencies: 0.011564
445500 -- [-1181.261] (-1183.257) (-1184.047) (-1181.874) * (-1181.843) (-1182.421) [-1184.373] (-1182.959) -- 0:00:34
446000 -- (-1182.735) (-1183.657) (-1183.333) [-1182.949] * (-1184.241) [-1181.442] (-1183.607) (-1188.100) -- 0:00:34
446500 -- (-1181.488) (-1187.053) [-1180.658] (-1182.136) * (-1184.302) (-1183.161) [-1181.770] (-1180.999) -- 0:00:34
447000 -- (-1182.456) [-1182.598] (-1182.284) (-1181.450) * [-1183.103] (-1181.562) (-1181.646) (-1181.691) -- 0:00:34
447500 -- (-1181.412) [-1182.154] (-1182.337) (-1183.284) * (-1184.678) (-1182.087) (-1182.562) [-1183.722] -- 0:00:34
448000 -- (-1181.498) (-1182.133) [-1181.192] (-1182.842) * (-1183.647) (-1183.101) (-1184.142) [-1181.623] -- 0:00:34
448500 -- [-1183.017] (-1181.033) (-1181.054) (-1184.895) * (-1184.465) (-1181.543) (-1181.462) [-1183.483] -- 0:00:34
449000 -- (-1183.366) [-1182.670] (-1183.839) (-1182.031) * (-1183.033) (-1183.405) (-1183.902) [-1182.033] -- 0:00:34
449500 -- [-1181.398] (-1181.816) (-1181.993) (-1181.610) * (-1182.864) (-1181.220) [-1182.148] (-1182.731) -- 0:00:34
450000 -- (-1183.087) [-1181.949] (-1182.947) (-1181.367) * (-1183.792) (-1182.667) [-1185.604] (-1182.159) -- 0:00:34
Average standard deviation of split frequencies: 0.011814
450500 -- [-1181.356] (-1181.756) (-1182.463) (-1184.703) * (-1185.866) [-1187.498] (-1182.984) (-1183.055) -- 0:00:34
451000 -- (-1180.868) (-1182.792) (-1181.699) [-1183.164] * [-1184.356] (-1181.202) (-1181.364) (-1183.195) -- 0:00:34
451500 -- (-1182.171) (-1182.302) [-1181.809] (-1182.194) * (-1185.704) (-1182.834) (-1181.989) [-1182.724] -- 0:00:34
452000 -- (-1180.585) (-1182.386) (-1184.297) [-1183.185] * (-1183.174) (-1180.624) (-1181.740) [-1182.564] -- 0:00:33
452500 -- (-1180.555) (-1183.531) [-1182.047] (-1182.353) * (-1183.195) (-1185.958) [-1182.081] (-1185.481) -- 0:00:33
453000 -- (-1180.436) (-1183.735) (-1182.499) [-1181.006] * [-1183.736] (-1184.573) (-1183.123) (-1182.265) -- 0:00:33
453500 -- (-1181.450) (-1182.261) (-1182.856) [-1181.340] * (-1185.845) (-1182.343) (-1183.894) [-1183.186] -- 0:00:34
454000 -- (-1182.272) [-1183.168] (-1184.352) (-1180.611) * (-1189.465) (-1181.830) (-1182.318) [-1183.128] -- 0:00:34
454500 -- (-1182.138) [-1182.109] (-1180.850) (-1180.611) * (-1181.317) (-1185.092) [-1183.197] (-1182.927) -- 0:00:34
455000 -- (-1180.471) (-1182.704) [-1182.706] (-1181.717) * (-1184.031) [-1181.168] (-1181.395) (-1182.199) -- 0:00:34
Average standard deviation of split frequencies: 0.011797
455500 -- [-1180.905] (-1183.040) (-1181.731) (-1181.536) * (-1182.674) [-1187.828] (-1184.163) (-1181.619) -- 0:00:34
456000 -- (-1184.015) (-1182.987) [-1180.580] (-1182.576) * (-1180.964) (-1185.182) [-1183.324] (-1182.451) -- 0:00:34
456500 -- (-1182.088) [-1183.418] (-1182.062) (-1182.926) * (-1180.845) [-1184.363] (-1183.259) (-1185.084) -- 0:00:34
457000 -- (-1181.151) [-1183.640] (-1182.413) (-1184.312) * (-1183.148) [-1184.539] (-1184.251) (-1186.553) -- 0:00:34
457500 -- (-1183.805) [-1183.435] (-1181.179) (-1181.348) * [-1182.375] (-1182.263) (-1184.798) (-1182.550) -- 0:00:34
458000 -- [-1182.375] (-1182.943) (-1182.670) (-1180.541) * [-1183.809] (-1184.162) (-1184.871) (-1182.838) -- 0:00:34
458500 -- (-1181.210) (-1185.736) (-1184.229) [-1180.572] * (-1187.502) (-1181.883) [-1181.075] (-1182.325) -- 0:00:34
459000 -- (-1181.524) (-1184.991) [-1181.444] (-1181.266) * (-1185.779) [-1183.225] (-1180.327) (-1181.490) -- 0:00:34
459500 -- (-1180.371) (-1181.643) [-1184.806] (-1185.668) * (-1182.154) (-1185.288) (-1180.625) [-1180.560] -- 0:00:34
460000 -- (-1181.310) (-1181.218) (-1181.691) [-1181.615] * (-1183.992) (-1183.322) (-1181.777) [-1182.110] -- 0:00:34
Average standard deviation of split frequencies: 0.012280
460500 -- (-1182.448) (-1182.822) (-1186.622) [-1182.471] * (-1184.094) (-1185.704) (-1181.997) [-1183.204] -- 0:00:33
461000 -- [-1184.561] (-1180.745) (-1186.504) (-1183.434) * (-1183.092) [-1186.195] (-1181.566) (-1181.490) -- 0:00:33
461500 -- [-1182.433] (-1183.789) (-1184.967) (-1181.137) * (-1182.421) (-1183.783) [-1181.609] (-1181.011) -- 0:00:33
462000 -- (-1180.614) (-1181.180) [-1184.593] (-1182.811) * (-1183.640) (-1182.949) [-1183.036] (-1181.474) -- 0:00:33
462500 -- (-1181.509) (-1181.948) [-1182.888] (-1181.988) * (-1182.806) [-1181.075] (-1183.827) (-1180.732) -- 0:00:33
463000 -- [-1182.339] (-1186.465) (-1183.201) (-1181.809) * (-1182.337) (-1181.444) [-1182.212] (-1181.757) -- 0:00:33
463500 -- (-1182.148) (-1186.685) [-1182.598] (-1181.446) * (-1181.820) [-1183.994] (-1181.538) (-1181.757) -- 0:00:33
464000 -- (-1181.440) [-1183.228] (-1182.091) (-1183.180) * [-1180.499] (-1184.920) (-1183.617) (-1181.963) -- 0:00:33
464500 -- (-1182.061) (-1186.706) (-1180.957) [-1181.400] * [-1181.352] (-1182.893) (-1182.734) (-1185.181) -- 0:00:33
465000 -- (-1181.910) (-1183.917) (-1182.222) [-1182.979] * (-1185.017) [-1184.995] (-1181.460) (-1183.387) -- 0:00:33
Average standard deviation of split frequencies: 0.012556
465500 -- (-1182.906) (-1182.224) (-1181.789) [-1181.339] * (-1185.286) [-1181.768] (-1182.151) (-1186.028) -- 0:00:33
466000 -- (-1185.467) (-1180.371) (-1180.302) [-1181.370] * (-1180.785) (-1186.478) (-1181.547) [-1183.876] -- 0:00:33
466500 -- (-1181.902) [-1180.917] (-1180.752) (-1180.446) * (-1181.943) (-1182.828) (-1183.132) [-1180.717] -- 0:00:33
467000 -- [-1183.384] (-1185.057) (-1180.588) (-1182.146) * [-1181.865] (-1183.784) (-1183.410) (-1184.810) -- 0:00:33
467500 -- (-1181.133) [-1183.631] (-1181.276) (-1184.806) * [-1185.594] (-1182.551) (-1182.964) (-1186.103) -- 0:00:33
468000 -- (-1182.460) (-1181.057) [-1181.572] (-1182.739) * (-1183.893) [-1180.329] (-1182.230) (-1182.790) -- 0:00:32
468500 -- (-1183.310) (-1181.312) (-1185.489) [-1182.918] * (-1184.756) (-1180.842) (-1182.268) [-1181.184] -- 0:00:32
469000 -- [-1184.543] (-1182.729) (-1182.833) (-1183.838) * (-1183.679) (-1182.039) (-1181.007) [-1181.586] -- 0:00:32
469500 -- (-1181.867) (-1181.788) [-1183.964] (-1180.865) * [-1181.445] (-1182.073) (-1181.539) (-1186.648) -- 0:00:32
470000 -- (-1184.672) (-1180.320) [-1182.907] (-1180.705) * [-1183.336] (-1181.602) (-1182.935) (-1183.930) -- 0:00:33
Average standard deviation of split frequencies: 0.011768
470500 -- (-1189.505) (-1183.179) (-1184.613) [-1182.067] * (-1183.134) [-1184.454] (-1181.293) (-1182.507) -- 0:00:33
471000 -- [-1186.929] (-1184.915) (-1183.782) (-1182.114) * [-1183.909] (-1181.027) (-1181.133) (-1185.493) -- 0:00:33
471500 -- (-1189.095) (-1182.531) [-1180.900] (-1182.815) * (-1181.665) (-1182.412) (-1182.236) [-1183.313] -- 0:00:33
472000 -- (-1188.221) (-1181.550) (-1180.761) [-1183.825] * [-1181.608] (-1182.385) (-1181.311) (-1183.975) -- 0:00:33
472500 -- [-1182.198] (-1182.060) (-1183.468) (-1182.203) * [-1181.318] (-1182.573) (-1183.423) (-1184.200) -- 0:00:33
473000 -- [-1182.039] (-1182.122) (-1186.361) (-1182.237) * (-1183.044) (-1185.381) (-1183.821) [-1187.549] -- 0:00:33
473500 -- (-1183.324) [-1182.419] (-1184.270) (-1182.703) * (-1180.901) (-1185.318) [-1181.391] (-1185.638) -- 0:00:33
474000 -- (-1183.085) (-1182.771) (-1183.758) [-1180.977] * (-1182.977) [-1181.048] (-1182.332) (-1182.552) -- 0:00:33
474500 -- (-1181.657) (-1180.771) [-1183.458] (-1184.090) * (-1182.070) (-1180.981) [-1183.356] (-1182.232) -- 0:00:33
475000 -- (-1184.877) (-1181.269) [-1182.410] (-1184.177) * (-1180.450) (-1181.815) (-1183.136) [-1182.947] -- 0:00:33
Average standard deviation of split frequencies: 0.011822
475500 -- [-1180.964] (-1181.777) (-1181.690) (-1183.019) * (-1183.062) [-1181.646] (-1181.824) (-1183.015) -- 0:00:33
476000 -- (-1181.577) [-1184.007] (-1181.128) (-1182.785) * (-1184.337) (-1181.614) (-1184.744) [-1181.595] -- 0:00:33
476500 -- (-1183.056) (-1182.224) [-1181.328] (-1188.185) * (-1181.571) (-1182.574) [-1180.710] (-1183.604) -- 0:00:32
477000 -- (-1182.001) (-1183.098) [-1183.474] (-1182.424) * (-1181.560) [-1184.995] (-1180.704) (-1184.833) -- 0:00:32
477500 -- (-1182.005) (-1181.547) (-1185.308) [-1181.089] * (-1181.260) (-1182.642) [-1181.772] (-1183.208) -- 0:00:32
478000 -- (-1182.455) [-1180.905] (-1185.890) (-1182.505) * (-1184.635) (-1184.448) (-1184.202) [-1181.106] -- 0:00:32
478500 -- [-1183.240] (-1181.068) (-1183.316) (-1184.072) * [-1184.616] (-1182.972) (-1180.784) (-1182.199) -- 0:00:32
479000 -- (-1181.856) [-1184.230] (-1187.815) (-1183.250) * (-1185.330) (-1186.432) [-1180.806] (-1183.465) -- 0:00:32
479500 -- (-1183.819) (-1186.837) (-1186.393) [-1181.471] * (-1182.365) (-1185.585) [-1181.202] (-1181.409) -- 0:00:32
480000 -- (-1183.773) (-1182.118) [-1182.217] (-1182.628) * (-1184.601) (-1182.831) (-1182.933) [-1182.653] -- 0:00:32
Average standard deviation of split frequencies: 0.012075
480500 -- [-1185.207] (-1185.979) (-1187.544) (-1183.369) * (-1182.040) [-1184.190] (-1181.433) (-1182.956) -- 0:00:32
481000 -- (-1184.022) [-1182.394] (-1180.714) (-1182.054) * (-1182.097) (-1186.382) (-1182.867) [-1182.626] -- 0:00:32
481500 -- (-1186.543) (-1183.220) [-1181.528] (-1181.240) * (-1181.620) (-1183.909) (-1182.695) [-1184.436] -- 0:00:32
482000 -- (-1183.586) (-1184.626) (-1180.435) [-1180.217] * (-1180.968) (-1184.327) [-1181.139] (-1184.361) -- 0:00:32
482500 -- (-1182.381) [-1185.559] (-1181.274) (-1181.067) * (-1181.383) (-1183.204) (-1181.102) [-1182.973] -- 0:00:32
483000 -- (-1185.418) (-1182.562) (-1184.562) [-1182.310] * (-1183.321) [-1182.048] (-1183.698) (-1182.994) -- 0:00:32
483500 -- (-1182.316) [-1181.569] (-1183.247) (-1181.525) * (-1182.644) [-1188.962] (-1180.938) (-1181.468) -- 0:00:32
484000 -- [-1180.625] (-1180.621) (-1185.275) (-1181.579) * (-1182.492) (-1182.215) (-1182.296) [-1188.015] -- 0:00:31
484500 -- (-1181.688) [-1183.235] (-1181.428) (-1182.298) * (-1181.794) (-1180.999) (-1183.490) [-1188.492] -- 0:00:31
485000 -- (-1183.902) (-1181.577) (-1183.060) [-1185.716] * (-1182.242) (-1184.740) [-1183.275] (-1184.175) -- 0:00:31
Average standard deviation of split frequencies: 0.012064
485500 -- (-1181.819) (-1182.707) (-1183.646) [-1181.378] * (-1183.722) (-1181.782) (-1181.844) [-1181.829] -- 0:00:31
486000 -- [-1184.827] (-1182.223) (-1180.837) (-1181.199) * (-1184.382) (-1182.551) (-1181.944) [-1182.499] -- 0:00:32
486500 -- (-1185.068) (-1182.029) (-1182.856) [-1181.601] * (-1184.568) (-1184.829) [-1183.034] (-1182.513) -- 0:00:32
487000 -- (-1185.302) [-1183.409] (-1184.518) (-1181.219) * (-1185.295) [-1180.510] (-1181.110) (-1184.167) -- 0:00:32
487500 -- (-1182.600) (-1183.512) [-1183.227] (-1182.549) * (-1182.150) (-1180.548) [-1180.858] (-1186.915) -- 0:00:32
488000 -- (-1181.400) [-1183.882] (-1181.104) (-1183.750) * [-1180.880] (-1180.821) (-1180.703) (-1181.515) -- 0:00:32
488500 -- [-1182.678] (-1183.777) (-1183.630) (-1181.281) * (-1181.782) (-1188.805) (-1183.355) [-1182.923] -- 0:00:32
489000 -- [-1183.130] (-1185.146) (-1181.352) (-1181.874) * (-1181.447) [-1180.933] (-1181.787) (-1181.453) -- 0:00:32
489500 -- (-1181.295) (-1180.495) [-1182.042] (-1186.079) * [-1182.270] (-1181.553) (-1181.742) (-1184.124) -- 0:00:32
490000 -- (-1186.203) (-1182.104) (-1185.825) [-1184.383] * (-1183.035) (-1183.161) [-1184.845] (-1181.491) -- 0:00:32
Average standard deviation of split frequencies: 0.012009
490500 -- (-1186.389) [-1182.211] (-1184.017) (-1182.243) * (-1182.284) [-1183.520] (-1181.643) (-1181.909) -- 0:00:32
491000 -- (-1184.617) (-1181.471) (-1181.082) [-1182.822] * [-1183.565] (-1182.264) (-1183.714) (-1181.869) -- 0:00:32
491500 -- (-1184.801) (-1182.543) [-1181.236] (-1183.074) * (-1186.347) (-1182.179) [-1183.251] (-1182.116) -- 0:00:32
492000 -- [-1181.831] (-1181.210) (-1184.507) (-1183.582) * (-1180.896) (-1181.898) [-1181.342] (-1184.327) -- 0:00:32
492500 -- (-1184.377) [-1181.325] (-1184.477) (-1181.781) * [-1181.293] (-1184.998) (-1181.985) (-1183.182) -- 0:00:31
493000 -- (-1181.703) (-1180.896) [-1185.869] (-1182.708) * (-1181.676) (-1181.033) [-1183.691] (-1181.822) -- 0:00:31
493500 -- (-1182.795) [-1181.305] (-1185.275) (-1186.193) * (-1183.509) (-1180.958) [-1181.378] (-1182.137) -- 0:00:31
494000 -- (-1180.451) (-1182.308) [-1183.442] (-1181.531) * (-1185.023) [-1181.938] (-1181.680) (-1181.642) -- 0:00:31
494500 -- [-1181.090] (-1182.183) (-1182.584) (-1182.294) * (-1181.549) (-1181.855) [-1181.007] (-1181.959) -- 0:00:31
495000 -- (-1180.428) (-1183.258) [-1180.742] (-1180.469) * (-1182.608) (-1185.679) (-1181.112) [-1180.699] -- 0:00:31
Average standard deviation of split frequencies: 0.011524
495500 -- [-1180.727] (-1185.901) (-1186.738) (-1181.949) * (-1181.373) (-1184.430) (-1181.316) [-1180.728] -- 0:00:31
496000 -- (-1181.139) (-1183.908) (-1186.064) [-1181.329] * [-1181.172] (-1181.614) (-1182.720) (-1183.630) -- 0:00:31
496500 -- (-1182.759) [-1183.127] (-1181.667) (-1184.099) * [-1182.898] (-1182.564) (-1184.611) (-1185.089) -- 0:00:31
497000 -- (-1181.558) (-1185.976) [-1181.513] (-1183.999) * (-1182.433) (-1182.121) [-1181.599] (-1188.922) -- 0:00:31
497500 -- (-1183.974) [-1180.780] (-1183.340) (-1180.740) * (-1185.553) (-1182.911) [-1181.468] (-1181.340) -- 0:00:31
498000 -- (-1186.026) (-1182.701) [-1181.180] (-1180.740) * [-1184.451] (-1182.377) (-1180.551) (-1182.574) -- 0:00:31
498500 -- (-1182.306) (-1186.911) [-1180.664] (-1183.065) * [-1185.492] (-1182.161) (-1181.030) (-1183.963) -- 0:00:31
499000 -- (-1183.312) [-1183.584] (-1181.793) (-1185.390) * [-1181.277] (-1182.273) (-1182.664) (-1182.300) -- 0:00:31
499500 -- (-1183.625) [-1181.678] (-1185.905) (-1185.061) * (-1187.770) [-1181.895] (-1185.230) (-1180.862) -- 0:00:31
500000 -- (-1181.320) (-1182.193) (-1190.036) [-1181.606] * (-1184.763) [-1181.345] (-1181.698) (-1182.099) -- 0:00:31
Average standard deviation of split frequencies: 0.011475
500500 -- [-1181.512] (-1185.778) (-1182.441) (-1181.810) * (-1184.412) (-1181.946) [-1182.289] (-1184.296) -- 0:00:30
501000 -- (-1181.034) [-1181.669] (-1182.008) (-1182.593) * (-1183.923) (-1185.614) (-1186.857) [-1182.928] -- 0:00:30
501500 -- (-1184.554) (-1182.819) [-1181.932] (-1181.391) * (-1183.308) (-1181.944) (-1184.945) [-1181.853] -- 0:00:30
502000 -- (-1181.415) (-1181.817) [-1184.221] (-1181.067) * [-1182.541] (-1181.957) (-1184.029) (-1184.312) -- 0:00:31
502500 -- (-1182.289) (-1181.912) [-1183.388] (-1182.846) * (-1182.073) (-1181.976) [-1181.514] (-1180.394) -- 0:00:31
503000 -- (-1183.295) (-1181.474) (-1183.504) [-1180.821] * (-1183.132) [-1183.812] (-1182.380) (-1187.727) -- 0:00:31
503500 -- (-1184.008) (-1184.050) (-1181.395) [-1182.627] * (-1183.655) [-1180.856] (-1183.059) (-1181.036) -- 0:00:31
504000 -- (-1182.114) (-1182.777) [-1181.177] (-1182.389) * (-1182.282) (-1183.872) [-1184.221] (-1181.067) -- 0:00:31
504500 -- (-1183.375) (-1182.606) (-1184.110) [-1180.502] * (-1184.948) (-1184.442) [-1181.823] (-1180.811) -- 0:00:31
505000 -- (-1183.673) [-1183.589] (-1185.031) (-1181.453) * (-1182.385) (-1182.170) [-1181.039] (-1185.208) -- 0:00:31
Average standard deviation of split frequencies: 0.010772
505500 -- (-1182.087) (-1186.847) (-1184.894) [-1186.118] * (-1186.840) (-1182.772) [-1182.062] (-1185.041) -- 0:00:31
506000 -- (-1181.835) (-1183.766) [-1181.984] (-1181.483) * (-1189.965) (-1180.727) (-1183.065) [-1182.766] -- 0:00:31
506500 -- (-1181.488) [-1184.825] (-1182.160) (-1182.401) * [-1181.263] (-1181.461) (-1182.137) (-1183.141) -- 0:00:31
507000 -- (-1182.358) (-1183.147) [-1180.823] (-1180.656) * (-1181.647) [-1181.408] (-1181.350) (-1181.257) -- 0:00:31
507500 -- (-1184.041) (-1181.500) (-1181.813) [-1180.700] * [-1183.507] (-1185.122) (-1182.776) (-1182.549) -- 0:00:31
508000 -- [-1181.660] (-1180.689) (-1182.866) (-1181.245) * [-1181.668] (-1186.393) (-1181.793) (-1182.249) -- 0:00:30
508500 -- (-1183.112) (-1181.286) (-1185.732) [-1183.731] * [-1184.008] (-1181.052) (-1187.048) (-1183.302) -- 0:00:30
509000 -- (-1183.446) [-1180.717] (-1182.318) (-1181.392) * (-1183.020) (-1182.196) (-1183.269) [-1188.997] -- 0:00:30
509500 -- [-1181.674] (-1181.437) (-1185.185) (-1182.558) * (-1180.447) (-1181.972) (-1181.626) [-1190.310] -- 0:00:30
510000 -- (-1182.960) [-1183.174] (-1182.926) (-1183.941) * (-1184.147) (-1183.860) (-1181.996) [-1181.071] -- 0:00:30
Average standard deviation of split frequencies: 0.010097
510500 -- (-1182.797) [-1180.730] (-1181.944) (-1186.561) * (-1183.783) (-1183.846) [-1181.478] (-1184.138) -- 0:00:30
511000 -- (-1182.348) [-1180.857] (-1181.543) (-1182.317) * (-1184.864) (-1180.910) (-1188.086) [-1180.810] -- 0:00:30
511500 -- (-1183.722) [-1181.279] (-1181.944) (-1183.923) * (-1184.861) (-1181.780) (-1189.377) [-1183.388] -- 0:00:30
512000 -- (-1182.540) (-1181.013) (-1188.202) [-1187.954] * (-1182.150) (-1183.627) [-1183.201] (-1184.264) -- 0:00:30
512500 -- (-1182.129) [-1181.754] (-1186.604) (-1184.274) * (-1182.276) (-1182.252) (-1181.441) [-1181.463] -- 0:00:30
513000 -- (-1182.118) (-1181.061) [-1180.865] (-1182.243) * (-1181.197) (-1182.267) (-1180.797) [-1183.673] -- 0:00:30
513500 -- (-1182.957) (-1181.634) (-1191.205) [-1182.873] * [-1181.910] (-1182.906) (-1182.213) (-1183.196) -- 0:00:30
514000 -- (-1181.508) [-1184.735] (-1185.553) (-1181.363) * [-1181.379] (-1182.657) (-1183.525) (-1188.381) -- 0:00:30
514500 -- (-1182.565) [-1185.651] (-1180.512) (-1182.700) * (-1183.025) [-1181.418] (-1184.340) (-1185.506) -- 0:00:30
515000 -- [-1183.658] (-1184.433) (-1183.130) (-1182.266) * (-1182.625) [-1181.686] (-1181.895) (-1189.287) -- 0:00:30
Average standard deviation of split frequencies: 0.009935
515500 -- (-1183.989) [-1184.930] (-1181.475) (-1186.528) * [-1181.739] (-1180.996) (-1182.459) (-1186.166) -- 0:00:30
516000 -- (-1183.176) (-1182.384) (-1181.433) [-1188.682] * (-1181.572) [-1181.693] (-1182.168) (-1191.712) -- 0:00:30
516500 -- [-1185.160] (-1183.803) (-1183.292) (-1185.012) * (-1193.620) (-1182.220) (-1188.276) [-1183.590] -- 0:00:29
517000 -- (-1187.117) [-1181.680] (-1183.434) (-1181.168) * (-1183.269) (-1181.361) [-1182.900] (-1186.354) -- 0:00:29
517500 -- [-1182.923] (-1182.010) (-1182.270) (-1181.424) * (-1182.402) (-1181.645) (-1182.475) [-1182.144] -- 0:00:29
518000 -- (-1184.615) (-1184.037) [-1181.194] (-1181.941) * [-1181.882] (-1183.014) (-1181.899) (-1183.409) -- 0:00:30
518500 -- [-1186.592] (-1184.081) (-1182.949) (-1183.574) * (-1186.867) [-1184.724] (-1180.560) (-1182.995) -- 0:00:30
519000 -- (-1182.548) (-1187.011) [-1183.374] (-1184.013) * (-1182.027) (-1186.986) (-1182.069) [-1181.404] -- 0:00:30
519500 -- (-1182.287) (-1183.448) (-1182.220) [-1183.834] * (-1183.911) (-1186.733) [-1182.147] (-1184.134) -- 0:00:30
520000 -- [-1182.623] (-1182.948) (-1186.205) (-1184.080) * (-1184.412) [-1182.364] (-1183.025) (-1183.720) -- 0:00:30
Average standard deviation of split frequencies: 0.009903
520500 -- (-1188.571) (-1182.336) [-1185.239] (-1181.897) * (-1183.555) (-1184.348) (-1182.379) [-1183.496] -- 0:00:30
521000 -- (-1187.414) (-1182.195) [-1181.347] (-1182.878) * (-1183.578) (-1183.933) (-1182.470) [-1182.056] -- 0:00:30
521500 -- (-1182.140) [-1185.396] (-1180.870) (-1186.572) * [-1189.037] (-1183.687) (-1181.838) (-1180.403) -- 0:00:30
522000 -- (-1181.942) (-1181.623) (-1181.896) [-1181.009] * (-1181.571) (-1181.937) [-1182.316] (-1182.336) -- 0:00:30
522500 -- [-1181.102] (-1184.011) (-1187.273) (-1182.308) * (-1181.734) (-1182.359) [-1182.204] (-1183.544) -- 0:00:30
523000 -- (-1184.300) (-1182.360) (-1183.350) [-1181.575] * [-1181.641] (-1181.011) (-1184.273) (-1181.377) -- 0:00:30
523500 -- (-1180.643) (-1182.426) (-1182.794) [-1182.667] * (-1182.971) [-1180.696] (-1185.892) (-1184.189) -- 0:00:30
524000 -- (-1182.801) (-1183.435) (-1183.241) [-1183.467] * (-1180.840) (-1182.260) [-1185.716] (-1184.562) -- 0:00:29
524500 -- [-1180.616] (-1181.904) (-1181.891) (-1186.660) * (-1180.495) (-1182.111) (-1182.222) [-1182.041] -- 0:00:29
525000 -- [-1181.209] (-1182.699) (-1184.593) (-1181.245) * [-1181.223] (-1181.949) (-1185.239) (-1186.984) -- 0:00:29
Average standard deviation of split frequencies: 0.010026
525500 -- (-1182.260) (-1182.588) [-1183.495] (-1180.735) * (-1186.399) (-1184.713) [-1182.895] (-1184.007) -- 0:00:29
526000 -- [-1181.844] (-1183.719) (-1180.952) (-1182.647) * (-1184.716) (-1181.510) (-1181.860) [-1182.442] -- 0:00:29
526500 -- (-1185.627) (-1185.341) (-1182.425) [-1180.362] * (-1181.418) (-1180.893) (-1183.903) [-1182.152] -- 0:00:29
527000 -- (-1181.227) (-1185.287) (-1182.542) [-1184.208] * (-1185.731) [-1181.229] (-1185.142) (-1183.320) -- 0:00:29
527500 -- (-1189.986) (-1180.588) (-1183.263) [-1181.916] * (-1186.101) [-1180.302] (-1181.836) (-1181.378) -- 0:00:29
528000 -- (-1181.428) (-1183.293) (-1183.070) [-1182.335] * (-1182.427) [-1181.745] (-1183.383) (-1183.717) -- 0:00:29
528500 -- [-1183.967] (-1183.283) (-1182.355) (-1182.133) * (-1182.984) (-1184.895) [-1183.733] (-1181.573) -- 0:00:29
529000 -- (-1186.293) (-1182.387) [-1187.411] (-1183.105) * (-1184.541) (-1186.685) (-1183.938) [-1184.510] -- 0:00:29
529500 -- (-1181.041) (-1181.294) [-1181.830] (-1183.499) * (-1184.111) (-1184.167) (-1181.844) [-1182.802] -- 0:00:29
530000 -- (-1181.332) (-1183.549) [-1184.902] (-1182.455) * [-1181.590] (-1185.513) (-1182.782) (-1189.271) -- 0:00:29
Average standard deviation of split frequencies: 0.009605
530500 -- [-1182.030] (-1184.138) (-1184.431) (-1182.160) * [-1181.606] (-1184.431) (-1180.962) (-1182.789) -- 0:00:29
531000 -- [-1185.911] (-1187.133) (-1187.019) (-1184.648) * (-1181.779) [-1182.609] (-1181.868) (-1182.191) -- 0:00:29
531500 -- (-1183.472) (-1189.300) (-1182.389) [-1182.710] * (-1184.944) (-1181.571) (-1185.533) [-1181.899] -- 0:00:29
532000 -- [-1183.632] (-1182.321) (-1183.284) (-1182.042) * [-1184.110] (-1183.457) (-1184.555) (-1182.156) -- 0:00:29
532500 -- [-1182.419] (-1180.781) (-1185.266) (-1186.881) * (-1184.260) [-1182.282] (-1183.908) (-1182.190) -- 0:00:28
533000 -- (-1181.863) [-1182.395] (-1184.949) (-1183.466) * [-1181.348] (-1184.298) (-1187.271) (-1183.832) -- 0:00:28
533500 -- [-1181.719] (-1182.730) (-1185.524) (-1182.488) * (-1185.587) (-1186.294) (-1184.785) [-1182.394] -- 0:00:28
534000 -- (-1181.515) [-1181.453] (-1187.096) (-1183.942) * (-1181.615) (-1183.227) (-1183.298) [-1183.617] -- 0:00:28
534500 -- (-1182.389) (-1180.303) (-1187.870) [-1181.389] * [-1181.373] (-1183.761) (-1182.179) (-1185.931) -- 0:00:29
535000 -- (-1185.687) (-1185.154) (-1182.159) [-1182.252] * [-1181.844] (-1181.859) (-1185.440) (-1182.140) -- 0:00:29
Average standard deviation of split frequencies: 0.009235
535500 -- [-1181.661] (-1181.661) (-1183.673) (-1184.010) * (-1182.533) (-1180.934) (-1183.179) [-1183.125] -- 0:00:29
536000 -- (-1184.136) [-1184.075] (-1192.030) (-1185.177) * (-1182.273) (-1181.599) (-1183.775) [-1182.006] -- 0:00:29
536500 -- (-1181.750) (-1187.492) [-1187.638] (-1186.083) * (-1180.289) (-1182.169) [-1182.441] (-1182.319) -- 0:00:29
537000 -- (-1180.982) (-1182.489) [-1183.927] (-1187.113) * (-1182.486) (-1186.564) (-1182.277) [-1182.672] -- 0:00:29
537500 -- [-1183.145] (-1182.495) (-1182.020) (-1184.427) * (-1182.635) [-1182.903] (-1183.236) (-1183.177) -- 0:00:29
538000 -- (-1183.005) (-1181.433) [-1184.497] (-1182.068) * (-1185.315) [-1181.388] (-1181.740) (-1184.322) -- 0:00:29
538500 -- [-1182.763] (-1180.996) (-1182.846) (-1186.096) * [-1188.182] (-1184.835) (-1183.525) (-1182.876) -- 0:00:29
539000 -- (-1182.822) (-1181.578) [-1181.966] (-1186.822) * (-1183.014) (-1181.786) (-1182.172) [-1182.784] -- 0:00:29
539500 -- (-1182.799) (-1181.193) [-1183.857] (-1182.654) * (-1181.366) [-1182.246] (-1181.506) (-1184.443) -- 0:00:29
540000 -- (-1182.554) (-1181.892) (-1185.728) [-1189.111] * (-1181.005) (-1185.567) [-1182.151] (-1182.330) -- 0:00:28
Average standard deviation of split frequencies: 0.009427
540500 -- [-1182.210] (-1181.825) (-1184.283) (-1185.266) * (-1181.144) (-1184.550) (-1184.338) [-1181.397] -- 0:00:28
541000 -- (-1187.596) (-1183.261) (-1184.535) [-1181.853] * [-1183.351] (-1182.386) (-1183.483) (-1181.665) -- 0:00:28
541500 -- [-1184.252] (-1181.503) (-1181.917) (-1183.581) * [-1180.899] (-1182.684) (-1181.896) (-1182.952) -- 0:00:28
542000 -- (-1186.492) (-1182.455) [-1181.946] (-1183.845) * (-1181.082) (-1181.726) [-1182.923] (-1180.965) -- 0:00:28
542500 -- (-1189.579) (-1182.184) [-1182.736] (-1183.081) * [-1183.855] (-1181.684) (-1185.229) (-1181.033) -- 0:00:28
543000 -- (-1180.699) [-1181.162] (-1183.303) (-1182.964) * (-1183.335) [-1183.092] (-1190.974) (-1181.595) -- 0:00:28
543500 -- [-1180.999] (-1181.209) (-1182.337) (-1185.386) * [-1183.219] (-1181.803) (-1184.115) (-1182.210) -- 0:00:28
544000 -- (-1183.262) (-1185.317) (-1182.846) [-1183.896] * (-1189.670) [-1181.716] (-1181.999) (-1183.518) -- 0:00:28
544500 -- [-1182.739] (-1185.953) (-1181.004) (-1186.106) * [-1182.187] (-1182.167) (-1183.607) (-1184.512) -- 0:00:28
545000 -- (-1182.109) (-1183.985) [-1180.522] (-1182.635) * (-1183.955) (-1183.132) (-1186.952) [-1181.782] -- 0:00:28
Average standard deviation of split frequencies: 0.009443
545500 -- (-1181.928) [-1181.374] (-1185.053) (-1183.212) * (-1181.774) (-1184.769) (-1182.394) [-1182.185] -- 0:00:28
546000 -- [-1183.865] (-1182.038) (-1182.187) (-1191.430) * (-1183.574) [-1182.067] (-1182.818) (-1183.297) -- 0:00:28
546500 -- (-1183.478) (-1181.383) [-1182.311] (-1186.616) * (-1182.501) [-1180.801] (-1181.663) (-1181.210) -- 0:00:28
547000 -- (-1183.024) [-1181.346] (-1185.353) (-1183.660) * (-1184.186) (-1187.217) [-1182.037] (-1181.176) -- 0:00:28
547500 -- [-1182.368] (-1182.230) (-1183.191) (-1186.776) * [-1183.571] (-1182.122) (-1184.702) (-1181.174) -- 0:00:28
548000 -- (-1182.501) [-1181.029] (-1185.073) (-1182.407) * (-1183.652) (-1181.036) [-1185.048] (-1185.084) -- 0:00:28
548500 -- (-1181.714) (-1181.600) [-1190.744] (-1181.920) * (-1182.065) [-1182.565] (-1183.530) (-1182.903) -- 0:00:27
549000 -- (-1183.240) [-1180.582] (-1184.212) (-1183.989) * (-1181.737) [-1182.665] (-1180.507) (-1181.051) -- 0:00:27
549500 -- (-1180.940) (-1186.503) (-1181.653) [-1180.934] * (-1181.804) (-1182.066) (-1182.897) [-1180.400] -- 0:00:27
550000 -- (-1181.185) (-1182.975) (-1184.242) [-1182.444] * (-1184.868) [-1181.331] (-1181.341) (-1181.101) -- 0:00:27
Average standard deviation of split frequencies: 0.009577
550500 -- (-1182.650) (-1181.177) [-1182.796] (-1181.396) * (-1184.868) (-1182.393) (-1181.109) [-1183.334] -- 0:00:28
551000 -- (-1182.701) (-1182.741) [-1183.757] (-1183.581) * (-1183.546) (-1182.360) (-1184.993) [-1181.474] -- 0:00:28
551500 -- (-1184.587) (-1183.554) [-1181.754] (-1184.183) * (-1183.279) [-1185.064] (-1185.293) (-1181.776) -- 0:00:28
552000 -- (-1181.963) (-1183.898) [-1182.078] (-1182.396) * [-1183.334] (-1181.010) (-1183.179) (-1181.601) -- 0:00:28
552500 -- [-1182.877] (-1185.028) (-1184.660) (-1182.226) * [-1181.474] (-1181.119) (-1184.057) (-1182.934) -- 0:00:28
553000 -- (-1185.685) (-1182.880) [-1185.958] (-1182.649) * (-1181.981) (-1181.731) (-1183.096) [-1182.112] -- 0:00:28
553500 -- (-1187.545) (-1182.452) [-1182.049] (-1183.752) * [-1184.044] (-1184.376) (-1185.219) (-1182.167) -- 0:00:28
554000 -- (-1189.354) (-1181.821) (-1183.746) [-1182.918] * [-1181.193] (-1182.512) (-1180.427) (-1182.998) -- 0:00:28
554500 -- (-1184.137) (-1183.157) (-1181.149) [-1181.696] * (-1182.810) (-1182.156) (-1182.339) [-1181.065] -- 0:00:28
555000 -- (-1182.797) (-1184.225) (-1184.747) [-1182.185] * (-1184.350) (-1182.989) (-1181.125) [-1181.161] -- 0:00:28
Average standard deviation of split frequencies: 0.008955
555500 -- [-1184.612] (-1182.208) (-1184.702) (-1185.934) * (-1185.887) [-1181.653] (-1181.724) (-1181.692) -- 0:00:28
556000 -- [-1182.256] (-1183.262) (-1182.463) (-1180.863) * (-1188.506) (-1182.284) (-1181.415) [-1182.521] -- 0:00:27
556500 -- (-1182.361) [-1184.558] (-1181.982) (-1181.455) * (-1184.760) (-1181.467) [-1180.963] (-1183.707) -- 0:00:27
557000 -- (-1182.180) [-1181.028] (-1181.185) (-1184.096) * (-1184.956) [-1180.797] (-1181.514) (-1181.699) -- 0:00:27
557500 -- (-1184.594) (-1182.388) (-1185.536) [-1182.953] * (-1182.162) (-1181.469) (-1185.150) [-1182.114] -- 0:00:27
558000 -- [-1181.978] (-1185.434) (-1181.201) (-1184.312) * [-1182.161] (-1186.226) (-1183.493) (-1180.916) -- 0:00:27
558500 -- (-1182.790) (-1185.011) [-1182.741] (-1185.168) * [-1182.751] (-1182.603) (-1185.730) (-1182.742) -- 0:00:27
559000 -- (-1181.108) (-1183.146) [-1180.796] (-1180.941) * [-1183.930] (-1184.820) (-1182.683) (-1182.619) -- 0:00:27
559500 -- (-1182.502) (-1184.990) (-1181.635) [-1181.488] * (-1184.107) (-1186.442) (-1182.409) [-1185.058] -- 0:00:27
560000 -- (-1181.942) (-1183.508) [-1182.504] (-1183.516) * (-1181.418) [-1182.865] (-1182.397) (-1181.644) -- 0:00:27
Average standard deviation of split frequencies: 0.008933
560500 -- (-1182.319) [-1182.938] (-1182.548) (-1181.553) * [-1183.083] (-1180.461) (-1181.958) (-1182.132) -- 0:00:27
561000 -- (-1184.171) [-1180.603] (-1182.338) (-1186.449) * (-1183.173) (-1182.021) (-1185.258) [-1184.084] -- 0:00:27
561500 -- (-1184.333) (-1183.230) [-1181.609] (-1183.379) * (-1182.395) (-1182.672) (-1185.423) [-1184.635] -- 0:00:27
562000 -- (-1186.485) (-1181.560) (-1181.752) [-1181.444] * (-1183.524) (-1182.702) [-1183.884] (-1184.639) -- 0:00:27
562500 -- [-1181.694] (-1182.910) (-1181.353) (-1182.768) * (-1182.362) (-1182.234) [-1181.992] (-1186.351) -- 0:00:27
563000 -- (-1183.333) (-1181.786) [-1183.256] (-1180.216) * [-1183.494] (-1180.270) (-1184.959) (-1182.413) -- 0:00:27
563500 -- (-1182.612) (-1182.035) [-1183.700] (-1181.951) * (-1183.210) [-1181.057] (-1183.206) (-1182.791) -- 0:00:27
564000 -- (-1182.340) (-1181.478) (-1185.913) [-1182.089] * (-1181.826) (-1182.100) (-1184.131) [-1182.681] -- 0:00:27
564500 -- (-1181.980) (-1184.793) [-1182.346] (-1182.748) * (-1182.393) (-1186.239) [-1182.298] (-1188.074) -- 0:00:27
565000 -- [-1180.746] (-1184.620) (-1183.890) (-1184.086) * [-1182.799] (-1183.750) (-1181.329) (-1181.888) -- 0:00:26
Average standard deviation of split frequencies: 0.008868
565500 -- (-1181.530) [-1184.479] (-1180.780) (-1184.772) * (-1184.067) (-1184.000) (-1182.023) [-1181.959] -- 0:00:27
566000 -- (-1181.012) (-1180.596) [-1182.118] (-1181.296) * (-1184.357) (-1184.116) [-1181.936] (-1184.303) -- 0:00:27
566500 -- (-1182.109) [-1181.697] (-1182.884) (-1181.939) * (-1185.794) [-1181.650] (-1186.186) (-1188.692) -- 0:00:27
567000 -- [-1180.482] (-1182.242) (-1182.313) (-1182.453) * (-1180.829) (-1181.337) (-1182.816) [-1182.746] -- 0:00:27
567500 -- (-1180.463) [-1186.435] (-1181.816) (-1184.332) * (-1182.636) (-1181.397) [-1181.902] (-1183.912) -- 0:00:27
568000 -- [-1182.510] (-1181.622) (-1185.197) (-1181.262) * (-1184.848) (-1182.251) [-1180.925] (-1185.483) -- 0:00:27
568500 -- (-1183.960) [-1180.612] (-1180.787) (-1181.445) * (-1184.850) [-1184.350] (-1180.994) (-1181.799) -- 0:00:27
569000 -- (-1183.507) (-1180.855) [-1182.784] (-1187.441) * (-1181.766) (-1183.794) [-1181.695] (-1184.250) -- 0:00:27
569500 -- [-1183.916] (-1182.155) (-1183.695) (-1184.041) * (-1180.789) [-1184.115] (-1183.261) (-1184.291) -- 0:00:27
570000 -- (-1183.305) (-1184.025) [-1182.590] (-1183.294) * [-1181.897] (-1181.717) (-1183.399) (-1183.057) -- 0:00:27
Average standard deviation of split frequencies: 0.008795
570500 -- [-1185.325] (-1185.567) (-1184.477) (-1186.800) * (-1182.764) (-1182.723) [-1181.274] (-1181.493) -- 0:00:27
571000 -- (-1182.991) (-1183.138) [-1185.428] (-1182.347) * (-1183.563) (-1183.808) (-1181.695) [-1181.698] -- 0:00:27
571500 -- [-1181.098] (-1183.304) (-1182.870) (-1181.169) * (-1182.417) (-1183.241) [-1182.320] (-1183.288) -- 0:00:26
572000 -- (-1182.347) [-1180.733] (-1181.811) (-1181.680) * (-1183.651) (-1182.336) [-1183.438] (-1181.239) -- 0:00:26
572500 -- [-1184.484] (-1182.287) (-1182.345) (-1181.008) * (-1183.263) (-1182.839) (-1183.594) [-1181.567] -- 0:00:26
573000 -- (-1185.725) (-1181.497) (-1181.681) [-1180.805] * (-1183.311) [-1181.883] (-1183.675) (-1181.082) -- 0:00:26
573500 -- [-1184.567] (-1181.795) (-1181.662) (-1181.499) * (-1181.534) (-1183.780) (-1181.494) [-1184.720] -- 0:00:26
574000 -- (-1182.208) (-1181.546) (-1180.969) [-1181.769] * [-1183.004] (-1183.445) (-1183.071) (-1182.012) -- 0:00:26
574500 -- (-1181.127) (-1182.103) (-1181.666) [-1181.788] * (-1183.816) [-1181.554] (-1183.556) (-1183.610) -- 0:00:26
575000 -- [-1183.155] (-1183.707) (-1183.800) (-1182.282) * (-1181.947) (-1182.022) (-1184.434) [-1181.953] -- 0:00:26
Average standard deviation of split frequencies: 0.008906
575500 -- (-1184.865) [-1181.801] (-1182.940) (-1181.052) * (-1181.528) [-1182.203] (-1183.341) (-1183.264) -- 0:00:26
576000 -- (-1184.386) (-1183.443) (-1186.642) [-1182.686] * [-1183.312] (-1181.192) (-1182.950) (-1185.669) -- 0:00:26
576500 -- (-1184.989) (-1183.258) (-1184.010) [-1182.992] * [-1181.683] (-1181.208) (-1181.064) (-1185.403) -- 0:00:26
577000 -- (-1183.786) [-1183.919] (-1181.791) (-1185.665) * [-1182.804] (-1181.014) (-1183.196) (-1184.393) -- 0:00:26
577500 -- (-1182.385) (-1185.774) (-1181.386) [-1185.078] * (-1183.496) [-1183.867] (-1188.085) (-1181.748) -- 0:00:26
578000 -- (-1183.070) [-1181.315] (-1185.662) (-1187.170) * (-1180.807) (-1184.410) [-1180.420] (-1181.011) -- 0:00:26
578500 -- [-1181.567] (-1181.318) (-1183.621) (-1182.128) * [-1181.999] (-1181.765) (-1181.298) (-1182.201) -- 0:00:26
579000 -- (-1181.573) [-1181.436] (-1181.604) (-1181.643) * [-1182.493] (-1181.870) (-1181.908) (-1185.955) -- 0:00:26
579500 -- (-1181.049) (-1182.886) [-1183.942] (-1186.800) * (-1184.142) (-1180.970) (-1180.870) [-1183.791] -- 0:00:26
580000 -- (-1181.346) (-1181.414) (-1181.583) [-1185.459] * [-1182.540] (-1181.492) (-1181.310) (-1182.759) -- 0:00:26
Average standard deviation of split frequencies: 0.008423
580500 -- (-1180.951) [-1183.955] (-1181.549) (-1182.027) * (-1185.151) [-1182.073] (-1183.151) (-1182.898) -- 0:00:26
581000 -- (-1181.188) (-1182.345) (-1183.340) [-1182.263] * (-1181.046) [-1180.529] (-1180.744) (-1182.709) -- 0:00:26
581500 -- [-1181.766] (-1187.058) (-1186.029) (-1183.093) * (-1184.643) (-1183.680) [-1180.674] (-1181.380) -- 0:00:26
582000 -- (-1182.575) (-1187.491) (-1185.409) [-1182.882] * [-1183.893] (-1181.832) (-1181.461) (-1185.378) -- 0:00:26
582500 -- (-1182.945) (-1184.819) [-1180.846] (-1181.764) * (-1182.408) [-1180.613] (-1184.876) (-1184.418) -- 0:00:26
583000 -- (-1180.954) [-1181.927] (-1181.621) (-1181.779) * (-1183.650) (-1182.018) (-1190.739) [-1184.765] -- 0:00:26
583500 -- [-1183.218] (-1181.306) (-1184.126) (-1183.216) * (-1181.380) (-1187.736) (-1182.434) [-1182.344] -- 0:00:26
584000 -- (-1182.997) (-1181.724) [-1182.463] (-1180.755) * (-1181.656) (-1189.254) (-1181.897) [-1184.326] -- 0:00:26
584500 -- (-1184.165) (-1182.384) [-1181.559] (-1182.053) * (-1182.585) [-1182.270] (-1181.382) (-1183.838) -- 0:00:26
585000 -- (-1182.616) (-1181.613) (-1186.104) [-1180.937] * [-1180.712] (-1189.717) (-1181.693) (-1186.917) -- 0:00:26
Average standard deviation of split frequencies: 0.008376
585500 -- (-1181.830) (-1181.816) (-1183.360) [-1184.733] * (-1181.340) (-1183.539) (-1182.887) [-1184.428] -- 0:00:26
586000 -- (-1184.974) [-1181.526] (-1184.252) (-1187.615) * (-1180.945) (-1184.802) [-1183.350] (-1187.076) -- 0:00:26
586500 -- (-1181.871) (-1181.494) [-1181.236] (-1188.794) * (-1183.852) [-1180.317] (-1182.290) (-1186.577) -- 0:00:26
587000 -- [-1180.746] (-1183.428) (-1182.368) (-1181.817) * (-1181.242) [-1180.819] (-1182.412) (-1185.599) -- 0:00:26
587500 -- (-1183.683) [-1182.021] (-1184.017) (-1181.468) * (-1184.296) (-1184.054) [-1182.597] (-1181.498) -- 0:00:25
588000 -- (-1181.101) (-1182.817) (-1183.637) [-1181.654] * (-1182.960) (-1182.763) [-1183.378] (-1185.412) -- 0:00:25
588500 -- [-1181.781] (-1183.679) (-1184.412) (-1182.643) * (-1183.135) [-1180.686] (-1182.878) (-1182.619) -- 0:00:25
589000 -- (-1181.002) (-1182.631) (-1184.582) [-1181.647] * (-1184.768) (-1181.310) [-1181.358] (-1183.718) -- 0:00:25
589500 -- (-1183.621) (-1182.587) (-1182.140) [-1185.567] * (-1183.352) [-1183.301] (-1181.039) (-1185.751) -- 0:00:25
590000 -- (-1182.066) (-1180.456) [-1183.481] (-1183.685) * (-1182.108) (-1183.933) [-1181.986] (-1188.434) -- 0:00:25
Average standard deviation of split frequencies: 0.008403
590500 -- (-1181.549) (-1181.133) (-1183.279) [-1182.335] * [-1186.672] (-1182.233) (-1180.396) (-1187.975) -- 0:00:25
591000 -- [-1182.642] (-1184.982) (-1182.805) (-1188.340) * (-1182.469) (-1182.620) [-1182.738] (-1180.471) -- 0:00:25
591500 -- (-1182.197) (-1182.930) [-1182.344] (-1181.823) * (-1181.870) (-1181.999) (-1182.745) [-1180.789] -- 0:00:25
592000 -- (-1180.389) (-1185.510) [-1180.309] (-1183.628) * (-1183.114) (-1181.246) [-1182.005] (-1184.205) -- 0:00:25
592500 -- [-1180.828] (-1185.856) (-1181.836) (-1185.107) * (-1182.401) (-1182.065) (-1184.450) [-1183.924] -- 0:00:25
593000 -- (-1181.624) [-1181.105] (-1187.114) (-1184.090) * [-1181.326] (-1183.473) (-1180.894) (-1184.538) -- 0:00:25
593500 -- (-1187.080) [-1181.758] (-1183.465) (-1182.302) * (-1188.176) (-1183.867) [-1182.304] (-1181.991) -- 0:00:25
594000 -- (-1181.467) (-1181.455) [-1183.015] (-1185.284) * (-1187.379) (-1183.390) [-1181.337] (-1182.036) -- 0:00:25
594500 -- (-1181.578) [-1181.538] (-1182.717) (-1182.154) * (-1187.729) (-1182.360) [-1181.387] (-1186.689) -- 0:00:25
595000 -- [-1182.871] (-1182.684) (-1184.951) (-1183.214) * (-1188.323) [-1182.253] (-1181.437) (-1185.099) -- 0:00:25
Average standard deviation of split frequencies: 0.009119
595500 -- (-1182.009) [-1180.946] (-1182.886) (-1185.599) * [-1182.041] (-1184.058) (-1183.841) (-1185.093) -- 0:00:25
596000 -- (-1181.637) [-1183.442] (-1183.275) (-1184.694) * (-1180.999) (-1181.741) (-1182.656) [-1189.254] -- 0:00:25
596500 -- (-1185.793) (-1184.199) (-1181.180) [-1184.407] * [-1183.821] (-1182.582) (-1181.260) (-1182.390) -- 0:00:25
597000 -- [-1182.329] (-1185.263) (-1183.988) (-1184.487) * (-1181.886) (-1184.374) (-1181.880) [-1182.690] -- 0:00:24
597500 -- (-1182.755) (-1180.596) [-1181.831] (-1183.922) * (-1180.618) (-1188.804) (-1182.123) [-1180.456] -- 0:00:25
598000 -- (-1184.181) (-1185.368) (-1180.945) [-1181.556] * [-1182.832] (-1182.548) (-1181.533) (-1181.031) -- 0:00:25
598500 -- (-1181.809) (-1184.427) [-1183.322] (-1182.979) * (-1181.359) (-1182.282) (-1181.649) [-1180.739] -- 0:00:25
599000 -- [-1182.678] (-1183.346) (-1182.208) (-1181.505) * (-1184.129) (-1182.429) (-1184.481) [-1180.739] -- 0:00:25
599500 -- (-1184.259) (-1188.385) [-1180.410] (-1184.208) * [-1183.580] (-1181.570) (-1181.698) (-1181.215) -- 0:00:25
600000 -- (-1181.194) (-1181.434) [-1181.891] (-1181.841) * (-1184.837) (-1181.756) (-1186.737) [-1180.807] -- 0:00:25
Average standard deviation of split frequencies: 0.009074
600500 -- (-1181.876) [-1180.873] (-1189.167) (-1181.908) * (-1183.458) (-1186.057) [-1185.067] (-1184.305) -- 0:00:25
601000 -- [-1182.315] (-1183.352) (-1188.620) (-1181.908) * (-1182.198) (-1181.279) [-1182.254] (-1182.900) -- 0:00:25
601500 -- (-1182.267) (-1185.322) (-1186.239) [-1180.927] * (-1183.664) [-1181.023] (-1181.554) (-1184.006) -- 0:00:25
602000 -- (-1185.734) (-1180.578) [-1181.283] (-1182.985) * (-1182.164) (-1182.642) [-1181.604] (-1182.361) -- 0:00:25
602500 -- (-1180.887) (-1184.011) (-1185.754) [-1181.623] * (-1184.623) (-1184.436) (-1183.316) [-1183.845] -- 0:00:25
603000 -- (-1180.524) [-1186.303] (-1186.678) (-1182.447) * (-1185.088) (-1183.204) (-1182.924) [-1189.401] -- 0:00:25
603500 -- (-1181.804) [-1184.686] (-1181.206) (-1185.591) * (-1181.246) (-1186.673) (-1181.046) [-1185.313] -- 0:00:24
604000 -- (-1181.601) [-1183.937] (-1182.073) (-1182.701) * (-1182.596) (-1183.806) (-1184.922) [-1181.850] -- 0:00:24
604500 -- (-1180.868) [-1183.480] (-1182.935) (-1184.069) * (-1184.261) [-1183.713] (-1181.186) (-1183.261) -- 0:00:24
605000 -- (-1180.601) [-1182.234] (-1182.072) (-1181.379) * [-1183.400] (-1181.948) (-1185.055) (-1181.031) -- 0:00:24
Average standard deviation of split frequencies: 0.009140
605500 -- (-1182.140) (-1183.068) (-1183.959) [-1183.550] * (-1181.408) (-1182.942) [-1185.395] (-1182.510) -- 0:00:24
606000 -- (-1181.685) (-1183.544) (-1184.965) [-1181.270] * [-1180.426] (-1181.539) (-1205.282) (-1184.073) -- 0:00:24
606500 -- (-1185.997) (-1185.529) [-1182.065] (-1182.714) * [-1181.154] (-1181.439) (-1194.340) (-1185.088) -- 0:00:24
607000 -- (-1182.729) (-1183.448) (-1184.175) [-1182.430] * [-1183.448] (-1183.413) (-1182.999) (-1183.790) -- 0:00:24
607500 -- (-1181.345) [-1188.414] (-1183.574) (-1185.739) * (-1184.897) [-1182.105] (-1182.550) (-1184.717) -- 0:00:24
608000 -- [-1181.123] (-1184.137) (-1182.179) (-1184.094) * (-1183.404) (-1182.141) [-1182.607] (-1183.266) -- 0:00:24
608500 -- [-1180.611] (-1181.903) (-1187.349) (-1185.777) * [-1184.378] (-1184.039) (-1182.554) (-1185.031) -- 0:00:24
609000 -- (-1186.877) (-1182.768) (-1184.919) [-1182.844] * (-1182.942) [-1182.812] (-1180.797) (-1181.336) -- 0:00:24
609500 -- [-1183.437] (-1181.372) (-1184.437) (-1181.317) * (-1181.055) (-1180.465) (-1182.438) [-1181.271] -- 0:00:24
610000 -- (-1181.662) (-1183.763) [-1180.785] (-1182.616) * (-1183.836) [-1180.541] (-1184.610) (-1184.797) -- 0:00:24
Average standard deviation of split frequencies: 0.008926
610500 -- (-1182.430) [-1183.125] (-1182.388) (-1181.948) * (-1182.045) [-1182.223] (-1181.926) (-1180.985) -- 0:00:24
611000 -- (-1184.169) [-1181.725] (-1184.965) (-1182.783) * (-1185.862) (-1184.036) [-1182.137] (-1183.414) -- 0:00:24
611500 -- (-1185.156) [-1188.817] (-1182.163) (-1180.346) * (-1185.291) (-1184.293) [-1181.477] (-1186.676) -- 0:00:24
612000 -- (-1182.668) (-1183.090) (-1183.888) [-1181.850] * [-1180.923] (-1184.228) (-1183.316) (-1184.400) -- 0:00:24
612500 -- (-1181.642) (-1184.810) (-1185.525) [-1181.016] * (-1181.368) (-1182.594) (-1183.066) [-1180.783] -- 0:00:24
613000 -- (-1184.705) [-1182.657] (-1184.346) (-1182.508) * [-1181.071] (-1181.959) (-1181.051) (-1184.362) -- 0:00:23
613500 -- (-1183.235) [-1181.277] (-1182.674) (-1182.411) * [-1183.821] (-1182.390) (-1181.260) (-1181.062) -- 0:00:23
614000 -- (-1183.126) (-1180.710) [-1182.474] (-1182.212) * [-1181.281] (-1181.694) (-1182.900) (-1182.082) -- 0:00:24
614500 -- [-1183.614] (-1181.643) (-1181.239) (-1181.760) * (-1182.084) [-1186.430] (-1182.576) (-1183.660) -- 0:00:24
615000 -- (-1182.357) [-1185.196] (-1183.216) (-1183.163) * (-1182.603) (-1181.166) (-1184.803) [-1183.157] -- 0:00:24
Average standard deviation of split frequencies: 0.008370
615500 -- (-1181.617) [-1182.314] (-1181.409) (-1182.333) * (-1182.123) [-1182.651] (-1180.715) (-1181.448) -- 0:00:24
616000 -- (-1182.488) (-1181.380) (-1182.117) [-1182.661] * [-1182.548] (-1185.851) (-1182.107) (-1184.059) -- 0:00:24
616500 -- [-1183.208] (-1184.352) (-1181.275) (-1183.867) * (-1181.658) (-1182.906) [-1181.849] (-1184.239) -- 0:00:24
617000 -- [-1181.241] (-1186.161) (-1181.635) (-1183.502) * (-1182.789) [-1182.601] (-1181.935) (-1182.711) -- 0:00:24
617500 -- [-1183.335] (-1182.858) (-1182.454) (-1181.110) * (-1180.885) (-1181.376) [-1183.658] (-1181.840) -- 0:00:24
618000 -- [-1183.602] (-1183.635) (-1182.138) (-1182.233) * (-1185.730) [-1180.771] (-1184.684) (-1184.004) -- 0:00:24
618500 -- (-1182.656) (-1187.449) (-1188.008) [-1181.111] * (-1182.007) [-1182.035] (-1181.654) (-1183.369) -- 0:00:24
619000 -- (-1182.352) [-1183.300] (-1181.845) (-1180.538) * (-1181.584) [-1182.900] (-1181.239) (-1181.517) -- 0:00:24
619500 -- (-1183.912) [-1181.256] (-1180.628) (-1182.276) * (-1182.662) (-1182.590) (-1180.486) [-1181.923] -- 0:00:23
620000 -- (-1182.901) [-1181.896] (-1183.037) (-1180.734) * (-1185.157) (-1185.185) (-1182.238) [-1182.480] -- 0:00:23
Average standard deviation of split frequencies: 0.008260
620500 -- [-1182.914] (-1181.164) (-1182.933) (-1183.581) * (-1182.434) (-1186.425) (-1182.532) [-1181.831] -- 0:00:23
621000 -- (-1188.231) [-1182.453] (-1182.212) (-1181.219) * [-1183.170] (-1183.774) (-1183.244) (-1181.285) -- 0:00:23
621500 -- (-1181.991) (-1182.105) [-1182.384] (-1181.362) * [-1182.991] (-1182.008) (-1182.822) (-1184.734) -- 0:00:23
622000 -- (-1187.459) [-1180.833] (-1182.788) (-1182.196) * (-1182.492) (-1184.864) [-1183.056] (-1183.318) -- 0:00:23
622500 -- (-1183.395) [-1180.696] (-1183.348) (-1181.106) * (-1182.380) (-1186.264) (-1180.890) [-1183.392] -- 0:00:23
623000 -- (-1184.011) (-1181.692) [-1185.197] (-1182.114) * [-1182.485] (-1181.909) (-1181.207) (-1181.554) -- 0:00:23
623500 -- [-1184.561] (-1181.886) (-1181.137) (-1183.718) * (-1186.632) (-1182.255) (-1184.049) [-1183.867] -- 0:00:23
624000 -- (-1182.327) (-1182.291) [-1182.032] (-1181.256) * (-1183.699) (-1185.217) [-1182.991] (-1183.748) -- 0:00:23
624500 -- (-1189.133) (-1181.959) [-1184.361] (-1182.809) * (-1181.579) (-1184.421) [-1182.691] (-1181.685) -- 0:00:23
625000 -- (-1183.181) [-1183.654] (-1185.210) (-1183.170) * (-1185.754) (-1183.884) (-1181.599) [-1182.137] -- 0:00:23
Average standard deviation of split frequencies: 0.009225
625500 -- (-1182.336) (-1182.642) (-1181.660) [-1181.539] * (-1183.683) [-1183.982] (-1181.942) (-1181.654) -- 0:00:23
626000 -- (-1183.253) (-1186.550) [-1181.791] (-1182.232) * (-1181.456) (-1182.164) [-1181.487] (-1180.366) -- 0:00:23
626500 -- (-1184.228) (-1183.437) (-1181.836) [-1181.292] * [-1183.072] (-1181.716) (-1183.034) (-1181.664) -- 0:00:23
627000 -- (-1181.120) (-1182.834) [-1181.734] (-1182.000) * (-1181.145) [-1182.666] (-1180.610) (-1180.830) -- 0:00:23
627500 -- (-1183.789) (-1182.691) [-1181.532] (-1184.013) * (-1181.637) [-1184.418] (-1182.207) (-1182.849) -- 0:00:23
628000 -- (-1184.833) (-1184.630) (-1181.274) [-1183.235] * (-1181.433) (-1182.372) [-1181.313] (-1184.439) -- 0:00:23
628500 -- [-1181.827] (-1182.126) (-1186.261) (-1180.826) * (-1183.271) (-1180.903) [-1181.313] (-1182.108) -- 0:00:23
629000 -- (-1181.881) [-1180.611] (-1186.546) (-1183.619) * (-1185.217) (-1182.175) [-1181.372] (-1182.800) -- 0:00:23
629500 -- (-1181.109) (-1182.948) (-1184.803) [-1181.564] * (-1184.655) [-1185.457] (-1181.432) (-1181.368) -- 0:00:22
630000 -- (-1181.581) [-1181.028] (-1183.013) (-1181.958) * [-1184.233] (-1185.261) (-1183.760) (-1182.924) -- 0:00:23
Average standard deviation of split frequencies: 0.009297
630500 -- (-1181.776) [-1183.630] (-1182.375) (-1182.608) * [-1182.912] (-1186.737) (-1183.362) (-1182.096) -- 0:00:23
631000 -- (-1186.919) (-1185.087) [-1181.812] (-1182.133) * [-1182.110] (-1191.366) (-1183.497) (-1181.885) -- 0:00:23
631500 -- (-1182.220) (-1182.718) (-1181.335) [-1183.231] * (-1184.141) (-1181.839) (-1184.976) [-1181.809] -- 0:00:23
632000 -- (-1181.307) (-1183.605) [-1181.508] (-1182.356) * (-1182.449) [-1181.578] (-1180.751) (-1180.721) -- 0:00:23
632500 -- (-1183.709) (-1182.006) (-1183.018) [-1181.147] * (-1180.793) (-1183.315) [-1181.159] (-1183.886) -- 0:00:23
633000 -- (-1181.519) [-1181.974] (-1184.579) (-1183.945) * (-1182.341) (-1184.536) [-1181.656] (-1181.484) -- 0:00:23
633500 -- (-1181.180) (-1182.103) (-1182.182) [-1184.849] * [-1181.962] (-1182.336) (-1182.498) (-1181.981) -- 0:00:23
634000 -- (-1181.733) [-1182.108] (-1182.070) (-1183.869) * (-1181.169) (-1181.878) [-1181.488] (-1181.429) -- 0:00:23
634500 -- [-1182.809] (-1184.270) (-1182.925) (-1184.521) * (-1181.238) (-1182.426) (-1182.024) [-1185.647] -- 0:00:23
635000 -- (-1182.895) (-1187.002) [-1180.419] (-1181.503) * (-1182.177) [-1182.925] (-1181.685) (-1184.217) -- 0:00:22
Average standard deviation of split frequencies: 0.009033
635500 -- (-1182.224) (-1183.949) [-1180.403] (-1187.543) * (-1181.067) (-1181.242) (-1181.985) [-1184.636] -- 0:00:22
636000 -- [-1183.161] (-1182.713) (-1182.319) (-1184.635) * (-1182.469) (-1182.385) (-1185.585) [-1186.857] -- 0:00:22
636500 -- [-1182.048] (-1184.791) (-1183.836) (-1183.987) * (-1181.945) (-1181.262) [-1182.323] (-1184.437) -- 0:00:22
637000 -- (-1183.057) (-1183.320) (-1181.870) [-1183.382] * (-1182.210) (-1181.297) (-1182.921) [-1182.171] -- 0:00:22
637500 -- (-1181.460) (-1182.128) (-1186.028) [-1182.599] * (-1184.094) [-1181.141] (-1182.352) (-1182.303) -- 0:00:22
638000 -- [-1181.069] (-1182.865) (-1182.044) (-1183.185) * (-1184.006) (-1181.389) (-1180.968) [-1180.884] -- 0:00:22
638500 -- (-1181.417) (-1183.038) [-1181.988] (-1181.823) * (-1181.366) [-1181.406] (-1182.542) (-1180.493) -- 0:00:22
639000 -- (-1184.034) [-1184.265] (-1183.328) (-1190.086) * (-1183.964) (-1182.115) [-1184.917] (-1181.086) -- 0:00:22
639500 -- (-1181.536) (-1183.180) (-1183.157) [-1189.167] * (-1181.293) (-1186.922) [-1183.320] (-1182.412) -- 0:00:22
640000 -- [-1182.316] (-1181.521) (-1183.076) (-1182.641) * (-1181.787) (-1183.628) [-1181.994] (-1180.989) -- 0:00:22
Average standard deviation of split frequencies: 0.008738
640500 -- (-1181.128) (-1180.806) [-1181.898] (-1181.066) * (-1183.030) (-1182.510) (-1183.191) [-1181.426] -- 0:00:22
641000 -- [-1183.819] (-1180.255) (-1185.280) (-1180.650) * (-1182.837) (-1181.257) [-1181.405] (-1183.660) -- 0:00:22
641500 -- (-1181.867) [-1181.894] (-1186.239) (-1181.719) * [-1185.746] (-1182.058) (-1183.134) (-1180.881) -- 0:00:22
642000 -- (-1181.124) (-1182.117) (-1184.901) [-1181.324] * (-1182.070) (-1183.908) (-1182.242) [-1181.572] -- 0:00:22
642500 -- (-1181.872) (-1185.910) [-1182.309] (-1183.838) * (-1193.193) (-1181.607) [-1182.149] (-1181.688) -- 0:00:22
643000 -- (-1183.054) (-1182.240) [-1182.652] (-1181.961) * (-1181.736) [-1182.395] (-1182.755) (-1181.127) -- 0:00:22
643500 -- (-1185.455) (-1183.912) [-1183.517] (-1181.942) * (-1182.165) (-1181.736) (-1182.357) [-1181.175] -- 0:00:22
644000 -- (-1183.979) [-1181.551] (-1181.354) (-1180.862) * [-1182.815] (-1181.949) (-1182.610) (-1183.603) -- 0:00:22
644500 -- (-1182.598) [-1180.606] (-1182.493) (-1183.316) * (-1182.696) (-1184.001) (-1183.199) [-1183.661] -- 0:00:22
645000 -- (-1181.521) [-1182.184] (-1181.092) (-1182.712) * (-1183.222) [-1183.063] (-1182.794) (-1184.817) -- 0:00:22
Average standard deviation of split frequencies: 0.009213
645500 -- (-1181.867) (-1184.076) (-1186.517) [-1181.253] * (-1183.262) (-1183.017) (-1186.151) [-1181.601] -- 0:00:21
646000 -- (-1180.534) (-1181.854) (-1182.493) [-1183.028] * (-1183.789) [-1183.024] (-1182.414) (-1182.771) -- 0:00:21
646500 -- (-1181.261) (-1183.143) (-1184.544) [-1180.981] * (-1186.125) (-1180.664) [-1181.985] (-1184.726) -- 0:00:22
647000 -- [-1183.407] (-1187.384) (-1182.227) (-1181.205) * (-1182.022) (-1180.439) [-1184.029] (-1181.002) -- 0:00:22
647500 -- (-1184.297) [-1181.068] (-1185.598) (-1181.926) * [-1183.014] (-1182.597) (-1181.954) (-1181.088) -- 0:00:22
648000 -- (-1182.629) (-1181.299) [-1181.945] (-1186.327) * (-1180.808) (-1181.524) (-1181.324) [-1183.164] -- 0:00:22
648500 -- (-1181.630) [-1185.018] (-1183.589) (-1184.508) * (-1183.756) (-1181.593) [-1183.148] (-1187.230) -- 0:00:22
649000 -- [-1181.195] (-1180.666) (-1181.292) (-1187.351) * [-1182.995] (-1183.607) (-1182.854) (-1182.005) -- 0:00:22
649500 -- [-1182.752] (-1185.105) (-1181.862) (-1185.199) * (-1181.041) [-1183.754] (-1182.857) (-1183.677) -- 0:00:22
650000 -- (-1181.775) (-1183.482) [-1181.801] (-1182.731) * (-1181.832) [-1182.682] (-1185.423) (-1182.161) -- 0:00:22
Average standard deviation of split frequencies: 0.009328
650500 -- (-1182.469) (-1181.754) [-1184.822] (-1183.517) * (-1181.048) (-1184.068) [-1182.609] (-1183.089) -- 0:00:22
651000 -- [-1183.356] (-1184.450) (-1181.948) (-1183.216) * (-1181.033) (-1181.594) (-1186.430) [-1181.852] -- 0:00:21
651500 -- (-1181.861) (-1180.981) [-1180.859] (-1182.038) * (-1181.823) [-1183.593] (-1181.037) (-1184.835) -- 0:00:21
652000 -- (-1182.543) [-1181.838] (-1181.630) (-1182.349) * (-1183.432) (-1181.721) [-1181.447] (-1184.893) -- 0:00:21
652500 -- (-1187.243) [-1181.843] (-1184.583) (-1186.923) * (-1184.893) (-1185.587) [-1182.780] (-1183.548) -- 0:00:21
653000 -- (-1182.121) (-1180.567) (-1184.877) [-1181.353] * [-1183.850] (-1180.857) (-1181.447) (-1182.322) -- 0:00:21
653500 -- (-1182.651) (-1184.291) [-1182.429] (-1184.317) * (-1183.044) (-1183.214) [-1181.367] (-1182.159) -- 0:00:21
654000 -- (-1182.357) (-1189.174) [-1183.262] (-1182.112) * [-1182.785] (-1184.081) (-1184.276) (-1180.573) -- 0:00:21
654500 -- (-1183.010) [-1181.361] (-1181.710) (-1187.524) * (-1184.598) (-1183.449) (-1183.618) [-1180.453] -- 0:00:21
655000 -- (-1180.873) (-1181.957) [-1181.662] (-1184.687) * (-1182.525) [-1181.918] (-1183.601) (-1181.576) -- 0:00:21
Average standard deviation of split frequencies: 0.009117
655500 -- (-1183.384) (-1181.414) [-1182.495] (-1185.496) * (-1181.842) (-1184.231) [-1182.407] (-1181.572) -- 0:00:21
656000 -- (-1182.887) (-1185.266) [-1184.269] (-1181.014) * (-1182.812) (-1182.797) (-1181.914) [-1182.235] -- 0:00:21
656500 -- [-1181.943] (-1182.175) (-1185.663) (-1182.172) * (-1182.411) (-1181.377) [-1182.008] (-1184.270) -- 0:00:21
657000 -- (-1183.399) (-1182.783) [-1182.037] (-1183.912) * [-1184.589] (-1182.489) (-1182.587) (-1188.702) -- 0:00:21
657500 -- [-1182.798] (-1184.633) (-1183.797) (-1183.315) * (-1183.078) (-1181.574) (-1184.064) [-1180.968] -- 0:00:21
658000 -- [-1183.597] (-1181.965) (-1183.194) (-1184.698) * (-1185.567) (-1183.393) (-1184.375) [-1183.931] -- 0:00:21
658500 -- (-1182.918) (-1183.303) [-1182.718] (-1181.545) * (-1183.658) (-1180.847) [-1182.538] (-1183.044) -- 0:00:21
659000 -- (-1189.102) [-1181.960] (-1185.087) (-1182.586) * (-1186.047) (-1185.072) (-1184.457) [-1185.519] -- 0:00:21
659500 -- (-1184.500) [-1181.599] (-1186.872) (-1183.806) * (-1185.085) [-1183.697] (-1183.207) (-1181.122) -- 0:00:21
660000 -- (-1185.986) (-1183.721) [-1184.954] (-1183.647) * (-1186.483) (-1183.364) (-1182.276) [-1181.048] -- 0:00:21
Average standard deviation of split frequencies: 0.008830
660500 -- (-1182.707) [-1181.431] (-1182.163) (-1180.701) * (-1182.376) (-1185.291) (-1183.138) [-1181.144] -- 0:00:21
661000 -- (-1182.528) [-1183.287] (-1181.508) (-1182.248) * [-1182.113] (-1183.157) (-1182.343) (-1183.089) -- 0:00:21
661500 -- (-1189.727) [-1180.419] (-1182.063) (-1182.376) * [-1183.625] (-1182.581) (-1181.519) (-1183.979) -- 0:00:20
662000 -- [-1183.845] (-1180.696) (-1182.005) (-1182.815) * (-1181.749) (-1183.607) [-1182.660] (-1181.528) -- 0:00:20
662500 -- (-1186.298) (-1181.312) [-1182.424] (-1181.969) * (-1181.758) (-1181.444) [-1183.134] (-1181.768) -- 0:00:21
663000 -- [-1182.043] (-1184.018) (-1182.471) (-1181.241) * (-1184.394) (-1181.227) (-1182.863) [-1182.803] -- 0:00:21
663500 -- (-1183.693) [-1184.146] (-1189.881) (-1184.063) * (-1183.912) (-1190.248) (-1187.975) [-1183.177] -- 0:00:21
664000 -- [-1180.902] (-1186.681) (-1191.474) (-1182.208) * (-1181.949) (-1191.210) (-1182.872) [-1181.319] -- 0:00:21
664500 -- (-1181.859) [-1183.355] (-1190.989) (-1182.068) * (-1185.548) [-1185.138] (-1181.862) (-1182.281) -- 0:00:21
665000 -- [-1181.628] (-1183.236) (-1184.511) (-1182.474) * (-1184.922) (-1181.483) [-1182.665] (-1185.536) -- 0:00:21
Average standard deviation of split frequencies: 0.008494
665500 -- (-1180.816) [-1183.373] (-1182.194) (-1182.910) * (-1183.027) (-1182.606) [-1180.483] (-1182.039) -- 0:00:21
666000 -- (-1181.722) [-1181.979] (-1183.050) (-1183.103) * [-1184.522] (-1181.600) (-1180.350) (-1182.707) -- 0:00:21
666500 -- (-1182.947) (-1181.934) (-1181.321) [-1181.215] * [-1184.365] (-1185.456) (-1181.758) (-1180.731) -- 0:00:21
667000 -- [-1183.756] (-1181.138) (-1181.199) (-1183.032) * (-1183.220) (-1188.504) [-1189.008] (-1183.443) -- 0:00:20
667500 -- (-1182.000) (-1180.998) [-1182.998] (-1182.767) * (-1181.194) [-1183.151] (-1182.261) (-1187.697) -- 0:00:20
668000 -- [-1182.370] (-1181.226) (-1183.462) (-1183.578) * [-1181.433] (-1182.690) (-1180.782) (-1187.260) -- 0:00:20
668500 -- [-1182.492] (-1184.630) (-1183.662) (-1181.626) * (-1187.915) [-1181.745] (-1181.125) (-1182.928) -- 0:00:20
669000 -- [-1184.044] (-1183.099) (-1182.818) (-1182.671) * (-1182.394) [-1180.651] (-1184.112) (-1181.284) -- 0:00:20
669500 -- (-1182.090) [-1183.348] (-1182.015) (-1181.712) * (-1183.147) (-1184.207) [-1180.160] (-1181.493) -- 0:00:20
670000 -- [-1183.636] (-1181.668) (-1183.117) (-1181.170) * [-1182.440] (-1185.202) (-1181.834) (-1181.452) -- 0:00:20
Average standard deviation of split frequencies: 0.008391
670500 -- (-1183.751) (-1184.755) [-1181.862] (-1181.694) * (-1184.079) (-1186.891) (-1182.532) [-1182.118] -- 0:00:20
671000 -- [-1182.481] (-1182.790) (-1182.934) (-1182.841) * (-1183.136) [-1183.191] (-1180.877) (-1181.524) -- 0:00:20
671500 -- (-1183.608) (-1180.684) [-1182.419] (-1182.527) * (-1181.466) (-1181.809) [-1182.497] (-1181.292) -- 0:00:20
672000 -- (-1183.804) (-1184.523) (-1181.485) [-1180.883] * (-1183.787) (-1184.780) [-1182.177] (-1186.373) -- 0:00:20
672500 -- [-1187.682] (-1182.222) (-1185.024) (-1180.182) * [-1180.991] (-1181.132) (-1183.586) (-1186.944) -- 0:00:20
673000 -- (-1182.158) (-1180.515) (-1181.552) [-1180.830] * [-1182.030] (-1181.776) (-1185.945) (-1182.919) -- 0:00:20
673500 -- (-1182.133) (-1181.299) [-1181.744] (-1182.221) * (-1181.272) (-1182.419) (-1188.713) [-1181.206] -- 0:00:20
674000 -- (-1186.354) (-1181.843) [-1181.650] (-1182.529) * (-1180.808) (-1182.488) [-1183.455] (-1184.114) -- 0:00:20
674500 -- (-1183.049) [-1181.468] (-1181.881) (-1181.865) * [-1182.987] (-1183.868) (-1182.567) (-1184.034) -- 0:00:20
675000 -- [-1185.047] (-1182.080) (-1184.746) (-1180.662) * (-1185.818) (-1183.335) [-1181.808] (-1182.947) -- 0:00:20
Average standard deviation of split frequencies: 0.008368
675500 -- (-1184.001) (-1188.916) (-1182.030) [-1180.384] * [-1183.584] (-1183.679) (-1182.287) (-1180.246) -- 0:00:20
676000 -- (-1181.046) (-1185.430) (-1184.527) [-1182.492] * [-1181.655] (-1181.810) (-1183.925) (-1185.011) -- 0:00:20
676500 -- (-1182.941) (-1182.184) (-1183.907) [-1183.675] * (-1186.475) (-1182.755) [-1180.502] (-1183.898) -- 0:00:20
677000 -- (-1183.199) [-1188.051] (-1183.392) (-1182.307) * (-1185.245) [-1181.609] (-1183.241) (-1181.884) -- 0:00:20
677500 -- [-1182.781] (-1183.640) (-1182.489) (-1183.459) * (-1183.214) [-1180.603] (-1183.947) (-1181.662) -- 0:00:19
678000 -- (-1182.926) (-1183.142) [-1182.164] (-1184.985) * [-1181.594] (-1181.075) (-1185.366) (-1184.632) -- 0:00:19
678500 -- (-1185.173) [-1182.457] (-1190.598) (-1181.834) * (-1186.566) [-1186.114] (-1182.951) (-1184.612) -- 0:00:19
679000 -- (-1183.979) (-1184.606) (-1182.303) [-1182.611] * [-1183.529] (-1183.596) (-1182.438) (-1183.090) -- 0:00:20
679500 -- (-1183.072) [-1188.042] (-1183.616) (-1183.554) * [-1184.419] (-1181.721) (-1182.244) (-1184.051) -- 0:00:20
680000 -- (-1183.276) (-1187.799) [-1182.287] (-1181.160) * (-1182.130) [-1183.714] (-1182.404) (-1181.331) -- 0:00:20
Average standard deviation of split frequencies: 0.008570
680500 -- (-1183.821) (-1185.804) [-1181.635] (-1183.088) * [-1184.488] (-1185.069) (-1181.228) (-1181.194) -- 0:00:20
681000 -- [-1184.556] (-1182.619) (-1180.956) (-1181.948) * (-1181.319) (-1182.652) [-1181.666] (-1180.981) -- 0:00:20
681500 -- (-1181.949) (-1181.594) [-1184.680] (-1180.555) * (-1181.881) (-1185.459) (-1181.695) [-1181.427] -- 0:00:20
682000 -- (-1182.752) [-1183.707] (-1181.112) (-1181.659) * (-1187.579) (-1183.335) (-1181.856) [-1182.542] -- 0:00:20
682500 -- [-1181.364] (-1180.892) (-1183.773) (-1183.305) * (-1184.581) (-1180.781) (-1183.413) [-1182.573] -- 0:00:20
683000 -- (-1186.668) [-1184.211] (-1183.918) (-1183.431) * (-1184.151) (-1182.655) (-1183.606) [-1180.797] -- 0:00:19
683500 -- [-1181.678] (-1182.831) (-1181.888) (-1184.667) * (-1181.967) (-1182.650) [-1181.657] (-1184.695) -- 0:00:19
684000 -- (-1183.608) (-1183.029) [-1182.182] (-1184.070) * (-1182.432) (-1182.790) (-1182.521) [-1183.256] -- 0:00:19
684500 -- [-1182.649] (-1182.555) (-1181.775) (-1183.632) * (-1182.994) (-1182.585) [-1181.833] (-1181.447) -- 0:00:19
685000 -- (-1182.906) (-1181.245) (-1182.657) [-1182.216] * [-1181.407] (-1182.657) (-1183.353) (-1182.454) -- 0:00:19
Average standard deviation of split frequencies: 0.008332
685500 -- (-1181.505) (-1181.405) [-1182.993] (-1183.653) * (-1183.711) (-1187.277) (-1184.612) [-1182.052] -- 0:00:19
686000 -- [-1180.952] (-1190.801) (-1183.210) (-1184.615) * (-1181.711) [-1182.589] (-1181.317) (-1181.189) -- 0:00:19
686500 -- (-1183.207) [-1183.099] (-1180.893) (-1181.674) * [-1184.478] (-1182.109) (-1182.262) (-1184.169) -- 0:00:19
687000 -- (-1183.060) [-1184.178] (-1186.602) (-1181.722) * (-1185.136) (-1184.432) (-1184.238) [-1180.791] -- 0:00:19
687500 -- (-1183.092) [-1183.512] (-1181.324) (-1186.492) * (-1182.576) [-1181.334] (-1182.075) (-1187.815) -- 0:00:19
688000 -- (-1182.025) [-1185.926] (-1180.903) (-1183.607) * (-1186.147) (-1181.923) (-1180.658) [-1183.890] -- 0:00:19
688500 -- [-1182.823] (-1187.354) (-1180.608) (-1181.226) * (-1185.063) (-1181.688) (-1181.368) [-1184.893] -- 0:00:19
689000 -- [-1180.927] (-1188.151) (-1182.046) (-1187.864) * [-1181.394] (-1184.573) (-1181.747) (-1182.253) -- 0:00:19
689500 -- (-1180.572) (-1182.131) (-1182.696) [-1181.022] * [-1181.507] (-1180.630) (-1183.864) (-1182.386) -- 0:00:19
690000 -- (-1183.124) [-1182.667] (-1183.401) (-1182.134) * [-1180.963] (-1185.287) (-1187.590) (-1183.732) -- 0:00:19
Average standard deviation of split frequencies: 0.008318
690500 -- (-1183.651) [-1182.115] (-1182.805) (-1182.442) * (-1181.339) (-1184.879) (-1183.102) [-1180.989] -- 0:00:19
691000 -- (-1187.341) [-1183.584] (-1182.171) (-1182.262) * (-1181.114) (-1181.298) [-1180.639] (-1182.442) -- 0:00:19
691500 -- (-1186.332) (-1191.960) (-1180.630) [-1182.128] * [-1181.884] (-1181.348) (-1181.342) (-1182.903) -- 0:00:19
692000 -- [-1182.779] (-1190.110) (-1182.707) (-1186.179) * (-1183.722) (-1185.224) (-1181.374) [-1181.979] -- 0:00:19
692500 -- (-1182.770) (-1188.297) [-1182.618] (-1181.370) * [-1181.726] (-1184.448) (-1181.184) (-1180.940) -- 0:00:19
693000 -- [-1183.692] (-1183.818) (-1183.613) (-1181.450) * (-1183.258) (-1183.201) [-1180.348] (-1181.155) -- 0:00:19
693500 -- (-1182.021) [-1183.469] (-1181.741) (-1181.326) * (-1187.698) (-1184.965) (-1181.393) [-1181.420] -- 0:00:19
694000 -- [-1180.789] (-1180.848) (-1181.569) (-1180.476) * (-1184.014) (-1180.554) [-1182.284] (-1181.147) -- 0:00:18
694500 -- [-1181.159] (-1181.772) (-1180.689) (-1181.371) * [-1180.522] (-1184.014) (-1186.915) (-1182.416) -- 0:00:18
695000 -- (-1188.825) (-1184.260) [-1183.169] (-1181.985) * (-1182.268) (-1186.686) (-1183.823) [-1182.208] -- 0:00:19
Average standard deviation of split frequencies: 0.008424
695500 -- (-1181.319) (-1181.718) (-1185.220) [-1183.295] * (-1182.371) (-1190.768) (-1181.384) [-1186.003] -- 0:00:19
696000 -- (-1182.948) (-1181.254) [-1185.309] (-1181.520) * (-1181.811) (-1187.265) (-1181.487) [-1182.903] -- 0:00:19
696500 -- (-1182.880) (-1181.296) [-1183.087] (-1182.085) * (-1180.771) (-1181.596) (-1183.886) [-1183.816] -- 0:00:19
697000 -- (-1182.947) (-1181.441) (-1182.256) [-1184.813] * (-1182.547) [-1181.234] (-1183.253) (-1180.882) -- 0:00:19
697500 -- [-1181.436] (-1183.629) (-1182.447) (-1181.142) * (-1182.205) (-1184.222) [-1182.803] (-1181.607) -- 0:00:19
698000 -- (-1181.714) (-1183.017) (-1181.483) [-1181.219] * (-1184.628) (-1182.962) [-1181.502] (-1182.231) -- 0:00:19
698500 -- (-1183.308) (-1181.732) [-1182.204] (-1183.473) * (-1183.493) [-1182.127] (-1181.358) (-1181.667) -- 0:00:18
699000 -- [-1185.444] (-1181.034) (-1180.591) (-1181.538) * [-1186.095] (-1182.557) (-1185.603) (-1184.010) -- 0:00:18
699500 -- (-1184.867) (-1182.005) (-1182.086) [-1182.966] * (-1180.998) (-1182.017) (-1183.348) [-1181.812] -- 0:00:18
700000 -- (-1184.985) (-1181.182) (-1182.501) [-1183.609] * (-1181.880) [-1184.605] (-1181.259) (-1182.337) -- 0:00:18
Average standard deviation of split frequencies: 0.008830
700500 -- (-1185.124) (-1183.327) (-1182.634) [-1187.868] * (-1184.214) (-1185.673) (-1182.268) [-1183.965] -- 0:00:18
701000 -- [-1185.250] (-1181.363) (-1182.154) (-1183.010) * (-1182.422) [-1184.898] (-1183.876) (-1184.436) -- 0:00:18
701500 -- (-1182.951) [-1183.329] (-1182.672) (-1181.581) * [-1183.097] (-1183.310) (-1186.353) (-1186.477) -- 0:00:18
702000 -- (-1184.005) (-1183.260) (-1183.159) [-1182.838] * (-1182.306) (-1182.924) [-1183.046] (-1183.043) -- 0:00:18
702500 -- (-1184.332) (-1181.018) [-1180.633] (-1182.544) * (-1184.766) (-1183.478) (-1182.888) [-1186.426] -- 0:00:18
703000 -- (-1190.077) [-1180.684] (-1182.859) (-1182.770) * (-1181.202) (-1180.889) (-1188.401) [-1182.125] -- 0:00:18
703500 -- (-1182.608) [-1182.645] (-1183.110) (-1181.961) * [-1181.273] (-1181.162) (-1183.675) (-1182.620) -- 0:00:18
704000 -- (-1183.338) (-1181.394) [-1187.050] (-1187.122) * (-1181.889) (-1181.438) (-1184.580) [-1180.708] -- 0:00:18
704500 -- (-1182.178) [-1184.027] (-1186.883) (-1182.657) * (-1183.802) [-1182.675] (-1181.177) (-1180.606) -- 0:00:18
705000 -- [-1184.665] (-1182.112) (-1182.356) (-1182.104) * (-1182.946) (-1181.654) (-1182.038) [-1181.042] -- 0:00:18
Average standard deviation of split frequencies: 0.008931
705500 -- (-1182.177) [-1183.565] (-1186.159) (-1181.140) * (-1184.163) (-1181.680) [-1184.191] (-1180.945) -- 0:00:18
706000 -- (-1181.743) (-1180.640) (-1182.251) [-1181.752] * [-1183.758] (-1182.138) (-1182.768) (-1180.279) -- 0:00:18
706500 -- [-1183.360] (-1181.043) (-1183.893) (-1183.195) * (-1181.933) (-1186.539) [-1180.339] (-1183.147) -- 0:00:18
707000 -- (-1182.968) [-1182.340] (-1180.879) (-1182.024) * (-1181.014) (-1184.507) (-1180.338) [-1181.094] -- 0:00:18
707500 -- [-1186.752] (-1181.810) (-1186.195) (-1183.967) * [-1181.112] (-1185.918) (-1186.615) (-1183.852) -- 0:00:18
708000 -- (-1185.253) (-1184.203) (-1187.646) [-1183.760] * (-1182.108) [-1181.768] (-1189.167) (-1183.816) -- 0:00:18
708500 -- (-1182.612) [-1183.027] (-1182.314) (-1181.602) * (-1181.376) (-1186.416) (-1182.482) [-1186.227] -- 0:00:18
709000 -- (-1180.911) [-1183.016] (-1181.152) (-1180.928) * (-1181.417) (-1189.722) (-1185.130) [-1182.254] -- 0:00:18
709500 -- (-1185.662) (-1182.372) (-1182.792) [-1182.457] * (-1181.413) (-1186.921) (-1182.218) [-1186.197] -- 0:00:18
710000 -- [-1181.152] (-1182.356) (-1182.886) (-1182.430) * [-1180.824] (-1183.611) (-1185.286) (-1188.945) -- 0:00:17
Average standard deviation of split frequencies: 0.009121
710500 -- (-1183.138) (-1182.084) [-1181.233] (-1180.960) * (-1182.597) (-1182.542) [-1183.758] (-1180.919) -- 0:00:17
711000 -- [-1180.771] (-1183.250) (-1185.800) (-1180.365) * (-1183.635) (-1183.086) (-1184.159) [-1184.265] -- 0:00:18
711500 -- (-1181.623) (-1184.457) [-1182.142] (-1187.841) * [-1181.174] (-1183.441) (-1184.232) (-1181.294) -- 0:00:18
712000 -- (-1181.049) [-1182.504] (-1182.544) (-1182.936) * (-1182.542) [-1181.777] (-1182.342) (-1184.582) -- 0:00:18
712500 -- (-1181.354) (-1181.538) (-1187.531) [-1181.940] * (-1181.285) (-1181.931) [-1182.752] (-1182.805) -- 0:00:18
713000 -- (-1180.823) (-1180.866) [-1181.539] (-1183.460) * (-1181.462) [-1183.057] (-1183.620) (-1182.880) -- 0:00:18
713500 -- (-1182.546) (-1181.982) (-1181.248) [-1181.536] * (-1182.863) (-1183.378) [-1182.322] (-1184.355) -- 0:00:18
714000 -- (-1187.241) [-1185.890] (-1181.879) (-1181.216) * (-1183.349) [-1181.166] (-1186.074) (-1184.682) -- 0:00:18
714500 -- (-1194.943) [-1181.830] (-1183.455) (-1181.223) * (-1186.860) (-1188.083) (-1185.382) [-1181.446] -- 0:00:17
715000 -- [-1184.491] (-1182.460) (-1183.296) (-1182.214) * (-1184.300) [-1180.587] (-1196.391) (-1180.791) -- 0:00:17
Average standard deviation of split frequencies: 0.009135
715500 -- (-1184.368) (-1181.551) [-1182.845] (-1184.810) * (-1188.097) [-1184.288] (-1192.485) (-1182.936) -- 0:00:17
716000 -- [-1187.057] (-1181.713) (-1186.208) (-1181.226) * [-1181.664] (-1186.355) (-1183.766) (-1181.420) -- 0:00:17
716500 -- [-1184.008] (-1184.797) (-1183.340) (-1182.709) * (-1181.933) (-1188.952) [-1181.997] (-1180.967) -- 0:00:17
717000 -- (-1182.920) (-1182.514) (-1182.586) [-1180.560] * (-1189.038) [-1183.480] (-1181.454) (-1180.714) -- 0:00:17
717500 -- [-1181.160] (-1185.257) (-1184.921) (-1180.664) * (-1184.562) [-1182.836] (-1181.776) (-1181.250) -- 0:00:17
718000 -- [-1180.542] (-1184.140) (-1184.175) (-1180.607) * [-1183.521] (-1184.549) (-1182.384) (-1181.839) -- 0:00:17
718500 -- (-1180.510) [-1183.227] (-1180.825) (-1183.265) * (-1182.867) (-1184.576) (-1182.560) [-1182.362] -- 0:00:17
719000 -- (-1180.865) (-1181.647) (-1181.279) [-1183.339] * (-1180.892) (-1180.837) [-1181.813] (-1182.536) -- 0:00:17
719500 -- [-1185.611] (-1183.163) (-1180.997) (-1182.559) * (-1180.318) (-1180.831) [-1184.577] (-1181.393) -- 0:00:17
720000 -- (-1186.566) (-1181.877) [-1184.961] (-1181.945) * (-1185.941) [-1181.139] (-1180.385) (-1186.808) -- 0:00:17
Average standard deviation of split frequencies: 0.009199
720500 -- (-1186.507) [-1182.865] (-1181.569) (-1181.806) * (-1185.102) (-1181.749) [-1181.762] (-1181.751) -- 0:00:17
721000 -- (-1181.051) (-1182.817) [-1183.233] (-1180.752) * (-1184.601) [-1182.006] (-1182.312) (-1184.171) -- 0:00:17
721500 -- (-1183.686) (-1182.908) (-1180.753) [-1180.848] * (-1184.456) (-1185.508) (-1181.860) [-1183.300] -- 0:00:17
722000 -- (-1184.532) [-1181.410] (-1181.559) (-1181.915) * (-1183.753) [-1183.535] (-1182.092) (-1182.812) -- 0:00:17
722500 -- (-1183.852) (-1185.552) (-1182.704) [-1182.440] * (-1186.331) (-1181.693) [-1184.124] (-1182.142) -- 0:00:17
723000 -- (-1182.084) (-1182.486) [-1182.608] (-1182.141) * (-1184.355) [-1182.540] (-1180.990) (-1184.755) -- 0:00:17
723500 -- (-1182.527) [-1181.527] (-1182.146) (-1181.104) * (-1183.062) [-1184.075] (-1182.078) (-1184.625) -- 0:00:17
724000 -- [-1182.505] (-1182.487) (-1180.793) (-1181.655) * [-1187.950] (-1183.521) (-1183.282) (-1183.638) -- 0:00:17
724500 -- [-1182.200] (-1182.802) (-1180.679) (-1184.216) * (-1184.139) (-1182.066) (-1182.911) [-1181.883] -- 0:00:17
725000 -- [-1181.818] (-1180.652) (-1181.058) (-1187.119) * [-1184.907] (-1182.130) (-1181.792) (-1181.750) -- 0:00:17
Average standard deviation of split frequencies: 0.008766
725500 -- (-1181.437) (-1181.117) [-1181.645] (-1187.402) * (-1182.529) (-1181.200) (-1181.489) [-1181.448] -- 0:00:17
726000 -- [-1182.291] (-1181.983) (-1185.676) (-1185.288) * (-1184.867) [-1180.904] (-1185.481) (-1181.296) -- 0:00:16
726500 -- (-1181.818) (-1184.718) [-1189.143] (-1185.063) * [-1183.465] (-1182.529) (-1181.715) (-1185.809) -- 0:00:16
727000 -- [-1184.209] (-1180.996) (-1183.277) (-1184.968) * [-1180.527] (-1184.429) (-1183.141) (-1182.570) -- 0:00:16
727500 -- (-1183.695) (-1180.600) (-1183.710) [-1183.286] * (-1180.538) (-1182.976) (-1182.669) [-1181.549] -- 0:00:17
728000 -- (-1182.326) (-1182.294) (-1188.797) [-1182.897] * [-1181.050] (-1182.626) (-1183.031) (-1180.933) -- 0:00:17
728500 -- (-1182.538) (-1182.984) (-1181.474) [-1184.491] * (-1182.146) [-1182.127] (-1183.656) (-1185.890) -- 0:00:17
729000 -- [-1184.900] (-1183.099) (-1182.751) (-1184.408) * (-1182.173) (-1184.236) [-1183.510] (-1185.227) -- 0:00:17
729500 -- (-1181.678) [-1182.735] (-1187.750) (-1183.634) * (-1183.033) (-1183.805) (-1183.874) [-1184.639] -- 0:00:17
730000 -- [-1181.866] (-1184.598) (-1182.397) (-1184.356) * (-1183.850) (-1182.781) (-1181.239) [-1182.520] -- 0:00:17
Average standard deviation of split frequencies: 0.008871
730500 -- [-1186.287] (-1181.399) (-1181.787) (-1184.916) * [-1184.950] (-1184.203) (-1181.282) (-1185.841) -- 0:00:16
731000 -- (-1184.298) (-1182.349) [-1182.385] (-1181.571) * [-1181.978] (-1181.290) (-1181.668) (-1182.200) -- 0:00:16
731500 -- (-1183.825) (-1181.755) [-1184.131] (-1181.340) * (-1182.302) (-1181.272) [-1181.024] (-1183.692) -- 0:00:16
732000 -- (-1180.903) (-1182.442) (-1186.008) [-1181.287] * (-1180.837) (-1183.165) [-1184.372] (-1183.545) -- 0:00:16
732500 -- (-1183.202) (-1182.634) (-1181.730) [-1183.230] * (-1181.925) (-1183.095) (-1183.951) [-1186.432] -- 0:00:16
733000 -- [-1182.794] (-1182.066) (-1182.293) (-1182.685) * [-1181.452] (-1188.330) (-1182.309) (-1183.859) -- 0:00:16
733500 -- (-1181.627) [-1182.269] (-1180.821) (-1185.375) * (-1181.765) (-1183.734) (-1182.249) [-1186.060] -- 0:00:16
734000 -- (-1182.309) [-1184.482] (-1181.722) (-1185.939) * (-1182.975) (-1182.489) [-1181.399] (-1185.579) -- 0:00:16
734500 -- [-1181.763] (-1185.126) (-1181.397) (-1182.073) * (-1181.392) [-1182.154] (-1180.813) (-1183.405) -- 0:00:16
735000 -- (-1182.543) [-1183.177] (-1181.830) (-1182.750) * [-1182.204] (-1181.563) (-1182.070) (-1181.158) -- 0:00:16
Average standard deviation of split frequencies: 0.008567
735500 -- [-1182.854] (-1180.567) (-1181.009) (-1183.341) * (-1183.881) [-1183.078] (-1181.537) (-1180.381) -- 0:00:16
736000 -- (-1181.411) (-1181.124) [-1181.624] (-1186.863) * (-1182.259) (-1180.724) (-1183.608) [-1182.239] -- 0:00:16
736500 -- (-1181.878) (-1180.803) [-1181.362] (-1188.502) * [-1182.471] (-1181.805) (-1183.584) (-1183.557) -- 0:00:16
737000 -- (-1181.755) (-1182.282) [-1185.293] (-1183.287) * [-1187.701] (-1182.274) (-1183.237) (-1184.274) -- 0:00:16
737500 -- [-1182.727] (-1180.818) (-1181.735) (-1183.817) * (-1187.368) (-1182.178) [-1184.783] (-1183.466) -- 0:00:16
738000 -- [-1183.589] (-1187.131) (-1181.187) (-1184.369) * (-1186.554) (-1181.978) [-1180.564] (-1185.459) -- 0:00:16
738500 -- (-1182.414) [-1182.057] (-1180.935) (-1183.972) * (-1183.430) (-1182.471) (-1180.775) [-1182.532] -- 0:00:16
739000 -- [-1182.798] (-1181.712) (-1181.004) (-1182.988) * (-1182.809) (-1183.656) [-1181.919] (-1187.668) -- 0:00:16
739500 -- (-1183.736) (-1181.269) (-1181.978) [-1182.401] * (-1183.556) (-1181.033) (-1184.003) [-1182.319] -- 0:00:16
740000 -- [-1181.560] (-1183.742) (-1182.645) (-1182.855) * (-1181.335) [-1182.204] (-1183.278) (-1184.069) -- 0:00:16
Average standard deviation of split frequencies: 0.008393
740500 -- (-1182.015) (-1184.394) [-1180.682] (-1182.485) * (-1183.548) (-1184.745) (-1185.443) [-1182.234] -- 0:00:16
741000 -- (-1183.776) (-1186.105) [-1182.324] (-1182.279) * (-1184.963) (-1185.380) [-1181.922] (-1183.594) -- 0:00:16
741500 -- (-1181.613) (-1181.825) [-1182.414] (-1182.841) * (-1183.633) (-1186.260) (-1185.891) [-1182.657] -- 0:00:16
742000 -- (-1180.481) (-1183.100) (-1181.218) [-1181.467] * (-1182.796) (-1184.718) (-1183.005) [-1183.576] -- 0:00:15
742500 -- (-1180.767) (-1183.016) (-1185.093) [-1182.220] * (-1182.312) [-1181.987] (-1183.224) (-1183.268) -- 0:00:15
743000 -- [-1180.280] (-1181.574) (-1184.188) (-1182.645) * (-1182.204) [-1182.867] (-1185.450) (-1184.867) -- 0:00:15
743500 -- (-1180.689) (-1180.874) [-1182.926] (-1183.014) * (-1181.155) (-1183.103) (-1181.497) [-1181.731] -- 0:00:16
744000 -- (-1182.229) (-1182.548) (-1186.940) [-1181.322] * (-1180.433) (-1181.417) [-1180.376] (-1182.051) -- 0:00:16
744500 -- [-1180.798] (-1183.067) (-1184.225) (-1182.474) * [-1185.029] (-1183.406) (-1182.471) (-1180.846) -- 0:00:16
745000 -- (-1187.972) (-1185.597) [-1181.053] (-1185.159) * [-1183.192] (-1185.569) (-1183.600) (-1182.475) -- 0:00:16
Average standard deviation of split frequencies: 0.008570
745500 -- (-1185.000) (-1184.405) [-1181.330] (-1183.605) * (-1183.007) (-1185.785) (-1180.772) [-1180.504] -- 0:00:16
746000 -- (-1183.688) [-1181.844] (-1181.053) (-1183.592) * (-1184.757) [-1184.677] (-1186.222) (-1183.150) -- 0:00:16
746500 -- (-1182.289) (-1182.366) (-1182.069) [-1188.946] * [-1184.676] (-1184.006) (-1182.987) (-1182.244) -- 0:00:15
747000 -- (-1184.264) (-1181.388) (-1184.254) [-1183.833] * (-1181.801) (-1183.295) [-1184.300] (-1190.989) -- 0:00:15
747500 -- (-1182.513) (-1184.063) (-1184.029) [-1181.078] * (-1184.730) (-1183.019) [-1183.178] (-1180.761) -- 0:00:15
748000 -- [-1181.426] (-1182.847) (-1183.647) (-1181.318) * (-1184.809) [-1181.331] (-1182.155) (-1180.677) -- 0:00:15
748500 -- (-1181.536) (-1181.588) (-1182.423) [-1181.848] * (-1183.760) [-1182.702] (-1180.916) (-1181.202) -- 0:00:15
749000 -- (-1182.324) [-1181.117] (-1180.557) (-1183.252) * [-1183.355] (-1180.487) (-1180.827) (-1182.640) -- 0:00:15
749500 -- [-1184.273] (-1182.321) (-1181.530) (-1182.089) * (-1184.117) [-1183.695] (-1182.971) (-1186.540) -- 0:00:15
750000 -- (-1182.947) (-1181.663) [-1181.711] (-1182.836) * (-1181.922) (-1186.642) (-1180.267) [-1184.526] -- 0:00:15
Average standard deviation of split frequencies: 0.008870
750500 -- (-1181.298) (-1182.593) [-1185.704] (-1182.024) * [-1186.987] (-1182.656) (-1182.209) (-1184.879) -- 0:00:15
751000 -- (-1183.757) (-1182.824) [-1184.227] (-1181.439) * [-1181.612] (-1184.114) (-1183.285) (-1189.067) -- 0:00:15
751500 -- [-1184.755] (-1184.180) (-1183.174) (-1181.515) * (-1185.082) (-1183.198) (-1181.754) [-1181.567] -- 0:00:15
752000 -- (-1184.286) (-1183.834) (-1181.615) [-1181.875] * (-1187.052) (-1183.919) (-1184.754) [-1181.956] -- 0:00:15
752500 -- (-1184.115) [-1182.208] (-1181.832) (-1182.830) * (-1185.567) [-1183.151] (-1181.666) (-1185.285) -- 0:00:15
753000 -- (-1189.311) (-1183.951) (-1181.705) [-1182.424] * (-1181.315) [-1181.640] (-1184.636) (-1182.354) -- 0:00:15
753500 -- (-1184.096) (-1182.582) (-1181.897) [-1183.950] * (-1181.102) [-1186.069] (-1186.792) (-1181.395) -- 0:00:15
754000 -- [-1181.016] (-1181.329) (-1183.194) (-1185.642) * (-1180.973) [-1182.505] (-1187.006) (-1180.911) -- 0:00:15
754500 -- (-1180.930) (-1181.903) (-1184.302) [-1184.259] * (-1180.563) (-1181.678) [-1181.797] (-1181.651) -- 0:00:15
755000 -- [-1181.419] (-1185.344) (-1181.585) (-1181.366) * (-1181.187) (-1181.140) (-1181.209) [-1184.782] -- 0:00:15
Average standard deviation of split frequencies: 0.008808
755500 -- (-1185.757) (-1183.856) [-1184.407] (-1181.432) * (-1181.148) (-1182.133) (-1181.341) [-1182.235] -- 0:00:15
756000 -- [-1181.852] (-1182.610) (-1185.294) (-1184.125) * (-1184.015) [-1182.301] (-1181.917) (-1181.527) -- 0:00:15
756500 -- (-1182.837) [-1183.279] (-1181.623) (-1181.466) * (-1183.190) (-1192.710) [-1181.775] (-1183.460) -- 0:00:15
757000 -- (-1182.033) (-1183.642) [-1181.447] (-1182.173) * [-1182.098] (-1182.459) (-1182.201) (-1185.154) -- 0:00:15
757500 -- [-1180.997] (-1184.537) (-1182.208) (-1181.524) * (-1190.436) [-1183.498] (-1185.492) (-1182.752) -- 0:00:15
758000 -- (-1180.756) [-1183.755] (-1181.941) (-1182.499) * (-1184.502) (-1183.717) [-1182.071] (-1183.812) -- 0:00:15
758500 -- [-1183.604] (-1180.765) (-1182.394) (-1183.840) * [-1183.561] (-1185.004) (-1183.775) (-1183.480) -- 0:00:14
759000 -- (-1181.582) (-1181.441) (-1182.204) [-1187.913] * [-1185.541] (-1183.072) (-1183.416) (-1180.960) -- 0:00:14
759500 -- (-1182.411) (-1180.844) (-1187.842) [-1184.840] * [-1180.674] (-1182.836) (-1182.503) (-1181.279) -- 0:00:15
760000 -- (-1182.111) [-1181.240] (-1186.513) (-1184.670) * (-1181.047) [-1182.293] (-1180.507) (-1185.476) -- 0:00:15
Average standard deviation of split frequencies: 0.008560
760500 -- (-1181.542) (-1181.653) [-1184.869] (-1183.488) * (-1183.849) (-1181.144) [-1182.900] (-1185.398) -- 0:00:15
761000 -- (-1183.724) (-1183.390) [-1181.945] (-1182.877) * (-1184.335) (-1181.760) (-1182.313) [-1183.311] -- 0:00:15
761500 -- [-1181.398] (-1182.832) (-1182.608) (-1180.597) * (-1180.622) (-1182.665) (-1180.865) [-1185.915] -- 0:00:15
762000 -- [-1184.222] (-1180.440) (-1181.963) (-1180.796) * (-1181.272) (-1182.105) (-1183.610) [-1183.672] -- 0:00:14
762500 -- (-1182.607) (-1181.381) [-1181.552] (-1180.844) * (-1180.856) (-1182.095) (-1186.055) [-1184.181] -- 0:00:14
763000 -- (-1181.235) (-1180.882) [-1185.883] (-1188.403) * [-1181.889] (-1184.709) (-1190.605) (-1183.703) -- 0:00:14
763500 -- (-1184.989) (-1182.078) (-1181.917) [-1183.076] * (-1183.975) (-1181.531) [-1184.578] (-1181.637) -- 0:00:14
764000 -- (-1183.845) [-1181.689] (-1181.877) (-1184.963) * (-1184.089) [-1180.790] (-1182.479) (-1187.505) -- 0:00:14
764500 -- (-1182.532) [-1181.890] (-1180.928) (-1185.572) * (-1183.020) (-1182.527) (-1187.020) [-1180.867] -- 0:00:14
765000 -- (-1183.905) (-1182.981) [-1182.282] (-1185.863) * (-1182.006) [-1182.268] (-1180.869) (-1185.140) -- 0:00:14
Average standard deviation of split frequencies: 0.008231
765500 -- [-1183.487] (-1183.800) (-1183.006) (-1181.026) * (-1184.000) (-1181.608) [-1184.694] (-1184.513) -- 0:00:14
766000 -- (-1181.743) [-1182.320] (-1180.618) (-1184.676) * [-1183.338] (-1180.437) (-1182.188) (-1186.024) -- 0:00:14
766500 -- [-1183.286] (-1181.808) (-1183.448) (-1188.817) * [-1181.034] (-1180.797) (-1182.859) (-1187.743) -- 0:00:14
767000 -- (-1182.605) [-1183.044] (-1184.847) (-1186.654) * (-1180.806) (-1184.220) [-1183.512] (-1182.814) -- 0:00:14
767500 -- [-1180.860] (-1181.195) (-1182.818) (-1182.945) * [-1180.793] (-1183.524) (-1182.816) (-1184.998) -- 0:00:14
768000 -- [-1184.162] (-1183.992) (-1181.437) (-1185.437) * (-1180.912) (-1182.983) (-1181.220) [-1181.787] -- 0:00:14
768500 -- (-1181.242) (-1183.229) [-1183.025] (-1181.834) * (-1180.786) (-1181.030) [-1181.280] (-1181.075) -- 0:00:14
769000 -- (-1181.369) (-1182.948) [-1182.499] (-1181.558) * [-1180.478] (-1181.928) (-1185.623) (-1180.750) -- 0:00:14
769500 -- (-1183.156) (-1184.682) [-1187.300] (-1182.168) * (-1180.412) (-1183.510) [-1184.235] (-1183.032) -- 0:00:14
770000 -- (-1183.802) (-1184.474) [-1182.140] (-1182.312) * (-1181.761) [-1181.767] (-1183.163) (-1181.387) -- 0:00:14
Average standard deviation of split frequencies: 0.008105
770500 -- [-1182.030] (-1182.184) (-1186.997) (-1181.972) * (-1181.706) (-1187.298) (-1181.712) [-1181.648] -- 0:00:14
771000 -- (-1185.639) (-1181.481) [-1184.199] (-1183.559) * [-1183.924] (-1185.720) (-1181.750) (-1184.764) -- 0:00:14
771500 -- (-1181.546) (-1180.324) [-1185.515] (-1182.172) * (-1184.119) [-1188.851] (-1180.516) (-1182.345) -- 0:00:14
772000 -- (-1182.038) [-1180.391] (-1180.221) (-1181.845) * [-1182.326] (-1180.752) (-1186.175) (-1183.052) -- 0:00:14
772500 -- (-1183.299) [-1180.308] (-1182.014) (-1183.681) * (-1181.503) [-1182.435] (-1185.223) (-1182.175) -- 0:00:14
773000 -- [-1182.145] (-1184.547) (-1183.997) (-1183.843) * (-1181.580) [-1183.866] (-1184.582) (-1183.284) -- 0:00:14
773500 -- (-1181.394) [-1180.598] (-1184.340) (-1190.581) * (-1181.299) (-1184.618) [-1182.550] (-1183.745) -- 0:00:14
774000 -- [-1183.418] (-1180.926) (-1182.366) (-1186.087) * [-1181.797] (-1183.544) (-1182.038) (-1183.939) -- 0:00:14
774500 -- (-1185.595) (-1182.891) (-1184.714) [-1186.528] * [-1183.508] (-1181.373) (-1182.669) (-1184.221) -- 0:00:13
775000 -- [-1181.963] (-1181.375) (-1183.388) (-1183.713) * (-1184.250) (-1184.658) [-1182.683] (-1184.183) -- 0:00:13
Average standard deviation of split frequencies: 0.007533
775500 -- (-1182.481) (-1181.955) [-1181.322] (-1181.458) * (-1181.190) (-1185.266) [-1185.443] (-1182.071) -- 0:00:13
776000 -- (-1181.700) [-1182.236] (-1181.284) (-1180.788) * (-1181.416) [-1181.981] (-1184.498) (-1181.309) -- 0:00:14
776500 -- (-1181.756) (-1180.664) (-1184.362) [-1180.623] * [-1182.414] (-1183.453) (-1184.419) (-1181.453) -- 0:00:14
777000 -- [-1181.592] (-1181.054) (-1181.969) (-1181.804) * (-1182.281) (-1183.338) (-1189.234) [-1183.664] -- 0:00:14
777500 -- (-1186.900) [-1181.141] (-1185.613) (-1182.361) * (-1182.522) (-1182.139) [-1186.986] (-1183.790) -- 0:00:14
778000 -- (-1181.889) (-1182.781) [-1181.608] (-1182.712) * (-1181.341) [-1181.913] (-1184.462) (-1181.047) -- 0:00:13
778500 -- (-1182.609) (-1182.425) (-1183.155) [-1182.891] * [-1184.682] (-1182.223) (-1186.001) (-1183.621) -- 0:00:13
779000 -- [-1180.838] (-1182.375) (-1182.264) (-1181.515) * (-1183.599) (-1184.249) [-1185.057] (-1184.080) -- 0:00:13
779500 -- (-1183.452) (-1184.595) [-1182.505] (-1180.772) * (-1182.759) (-1185.092) [-1182.411] (-1180.990) -- 0:00:13
780000 -- (-1184.294) (-1181.525) (-1182.719) [-1180.817] * (-1183.519) [-1181.885] (-1183.429) (-1185.052) -- 0:00:13
Average standard deviation of split frequencies: 0.007488
780500 -- (-1182.579) (-1181.733) [-1185.072] (-1182.902) * [-1183.084] (-1181.407) (-1182.573) (-1184.616) -- 0:00:13
781000 -- (-1181.518) (-1183.279) (-1183.819) [-1182.015] * [-1180.886] (-1181.184) (-1184.546) (-1181.102) -- 0:00:13
781500 -- [-1183.499] (-1183.943) (-1181.382) (-1185.427) * (-1182.273) [-1181.707] (-1184.246) (-1184.950) -- 0:00:13
782000 -- (-1183.279) (-1183.647) [-1183.560] (-1185.186) * [-1183.420] (-1182.837) (-1185.946) (-1187.297) -- 0:00:13
782500 -- (-1183.073) (-1182.515) [-1181.794] (-1183.200) * (-1181.241) (-1184.503) [-1183.966] (-1183.780) -- 0:00:13
783000 -- (-1183.644) (-1184.469) [-1181.725] (-1181.862) * (-1185.522) (-1188.769) (-1184.114) [-1180.897] -- 0:00:13
783500 -- (-1185.758) (-1183.828) [-1182.720] (-1181.811) * (-1185.089) (-1187.818) (-1182.792) [-1183.803] -- 0:00:13
784000 -- (-1186.658) (-1182.908) [-1183.653] (-1182.220) * (-1182.453) [-1183.865] (-1180.733) (-1180.555) -- 0:00:13
784500 -- (-1185.069) (-1182.945) (-1182.878) [-1185.405] * [-1183.892] (-1186.998) (-1181.068) (-1180.558) -- 0:00:13
785000 -- (-1184.099) (-1181.172) [-1182.613] (-1182.989) * (-1189.478) [-1182.421] (-1182.212) (-1183.386) -- 0:00:13
Average standard deviation of split frequencies: 0.007037
785500 -- [-1183.539] (-1182.796) (-1185.108) (-1185.637) * (-1185.031) [-1181.810] (-1181.604) (-1188.060) -- 0:00:13
786000 -- (-1181.097) (-1183.291) (-1184.642) [-1181.308] * (-1181.325) (-1184.778) [-1182.227] (-1186.151) -- 0:00:13
786500 -- (-1181.135) (-1184.604) [-1182.036] (-1182.819) * (-1183.555) [-1183.231] (-1184.725) (-1180.867) -- 0:00:13
787000 -- (-1184.569) [-1180.898] (-1180.867) (-1182.366) * [-1180.880] (-1183.728) (-1184.196) (-1181.510) -- 0:00:13
787500 -- (-1183.749) (-1183.334) [-1182.390] (-1181.169) * [-1181.671] (-1184.145) (-1183.239) (-1182.118) -- 0:00:13
788000 -- (-1186.823) [-1181.338] (-1186.734) (-1183.453) * (-1181.021) (-1183.376) [-1181.331] (-1186.678) -- 0:00:13
788500 -- (-1181.849) (-1182.419) (-1186.647) [-1183.267] * (-1184.673) [-1181.849] (-1182.251) (-1183.233) -- 0:00:13
789000 -- (-1181.457) (-1183.495) [-1182.321] (-1182.025) * (-1185.715) (-1180.529) (-1182.835) [-1182.917] -- 0:00:13
789500 -- (-1183.228) [-1183.321] (-1181.377) (-1182.817) * [-1183.418] (-1181.127) (-1182.425) (-1181.400) -- 0:00:13
790000 -- (-1184.020) [-1181.727] (-1184.148) (-1185.304) * (-1181.045) (-1181.759) [-1181.556] (-1181.458) -- 0:00:13
Average standard deviation of split frequencies: 0.006439
790500 -- (-1182.017) (-1180.977) [-1182.899] (-1184.013) * (-1181.646) (-1181.759) (-1182.987) [-1184.319] -- 0:00:12
791000 -- (-1181.651) (-1181.120) (-1181.633) [-1185.098] * (-1184.473) (-1180.801) [-1182.420] (-1191.266) -- 0:00:12
791500 -- (-1181.079) [-1181.542] (-1184.267) (-1182.549) * (-1183.253) (-1182.978) [-1180.844] (-1189.243) -- 0:00:12
792000 -- (-1181.262) [-1181.295] (-1182.607) (-1181.666) * (-1182.781) (-1182.076) (-1180.535) [-1181.206] -- 0:00:13
792500 -- (-1180.633) [-1181.077] (-1182.607) (-1185.561) * (-1188.429) (-1182.857) (-1180.475) [-1182.343] -- 0:00:13
793000 -- (-1180.352) (-1183.997) [-1181.232] (-1183.169) * (-1183.564) (-1183.669) [-1183.096] (-1182.038) -- 0:00:13
793500 -- [-1183.106] (-1182.079) (-1181.296) (-1180.871) * (-1184.931) (-1183.869) [-1182.336] (-1183.917) -- 0:00:13
794000 -- (-1180.625) [-1181.447] (-1180.934) (-1183.822) * (-1186.733) (-1184.559) [-1183.275] (-1181.748) -- 0:00:12
794500 -- (-1184.297) [-1180.897] (-1183.242) (-1183.919) * [-1182.170] (-1184.422) (-1183.248) (-1181.897) -- 0:00:12
795000 -- (-1185.549) (-1182.324) [-1181.535] (-1181.241) * (-1181.535) [-1181.167] (-1181.988) (-1181.458) -- 0:00:12
Average standard deviation of split frequencies: 0.006107
795500 -- (-1183.158) (-1181.610) [-1181.857] (-1184.958) * [-1180.753] (-1194.004) (-1184.673) (-1184.895) -- 0:00:12
796000 -- (-1181.118) [-1183.189] (-1181.525) (-1181.717) * [-1182.435] (-1184.191) (-1181.210) (-1184.616) -- 0:00:12
796500 -- [-1181.826] (-1185.705) (-1187.336) (-1188.036) * (-1182.529) [-1183.860] (-1181.205) (-1183.131) -- 0:00:12
797000 -- (-1182.086) (-1192.877) [-1180.926] (-1181.951) * (-1184.137) [-1183.816] (-1183.340) (-1183.473) -- 0:00:12
797500 -- (-1182.474) (-1182.351) (-1180.331) [-1186.603] * (-1183.368) (-1183.028) (-1186.179) [-1182.862] -- 0:00:12
798000 -- (-1180.539) [-1181.636] (-1183.212) (-1181.513) * (-1182.809) [-1182.414] (-1183.451) (-1186.621) -- 0:00:12
798500 -- (-1180.904) (-1182.772) (-1181.387) [-1180.784] * [-1181.927] (-1183.136) (-1184.331) (-1187.891) -- 0:00:12
799000 -- [-1182.274] (-1186.198) (-1184.260) (-1182.039) * (-1182.334) (-1182.456) [-1181.429] (-1186.785) -- 0:00:12
799500 -- (-1181.056) (-1184.769) [-1181.737] (-1182.607) * (-1187.079) [-1183.469] (-1184.038) (-1183.253) -- 0:00:12
800000 -- (-1180.379) [-1182.542] (-1183.161) (-1181.907) * (-1183.593) (-1183.627) (-1183.996) [-1182.289] -- 0:00:12
Average standard deviation of split frequencies: 0.005851
800500 -- (-1180.443) (-1184.042) [-1182.107] (-1183.140) * (-1182.310) (-1183.456) [-1184.646] (-1182.800) -- 0:00:12
801000 -- (-1183.256) [-1181.592] (-1182.389) (-1183.870) * [-1186.858] (-1184.424) (-1183.075) (-1185.388) -- 0:00:12
801500 -- (-1186.519) (-1183.495) (-1187.040) [-1180.981] * [-1183.679] (-1181.697) (-1181.512) (-1181.638) -- 0:00:12
802000 -- (-1184.318) [-1182.346] (-1181.759) (-1182.735) * (-1186.016) [-1181.884] (-1180.817) (-1181.255) -- 0:00:12
802500 -- (-1184.419) [-1183.744] (-1180.805) (-1183.320) * (-1182.549) [-1182.160] (-1181.170) (-1181.765) -- 0:00:12
803000 -- [-1181.979] (-1183.072) (-1181.291) (-1185.203) * (-1183.316) (-1183.566) (-1181.846) [-1181.696] -- 0:00:12
803500 -- (-1181.212) (-1183.391) [-1183.384] (-1184.118) * (-1183.254) [-1184.895] (-1182.040) (-1180.343) -- 0:00:12
804000 -- [-1180.780] (-1182.947) (-1181.879) (-1182.426) * [-1184.568] (-1183.280) (-1183.971) (-1181.259) -- 0:00:12
804500 -- (-1180.884) [-1181.436] (-1185.537) (-1184.299) * (-1182.635) (-1181.618) [-1181.165] (-1180.410) -- 0:00:12
805000 -- (-1180.204) (-1181.788) (-1182.182) [-1181.785] * (-1182.848) (-1181.679) (-1180.834) [-1181.834] -- 0:00:12
Average standard deviation of split frequencies: 0.006031
805500 -- (-1180.580) [-1182.737] (-1182.616) (-1180.798) * (-1183.518) (-1181.817) [-1182.249] (-1181.548) -- 0:00:12
806000 -- [-1182.471] (-1183.431) (-1181.157) (-1182.233) * (-1182.625) [-1182.092] (-1181.152) (-1184.134) -- 0:00:12
806500 -- [-1183.202] (-1182.115) (-1182.669) (-1184.548) * (-1181.484) [-1182.666] (-1181.657) (-1184.871) -- 0:00:11
807000 -- [-1182.264] (-1182.462) (-1182.395) (-1181.645) * (-1181.293) (-1184.311) (-1185.913) [-1181.049] -- 0:00:11
807500 -- (-1181.364) [-1181.637] (-1184.304) (-1184.743) * [-1181.774] (-1185.923) (-1187.578) (-1180.585) -- 0:00:11
808000 -- (-1183.430) (-1185.263) (-1182.362) [-1181.456] * [-1183.576] (-1181.723) (-1185.890) (-1180.821) -- 0:00:12
808500 -- [-1182.471] (-1183.977) (-1183.011) (-1181.762) * (-1183.053) [-1183.497] (-1182.854) (-1181.840) -- 0:00:12
809000 -- (-1182.512) (-1182.743) [-1185.068] (-1184.143) * [-1186.715] (-1181.907) (-1182.996) (-1183.357) -- 0:00:12
809500 -- (-1181.564) (-1183.450) (-1181.260) [-1180.760] * [-1188.351] (-1183.167) (-1181.846) (-1183.058) -- 0:00:12
810000 -- (-1182.541) [-1181.901] (-1186.577) (-1181.706) * [-1183.856] (-1182.003) (-1188.188) (-1184.215) -- 0:00:11
Average standard deviation of split frequencies: 0.006435
810500 -- (-1187.938) (-1182.084) [-1180.811] (-1183.016) * (-1183.673) (-1182.354) [-1182.301] (-1184.557) -- 0:00:11
811000 -- [-1182.706] (-1187.839) (-1180.606) (-1183.800) * [-1183.761] (-1182.955) (-1180.955) (-1184.276) -- 0:00:11
811500 -- (-1181.722) (-1187.615) [-1181.600] (-1183.243) * (-1182.328) [-1181.929] (-1181.443) (-1185.040) -- 0:00:11
812000 -- (-1182.559) (-1182.243) [-1182.134] (-1181.964) * (-1182.342) [-1181.929] (-1184.163) (-1183.523) -- 0:00:11
812500 -- (-1181.050) (-1183.798) (-1181.297) [-1183.097] * (-1183.026) (-1181.872) [-1187.772] (-1183.050) -- 0:00:11
813000 -- [-1183.627] (-1183.242) (-1182.012) (-1189.546) * (-1181.023) (-1182.112) [-1181.351] (-1183.329) -- 0:00:11
813500 -- (-1180.376) [-1181.058] (-1183.295) (-1187.885) * (-1180.342) (-1180.544) [-1182.209] (-1181.390) -- 0:00:11
814000 -- (-1186.423) [-1182.977] (-1181.792) (-1182.562) * (-1180.481) (-1180.430) [-1182.077] (-1185.029) -- 0:00:11
814500 -- [-1183.798] (-1187.481) (-1181.723) (-1183.029) * (-1181.680) (-1182.223) (-1187.960) [-1183.559] -- 0:00:11
815000 -- (-1184.814) [-1183.465] (-1180.579) (-1181.094) * (-1181.423) (-1181.790) (-1184.321) [-1183.491] -- 0:00:11
Average standard deviation of split frequencies: 0.007164
815500 -- (-1181.793) (-1186.292) [-1182.606] (-1181.248) * (-1182.513) (-1181.855) [-1181.411] (-1186.232) -- 0:00:11
816000 -- (-1186.068) (-1181.222) (-1183.302) [-1182.860] * (-1182.029) (-1181.279) [-1182.118] (-1182.702) -- 0:00:11
816500 -- (-1181.723) [-1181.271] (-1184.562) (-1182.842) * (-1183.536) (-1183.002) (-1180.644) [-1180.900] -- 0:00:11
817000 -- (-1182.403) (-1183.761) [-1180.886] (-1181.622) * (-1185.923) (-1182.891) [-1182.643] (-1180.856) -- 0:00:11
817500 -- (-1181.991) [-1183.838] (-1186.850) (-1183.809) * [-1184.072] (-1181.305) (-1182.180) (-1181.748) -- 0:00:11
818000 -- (-1186.306) (-1182.961) (-1182.468) [-1183.008] * (-1181.153) [-1182.169] (-1181.562) (-1180.566) -- 0:00:11
818500 -- (-1180.773) [-1181.732] (-1182.217) (-1184.678) * (-1183.147) [-1183.299] (-1183.065) (-1184.265) -- 0:00:11
819000 -- (-1182.043) (-1181.514) (-1183.056) [-1181.621] * (-1187.327) (-1181.834) [-1182.088] (-1185.187) -- 0:00:11
819500 -- (-1181.507) [-1182.371] (-1182.239) (-1187.751) * (-1187.412) (-1181.095) [-1181.945] (-1181.871) -- 0:00:11
820000 -- [-1181.743] (-1182.446) (-1183.157) (-1185.319) * [-1186.441] (-1180.825) (-1182.793) (-1187.469) -- 0:00:11
Average standard deviation of split frequencies: 0.007429
820500 -- [-1180.915] (-1183.357) (-1181.313) (-1181.846) * (-1183.525) [-1181.054] (-1181.506) (-1185.665) -- 0:00:11
821000 -- (-1181.290) [-1180.396] (-1182.022) (-1181.936) * (-1182.509) (-1181.000) (-1181.677) [-1184.168] -- 0:00:11
821500 -- (-1180.876) [-1181.735] (-1184.555) (-1183.880) * [-1181.708] (-1181.210) (-1180.280) (-1184.283) -- 0:00:11
822000 -- (-1182.203) (-1183.114) (-1182.923) [-1185.289] * (-1181.596) (-1182.002) [-1182.042] (-1182.020) -- 0:00:11
822500 -- (-1181.203) (-1181.926) (-1182.773) [-1187.080] * (-1181.799) [-1185.202] (-1182.668) (-1184.075) -- 0:00:11
823000 -- (-1185.064) (-1181.614) (-1183.475) [-1186.862] * (-1184.864) [-1184.646] (-1184.889) (-1183.817) -- 0:00:10
823500 -- [-1182.435] (-1180.834) (-1184.263) (-1187.320) * (-1183.271) (-1180.645) [-1182.673] (-1183.797) -- 0:00:10
824000 -- (-1182.314) (-1181.328) (-1181.585) [-1182.524] * [-1186.050] (-1180.616) (-1186.409) (-1182.406) -- 0:00:11
824500 -- (-1184.469) (-1182.775) [-1184.498] (-1188.328) * (-1181.758) [-1182.629] (-1181.556) (-1183.150) -- 0:00:11
825000 -- (-1182.304) (-1182.582) (-1185.426) [-1183.525] * (-1182.808) [-1183.063] (-1181.946) (-1182.036) -- 0:00:11
Average standard deviation of split frequencies: 0.007647
825500 -- (-1181.320) (-1185.224) (-1180.823) [-1182.330] * (-1183.700) (-1183.659) (-1180.552) [-1185.717] -- 0:00:10
826000 -- [-1183.948] (-1185.011) (-1180.921) (-1186.371) * (-1183.097) (-1181.109) [-1181.536] (-1182.906) -- 0:00:10
826500 -- [-1184.572] (-1183.617) (-1182.078) (-1185.060) * (-1183.262) (-1181.315) [-1181.519] (-1187.644) -- 0:00:10
827000 -- (-1182.925) (-1181.858) [-1180.904] (-1185.228) * (-1184.413) (-1183.652) (-1183.309) [-1183.161] -- 0:00:10
827500 -- (-1181.752) [-1185.252] (-1182.079) (-1181.594) * (-1181.085) [-1181.102] (-1185.353) (-1184.890) -- 0:00:10
828000 -- [-1181.625] (-1184.669) (-1181.524) (-1181.986) * (-1182.131) (-1181.979) (-1184.335) [-1182.426] -- 0:00:10
828500 -- (-1186.521) (-1185.734) (-1182.833) [-1183.034] * (-1182.487) (-1186.015) [-1181.800] (-1183.815) -- 0:00:10
829000 -- (-1181.798) [-1182.706] (-1181.568) (-1182.749) * (-1185.473) [-1180.459] (-1181.179) (-1181.659) -- 0:00:10
829500 -- (-1180.870) (-1182.192) (-1181.078) [-1181.698] * (-1181.333) (-1183.349) [-1181.180] (-1181.448) -- 0:00:10
830000 -- [-1181.584] (-1182.909) (-1182.570) (-1181.763) * [-1183.846] (-1183.932) (-1180.623) (-1180.872) -- 0:00:10
Average standard deviation of split frequencies: 0.006961
830500 -- (-1182.331) (-1181.668) [-1183.645] (-1181.383) * [-1180.356] (-1182.127) (-1180.622) (-1180.739) -- 0:00:10
831000 -- (-1184.591) (-1184.308) [-1182.405] (-1181.344) * (-1181.569) (-1180.676) [-1183.645] (-1182.322) -- 0:00:10
831500 -- (-1181.530) [-1182.939] (-1180.596) (-1182.116) * (-1182.323) [-1182.247] (-1183.806) (-1180.802) -- 0:00:10
832000 -- (-1183.049) [-1182.412] (-1181.057) (-1184.247) * (-1180.574) (-1185.124) [-1180.904] (-1183.181) -- 0:00:10
832500 -- [-1182.962] (-1184.619) (-1182.041) (-1182.871) * [-1182.026] (-1185.567) (-1183.361) (-1185.201) -- 0:00:10
833000 -- [-1185.398] (-1184.573) (-1180.530) (-1189.383) * [-1180.964] (-1181.873) (-1181.643) (-1185.655) -- 0:00:10
833500 -- [-1180.533] (-1182.052) (-1184.020) (-1186.749) * (-1186.658) (-1181.991) (-1183.344) [-1182.120] -- 0:00:10
834000 -- (-1185.535) (-1181.020) [-1182.505] (-1187.263) * (-1184.097) (-1181.758) [-1180.885] (-1182.792) -- 0:00:10
834500 -- [-1183.363] (-1182.608) (-1184.262) (-1185.022) * (-1183.090) [-1183.698] (-1183.522) (-1182.195) -- 0:00:10
835000 -- (-1180.339) (-1183.311) (-1186.444) [-1185.103] * (-1181.363) (-1184.553) (-1183.428) [-1182.216] -- 0:00:10
Average standard deviation of split frequencies: 0.007105
835500 -- [-1181.024] (-1184.908) (-1181.515) (-1182.293) * [-1186.974] (-1181.423) (-1187.999) (-1182.233) -- 0:00:10
836000 -- (-1182.102) [-1187.096] (-1184.449) (-1185.006) * (-1185.693) (-1184.575) (-1186.238) [-1182.746] -- 0:00:10
836500 -- (-1184.154) [-1184.381] (-1183.209) (-1184.508) * [-1184.549] (-1182.992) (-1186.297) (-1181.481) -- 0:00:10
837000 -- [-1180.211] (-1181.153) (-1182.963) (-1182.317) * (-1180.276) [-1184.010] (-1184.395) (-1186.431) -- 0:00:10
837500 -- (-1181.949) (-1183.443) (-1181.935) [-1181.093] * (-1183.097) (-1181.429) (-1180.292) [-1182.294] -- 0:00:10
838000 -- (-1182.796) [-1182.055] (-1181.554) (-1181.843) * (-1184.264) [-1187.624] (-1182.531) (-1185.125) -- 0:00:10
838500 -- (-1181.844) (-1184.771) (-1181.077) [-1182.450] * (-1183.119) (-1190.759) (-1184.080) [-1182.482] -- 0:00:10
839000 -- (-1181.746) (-1184.361) (-1184.174) [-1182.259] * [-1183.587] (-1186.095) (-1182.545) (-1182.409) -- 0:00:09
839500 -- (-1182.939) (-1183.537) (-1182.511) [-1181.887] * (-1185.164) (-1181.183) [-1182.859] (-1181.770) -- 0:00:09
840000 -- (-1186.372) [-1187.550] (-1182.632) (-1183.475) * (-1181.779) [-1182.819] (-1181.033) (-1181.931) -- 0:00:10
Average standard deviation of split frequencies: 0.007365
840500 -- (-1183.237) (-1182.043) [-1182.334] (-1185.799) * (-1182.304) [-1182.554] (-1181.979) (-1184.017) -- 0:00:10
841000 -- [-1182.947] (-1182.478) (-1180.950) (-1189.449) * (-1181.719) (-1181.602) [-1181.507] (-1181.965) -- 0:00:10
841500 -- (-1184.291) [-1184.549] (-1181.994) (-1181.668) * [-1182.225] (-1181.621) (-1183.076) (-1181.993) -- 0:00:09
842000 -- [-1181.665] (-1181.134) (-1182.516) (-1181.548) * (-1181.774) [-1180.537] (-1183.051) (-1183.222) -- 0:00:09
842500 -- (-1184.296) (-1184.516) (-1184.281) [-1183.808] * (-1182.052) [-1181.279] (-1181.567) (-1181.370) -- 0:00:09
843000 -- [-1183.511] (-1185.856) (-1182.291) (-1182.627) * (-1183.591) [-1181.960] (-1184.931) (-1180.915) -- 0:00:09
843500 -- (-1181.565) (-1184.001) [-1182.286] (-1186.346) * (-1185.246) (-1181.219) [-1183.275] (-1180.451) -- 0:00:09
844000 -- (-1181.726) (-1184.754) (-1181.365) [-1183.038] * (-1182.548) [-1184.608] (-1183.625) (-1180.451) -- 0:00:09
844500 -- [-1182.134] (-1187.371) (-1180.685) (-1188.150) * (-1182.503) (-1186.430) [-1182.688] (-1182.290) -- 0:00:09
845000 -- (-1184.069) (-1185.345) [-1180.528] (-1181.275) * (-1185.982) (-1186.572) (-1184.057) [-1181.669] -- 0:00:09
Average standard deviation of split frequencies: 0.007541
845500 -- (-1184.112) (-1187.073) (-1180.938) [-1182.596] * (-1183.379) [-1182.364] (-1181.693) (-1180.893) -- 0:00:09
846000 -- (-1182.591) (-1182.329) (-1183.787) [-1181.162] * [-1188.163] (-1184.108) (-1181.793) (-1184.161) -- 0:00:09
846500 -- (-1183.883) (-1180.916) (-1182.618) [-1182.440] * (-1184.683) (-1181.296) (-1182.593) [-1182.991] -- 0:00:09
847000 -- (-1184.451) (-1181.355) (-1182.141) [-1181.329] * (-1182.872) (-1181.522) [-1182.237] (-1186.534) -- 0:00:09
847500 -- [-1181.494] (-1181.603) (-1180.845) (-1181.483) * [-1183.635] (-1182.868) (-1182.012) (-1183.793) -- 0:00:09
848000 -- (-1182.198) (-1182.204) [-1181.236] (-1181.572) * (-1181.572) (-1189.339) (-1181.506) [-1182.980] -- 0:00:09
848500 -- [-1181.448] (-1183.487) (-1180.780) (-1180.816) * (-1184.691) [-1182.301] (-1185.302) (-1182.903) -- 0:00:09
849000 -- (-1183.962) (-1183.563) [-1183.185] (-1182.086) * (-1187.674) (-1180.506) (-1181.565) [-1181.935] -- 0:00:09
849500 -- (-1184.604) (-1183.985) [-1183.027] (-1182.606) * (-1184.815) (-1187.821) (-1182.352) [-1183.184] -- 0:00:09
850000 -- (-1188.917) [-1184.396] (-1182.330) (-1183.772) * (-1182.679) (-1184.220) [-1184.498] (-1182.922) -- 0:00:09
Average standard deviation of split frequencies: 0.007610
850500 -- [-1182.044] (-1181.752) (-1183.981) (-1183.689) * (-1182.335) (-1184.477) [-1180.792] (-1182.328) -- 0:00:09
851000 -- (-1184.685) (-1180.692) (-1184.691) [-1181.702] * (-1181.674) (-1183.645) [-1180.539] (-1180.480) -- 0:00:09
851500 -- (-1184.024) [-1181.167] (-1181.791) (-1184.352) * (-1183.161) (-1182.831) (-1180.387) [-1180.265] -- 0:00:09
852000 -- (-1182.333) (-1183.664) (-1181.935) [-1181.119] * (-1181.018) [-1182.855] (-1180.961) (-1182.616) -- 0:00:09
852500 -- (-1180.868) (-1181.513) (-1182.283) [-1182.659] * [-1182.450] (-1182.194) (-1183.322) (-1185.653) -- 0:00:09
853000 -- (-1181.204) (-1185.621) (-1180.999) [-1182.530] * [-1186.497] (-1190.888) (-1187.017) (-1185.568) -- 0:00:09
853500 -- (-1183.512) [-1180.531] (-1185.001) (-1181.680) * (-1185.338) (-1185.466) (-1185.496) [-1185.620] -- 0:00:09
854000 -- (-1181.235) (-1182.779) [-1182.648] (-1184.229) * (-1183.333) (-1185.742) (-1188.276) [-1180.975] -- 0:00:09
854500 -- (-1185.316) [-1182.786] (-1182.155) (-1182.436) * (-1182.786) (-1185.901) (-1183.882) [-1185.085] -- 0:00:09
855000 -- [-1186.301] (-1184.081) (-1182.466) (-1181.289) * (-1181.630) (-1184.898) [-1182.743] (-1184.373) -- 0:00:08
Average standard deviation of split frequencies: 0.007490
855500 -- (-1184.635) (-1182.970) [-1183.082] (-1181.119) * (-1182.601) (-1184.453) [-1180.707] (-1182.054) -- 0:00:08
856000 -- (-1184.792) (-1184.174) [-1184.354] (-1183.601) * [-1180.774] (-1184.639) (-1180.667) (-1181.644) -- 0:00:09
856500 -- (-1182.583) [-1181.239] (-1182.846) (-1184.544) * [-1184.837] (-1182.901) (-1183.422) (-1181.480) -- 0:00:09
857000 -- [-1186.065] (-1185.593) (-1183.344) (-1183.121) * [-1182.686] (-1181.319) (-1181.234) (-1182.262) -- 0:00:09
857500 -- (-1182.326) (-1184.568) (-1181.404) [-1181.393] * (-1185.778) [-1181.190] (-1184.819) (-1182.854) -- 0:00:08
858000 -- (-1180.461) (-1188.437) (-1182.343) [-1180.826] * (-1181.882) [-1185.753] (-1180.487) (-1182.228) -- 0:00:08
858500 -- (-1181.704) [-1185.145] (-1181.366) (-1182.182) * [-1180.915] (-1184.343) (-1181.574) (-1182.220) -- 0:00:08
859000 -- (-1183.712) [-1181.753] (-1181.495) (-1181.976) * (-1187.808) [-1184.679] (-1184.586) (-1184.033) -- 0:00:08
859500 -- (-1184.752) (-1183.438) [-1180.200] (-1183.001) * (-1182.514) (-1183.344) (-1186.614) [-1183.093] -- 0:00:08
860000 -- (-1180.652) [-1182.138] (-1180.404) (-1184.866) * (-1190.806) (-1185.730) (-1181.153) [-1181.608] -- 0:00:08
Average standard deviation of split frequencies: 0.007778
860500 -- (-1180.658) (-1184.852) (-1182.484) [-1182.873] * (-1183.608) [-1182.306] (-1182.847) (-1182.875) -- 0:00:08
861000 -- [-1182.513] (-1185.310) (-1183.419) (-1184.301) * [-1183.410] (-1184.120) (-1180.901) (-1181.194) -- 0:00:08
861500 -- (-1183.328) (-1183.221) [-1180.640] (-1182.631) * [-1188.596] (-1181.526) (-1184.903) (-1185.271) -- 0:00:08
862000 -- (-1183.360) (-1181.749) (-1182.018) [-1184.612] * (-1185.854) (-1181.313) (-1182.316) [-1186.170] -- 0:00:08
862500 -- (-1183.188) (-1181.669) [-1180.890] (-1182.599) * [-1183.494] (-1185.389) (-1183.640) (-1180.298) -- 0:00:08
863000 -- [-1182.284] (-1185.118) (-1181.875) (-1182.027) * (-1183.335) (-1182.584) (-1182.226) [-1181.964] -- 0:00:08
863500 -- (-1182.289) (-1182.731) (-1187.379) [-1181.951] * (-1185.876) (-1182.843) (-1184.441) [-1181.564] -- 0:00:08
864000 -- (-1180.776) [-1180.900] (-1183.202) (-1181.603) * (-1184.984) (-1182.297) [-1181.915] (-1185.344) -- 0:00:08
864500 -- (-1180.974) (-1183.332) [-1184.135] (-1182.829) * (-1184.205) (-1184.612) (-1183.895) [-1182.754] -- 0:00:08
865000 -- (-1181.165) [-1182.599] (-1183.317) (-1181.013) * (-1184.718) [-1183.995] (-1183.844) (-1181.453) -- 0:00:08
Average standard deviation of split frequencies: 0.008274
865500 -- (-1183.063) (-1182.098) (-1181.189) [-1182.435] * (-1182.589) (-1186.066) [-1188.116] (-1181.794) -- 0:00:08
866000 -- (-1183.116) [-1183.609] (-1180.842) (-1182.566) * (-1180.768) (-1184.786) [-1181.495] (-1181.705) -- 0:00:08
866500 -- (-1181.901) (-1183.498) (-1183.102) [-1182.753] * (-1180.774) (-1182.362) [-1182.097] (-1181.733) -- 0:00:08
867000 -- (-1184.449) [-1185.143] (-1181.770) (-1186.528) * (-1186.780) [-1182.910] (-1181.160) (-1183.640) -- 0:00:08
867500 -- (-1183.235) [-1181.928] (-1181.470) (-1182.645) * (-1190.937) (-1181.425) (-1185.687) [-1183.846] -- 0:00:08
868000 -- (-1183.498) (-1180.771) (-1182.792) [-1180.780] * (-1184.422) (-1190.698) (-1184.384) [-1181.092] -- 0:00:08
868500 -- [-1185.297] (-1183.797) (-1182.697) (-1183.669) * [-1182.200] (-1183.263) (-1180.147) (-1182.225) -- 0:00:08
869000 -- (-1182.297) (-1181.734) (-1182.970) [-1180.805] * (-1180.859) [-1182.658] (-1183.494) (-1182.810) -- 0:00:08
869500 -- (-1182.961) (-1182.854) (-1180.781) [-1180.558] * (-1182.119) [-1184.654] (-1183.453) (-1184.545) -- 0:00:08
870000 -- (-1180.988) [-1182.104] (-1184.175) (-1181.292) * (-1182.085) (-1182.428) [-1183.620] (-1182.072) -- 0:00:08
Average standard deviation of split frequencies: 0.007941
870500 -- (-1181.959) (-1180.711) (-1183.365) [-1181.319] * (-1183.878) [-1184.273] (-1184.367) (-1181.769) -- 0:00:08
871000 -- (-1181.611) [-1182.704] (-1186.054) (-1180.747) * (-1189.753) (-1183.711) (-1183.024) [-1181.777] -- 0:00:07
871500 -- (-1184.509) (-1184.424) [-1181.371] (-1185.814) * (-1186.701) (-1183.476) [-1185.695] (-1181.175) -- 0:00:07
872000 -- (-1182.984) (-1181.381) (-1181.750) [-1187.664] * (-1181.615) (-1181.703) [-1182.331] (-1180.592) -- 0:00:08
872500 -- (-1181.832) (-1181.303) [-1181.121] (-1186.007) * [-1181.622] (-1184.639) (-1182.181) (-1183.172) -- 0:00:08
873000 -- (-1184.022) (-1181.987) (-1180.627) [-1182.604] * (-1180.251) [-1181.109] (-1182.994) (-1183.441) -- 0:00:08
873500 -- (-1185.937) [-1182.139] (-1182.372) (-1184.577) * (-1181.306) (-1181.083) (-1180.364) [-1182.465] -- 0:00:07
874000 -- [-1181.077] (-1182.650) (-1180.489) (-1185.385) * [-1184.040] (-1184.085) (-1180.343) (-1182.411) -- 0:00:07
874500 -- (-1184.256) (-1185.917) (-1181.269) [-1181.411] * (-1186.675) (-1182.104) [-1181.689] (-1182.499) -- 0:00:07
875000 -- (-1183.970) (-1181.996) [-1185.307] (-1183.158) * (-1185.193) [-1186.330] (-1182.104) (-1182.042) -- 0:00:07
Average standard deviation of split frequencies: 0.007964
875500 -- [-1183.776] (-1184.324) (-1183.855) (-1182.663) * (-1183.942) (-1181.791) [-1181.666] (-1184.564) -- 0:00:07
876000 -- (-1182.745) (-1182.318) (-1185.157) [-1181.375] * [-1183.000] (-1181.200) (-1181.047) (-1182.944) -- 0:00:07
876500 -- [-1182.064] (-1183.161) (-1181.771) (-1182.644) * (-1183.085) (-1184.547) (-1184.332) [-1182.493] -- 0:00:07
877000 -- (-1181.272) [-1183.323] (-1182.865) (-1187.097) * (-1184.864) (-1184.925) (-1185.476) [-1181.059] -- 0:00:07
877500 -- (-1183.922) (-1181.501) (-1181.918) [-1181.187] * [-1184.837] (-1182.432) (-1181.783) (-1181.290) -- 0:00:07
878000 -- (-1185.800) (-1180.835) (-1181.283) [-1182.116] * (-1181.907) [-1181.724] (-1188.666) (-1185.905) -- 0:00:07
878500 -- (-1183.161) (-1182.072) (-1182.388) [-1180.903] * [-1181.660] (-1181.523) (-1183.613) (-1184.206) -- 0:00:07
879000 -- (-1181.798) (-1182.672) (-1181.977) [-1180.684] * (-1184.794) (-1181.667) [-1181.406] (-1183.553) -- 0:00:07
879500 -- (-1181.841) [-1181.403] (-1186.234) (-1180.829) * (-1186.480) (-1186.791) [-1181.344] (-1182.559) -- 0:00:07
880000 -- (-1182.700) (-1181.921) (-1182.658) [-1183.195] * (-1182.877) [-1183.735] (-1183.477) (-1183.395) -- 0:00:07
Average standard deviation of split frequencies: 0.007851
880500 -- [-1184.747] (-1183.312) (-1186.508) (-1185.361) * (-1183.407) (-1184.080) [-1183.628] (-1182.836) -- 0:00:07
881000 -- (-1181.742) (-1181.649) [-1181.415] (-1182.733) * [-1181.442] (-1185.333) (-1183.804) (-1182.642) -- 0:00:07
881500 -- (-1182.843) (-1183.086) [-1186.150] (-1184.605) * (-1183.365) (-1183.906) [-1185.227] (-1181.464) -- 0:00:07
882000 -- (-1182.865) [-1183.320] (-1184.231) (-1182.205) * [-1181.405] (-1182.114) (-1181.092) (-1182.572) -- 0:00:07
882500 -- [-1181.151] (-1180.991) (-1183.583) (-1183.391) * (-1183.132) (-1182.594) [-1180.885] (-1183.821) -- 0:00:07
883000 -- (-1182.410) (-1182.790) (-1187.859) [-1187.389] * [-1181.251] (-1183.945) (-1183.551) (-1180.315) -- 0:00:07
883500 -- (-1180.609) (-1182.889) (-1185.886) [-1183.214] * (-1181.160) [-1185.070] (-1185.279) (-1182.298) -- 0:00:07
884000 -- [-1183.482] (-1180.566) (-1183.183) (-1182.766) * [-1181.227] (-1183.038) (-1189.490) (-1182.741) -- 0:00:07
884500 -- (-1181.264) [-1185.062] (-1182.227) (-1182.627) * (-1181.891) (-1183.578) (-1186.950) [-1182.851] -- 0:00:07
885000 -- (-1185.065) (-1181.533) (-1182.771) [-1182.427] * (-1184.604) (-1183.275) [-1181.026] (-1182.092) -- 0:00:07
Average standard deviation of split frequencies: 0.008052
885500 -- (-1189.527) (-1182.079) [-1181.331] (-1181.134) * (-1180.871) (-1181.676) (-1181.237) [-1182.168] -- 0:00:07
886000 -- (-1185.533) (-1181.268) [-1183.928] (-1181.120) * (-1185.938) (-1180.685) (-1182.605) [-1181.571] -- 0:00:07
886500 -- (-1184.725) (-1184.063) (-1183.521) [-1181.262] * [-1183.625] (-1182.761) (-1183.064) (-1185.266) -- 0:00:07
887000 -- (-1187.914) [-1183.947] (-1183.808) (-1184.337) * (-1184.776) (-1186.827) [-1185.529] (-1181.591) -- 0:00:07
887500 -- (-1182.815) (-1182.559) [-1181.108] (-1184.278) * (-1180.579) (-1182.165) [-1181.158] (-1184.216) -- 0:00:06
888000 -- [-1182.860] (-1183.441) (-1183.892) (-1180.839) * [-1184.671] (-1181.958) (-1185.965) (-1182.340) -- 0:00:07
888500 -- (-1182.692) [-1184.230] (-1186.708) (-1181.933) * (-1183.801) [-1183.524] (-1182.591) (-1180.590) -- 0:00:07
889000 -- [-1181.808] (-1180.853) (-1185.667) (-1185.019) * (-1181.576) (-1184.461) (-1182.840) [-1183.516] -- 0:00:06
889500 -- (-1180.520) (-1185.416) (-1184.636) [-1182.568] * (-1181.708) (-1183.273) (-1183.246) [-1180.865] -- 0:00:06
890000 -- [-1184.682] (-1185.272) (-1190.238) (-1182.644) * [-1181.220] (-1182.987) (-1181.488) (-1185.293) -- 0:00:06
Average standard deviation of split frequencies: 0.007833
890500 -- [-1184.355] (-1184.016) (-1188.554) (-1184.030) * (-1186.130) (-1184.185) [-1182.899] (-1181.365) -- 0:00:06
891000 -- (-1181.609) (-1181.991) (-1186.098) [-1181.739] * (-1183.415) (-1182.726) (-1183.503) [-1182.582] -- 0:00:06
891500 -- (-1184.135) (-1181.426) [-1182.792] (-1181.347) * (-1181.904) (-1181.891) (-1183.364) [-1183.315] -- 0:00:06
892000 -- [-1185.233] (-1182.221) (-1182.623) (-1181.845) * (-1183.083) (-1185.318) (-1183.884) [-1182.580] -- 0:00:06
892500 -- (-1182.440) [-1182.784] (-1186.001) (-1181.263) * (-1181.693) [-1183.040] (-1181.041) (-1182.266) -- 0:00:06
893000 -- (-1186.951) (-1182.384) (-1180.205) [-1184.620] * (-1182.107) (-1180.884) (-1181.785) [-1182.458] -- 0:00:06
893500 -- [-1181.536] (-1183.391) (-1183.456) (-1183.081) * (-1182.270) (-1190.765) [-1181.895] (-1185.484) -- 0:00:06
894000 -- (-1180.569) [-1183.207] (-1182.947) (-1184.305) * (-1182.864) (-1182.197) (-1181.875) [-1183.206] -- 0:00:06
894500 -- (-1181.451) (-1181.215) (-1183.137) [-1180.931] * (-1181.094) (-1181.819) (-1180.574) [-1183.059] -- 0:00:06
895000 -- [-1181.456] (-1183.100) (-1183.621) (-1183.057) * [-1182.421] (-1180.975) (-1182.004) (-1183.018) -- 0:00:06
Average standard deviation of split frequencies: 0.007822
895500 -- (-1182.663) (-1183.822) [-1182.980] (-1182.924) * (-1180.912) (-1184.340) [-1182.959] (-1183.965) -- 0:00:06
896000 -- [-1181.834] (-1183.816) (-1182.823) (-1187.098) * (-1183.749) [-1185.924] (-1184.204) (-1181.921) -- 0:00:06
896500 -- (-1182.402) (-1181.485) (-1181.192) [-1183.056] * (-1183.935) (-1187.007) (-1180.367) [-1183.070] -- 0:00:06
897000 -- (-1181.186) [-1183.734] (-1183.920) (-1181.568) * (-1182.237) [-1180.955] (-1182.728) (-1183.980) -- 0:00:06
897500 -- (-1183.854) (-1181.174) [-1182.383] (-1181.742) * [-1181.913] (-1180.879) (-1188.147) (-1182.380) -- 0:00:06
898000 -- (-1183.898) (-1181.289) (-1184.635) [-1180.789] * [-1182.652] (-1181.000) (-1180.937) (-1182.093) -- 0:00:06
898500 -- (-1182.858) [-1183.270] (-1184.697) (-1185.319) * (-1180.803) (-1183.319) [-1182.099] (-1187.013) -- 0:00:06
899000 -- (-1186.837) [-1183.524] (-1181.003) (-1181.909) * (-1185.231) (-1181.694) [-1182.329] (-1183.688) -- 0:00:06
899500 -- [-1182.525] (-1188.218) (-1182.348) (-1183.015) * (-1182.945) [-1180.862] (-1181.203) (-1185.715) -- 0:00:06
900000 -- [-1184.332] (-1183.270) (-1183.057) (-1181.596) * (-1184.658) (-1187.721) (-1184.178) [-1183.220] -- 0:00:06
Average standard deviation of split frequencies: 0.007676
900500 -- [-1181.188] (-1182.581) (-1181.992) (-1184.231) * [-1180.533] (-1184.393) (-1180.864) (-1184.985) -- 0:00:06
901000 -- (-1182.237) [-1182.605] (-1182.674) (-1187.368) * [-1181.079] (-1184.697) (-1182.587) (-1186.092) -- 0:00:06
901500 -- (-1182.220) (-1184.530) [-1181.140] (-1186.615) * [-1185.535] (-1182.453) (-1184.289) (-1182.934) -- 0:00:06
902000 -- (-1182.894) (-1182.037) [-1181.760] (-1186.608) * (-1181.184) [-1180.804] (-1182.634) (-1182.548) -- 0:00:06
902500 -- (-1182.006) (-1182.463) [-1181.476] (-1180.653) * [-1182.291] (-1180.851) (-1181.400) (-1182.417) -- 0:00:06
903000 -- (-1185.646) (-1183.069) [-1183.774] (-1182.142) * (-1183.190) (-1182.465) (-1185.046) [-1181.162] -- 0:00:06
903500 -- (-1186.497) (-1186.130) [-1181.251] (-1183.274) * (-1183.157) (-1183.767) (-1187.302) [-1181.541] -- 0:00:05
904000 -- [-1186.387] (-1183.634) (-1182.409) (-1185.166) * [-1184.637] (-1183.366) (-1184.583) (-1180.778) -- 0:00:06
904500 -- (-1184.444) [-1181.328] (-1183.161) (-1180.750) * [-1182.045] (-1185.292) (-1183.373) (-1182.796) -- 0:00:06
905000 -- [-1182.326] (-1183.605) (-1181.380) (-1180.331) * [-1183.127] (-1184.835) (-1180.927) (-1181.902) -- 0:00:05
Average standard deviation of split frequencies: 0.007770
905500 -- (-1181.072) [-1182.472] (-1181.033) (-1181.863) * (-1182.554) (-1182.254) [-1188.359] (-1180.543) -- 0:00:05
906000 -- (-1180.796) [-1181.023] (-1181.928) (-1187.620) * [-1181.578] (-1182.480) (-1185.301) (-1186.442) -- 0:00:05
906500 -- (-1184.548) (-1183.637) [-1182.904] (-1180.599) * (-1182.797) (-1180.713) [-1187.904] (-1183.840) -- 0:00:05
907000 -- (-1181.985) (-1180.598) (-1182.073) [-1180.876] * [-1182.838] (-1180.689) (-1182.438) (-1183.379) -- 0:00:05
907500 -- (-1184.982) (-1182.356) (-1185.027) [-1182.588] * (-1183.003) (-1186.399) [-1181.454] (-1183.175) -- 0:00:05
908000 -- (-1186.456) [-1182.010] (-1180.905) (-1185.641) * (-1180.959) [-1183.624] (-1180.630) (-1183.487) -- 0:00:05
908500 -- (-1181.543) (-1183.308) [-1181.212] (-1180.711) * (-1182.283) (-1186.040) [-1181.322] (-1181.214) -- 0:00:05
909000 -- (-1183.012) (-1187.313) [-1181.051] (-1181.615) * [-1181.118] (-1181.378) (-1181.823) (-1185.301) -- 0:00:05
909500 -- (-1180.630) [-1181.473] (-1181.168) (-1180.361) * [-1183.478] (-1183.918) (-1182.223) (-1185.007) -- 0:00:05
910000 -- (-1180.683) (-1187.752) [-1181.781] (-1180.902) * (-1180.579) (-1183.386) (-1181.299) [-1182.381] -- 0:00:05
Average standard deviation of split frequencies: 0.008110
910500 -- (-1181.843) (-1182.723) [-1180.600] (-1181.085) * [-1180.576] (-1183.148) (-1181.796) (-1181.506) -- 0:00:05
911000 -- (-1181.955) (-1181.714) [-1180.652] (-1181.903) * (-1181.473) (-1183.230) (-1183.160) [-1181.323] -- 0:00:05
911500 -- [-1184.056] (-1185.882) (-1180.440) (-1188.344) * (-1184.700) [-1185.181] (-1183.831) (-1183.193) -- 0:00:05
912000 -- [-1183.442] (-1186.347) (-1182.361) (-1185.787) * [-1182.855] (-1187.012) (-1182.295) (-1182.097) -- 0:00:05
912500 -- [-1181.948] (-1182.049) (-1182.210) (-1183.256) * (-1181.801) (-1182.485) (-1180.992) [-1182.228] -- 0:00:05
913000 -- (-1185.652) [-1184.354] (-1181.190) (-1182.229) * [-1180.975] (-1181.168) (-1182.327) (-1181.742) -- 0:00:05
913500 -- (-1181.023) (-1184.282) [-1181.695] (-1182.011) * (-1181.235) [-1181.669] (-1184.962) (-1182.855) -- 0:00:05
914000 -- (-1182.434) (-1185.070) [-1181.784] (-1186.307) * (-1183.869) (-1182.351) [-1182.410] (-1182.971) -- 0:00:05
914500 -- (-1182.011) (-1181.600) [-1182.784] (-1185.091) * (-1186.396) (-1184.422) (-1184.338) [-1181.256] -- 0:00:05
915000 -- (-1183.117) (-1181.815) [-1180.735] (-1184.756) * (-1181.950) (-1183.845) (-1183.690) [-1182.626] -- 0:00:05
Average standard deviation of split frequencies: 0.008063
915500 -- (-1183.329) (-1183.012) [-1180.586] (-1180.921) * (-1180.962) (-1184.984) (-1181.246) [-1182.611] -- 0:00:05
916000 -- [-1182.130] (-1183.042) (-1181.896) (-1181.557) * [-1183.640] (-1180.416) (-1183.442) (-1186.597) -- 0:00:05
916500 -- (-1180.733) [-1182.288] (-1184.149) (-1182.786) * (-1181.742) (-1181.073) [-1183.844] (-1183.243) -- 0:00:05
917000 -- (-1185.697) [-1183.061] (-1185.060) (-1182.594) * [-1181.635] (-1182.511) (-1185.664) (-1180.846) -- 0:00:05
917500 -- [-1181.732] (-1184.652) (-1182.673) (-1183.528) * (-1182.571) [-1185.649] (-1181.301) (-1181.524) -- 0:00:05
918000 -- (-1182.146) (-1181.081) (-1182.318) [-1180.956] * (-1180.554) (-1181.819) (-1186.108) [-1184.667] -- 0:00:05
918500 -- (-1181.156) (-1186.237) (-1183.990) [-1182.720] * [-1181.668] (-1184.202) (-1194.269) (-1184.334) -- 0:00:05
919000 -- [-1180.807] (-1183.572) (-1182.801) (-1181.038) * (-1183.486) (-1183.956) (-1181.474) [-1183.710] -- 0:00:05
919500 -- (-1181.282) [-1182.256] (-1184.305) (-1181.329) * (-1183.570) (-1181.285) [-1182.664] (-1182.555) -- 0:00:04
920000 -- (-1181.883) (-1183.095) (-1186.074) [-1182.383] * (-1183.172) (-1181.965) (-1182.718) [-1182.658] -- 0:00:05
Average standard deviation of split frequencies: 0.007988
920500 -- (-1183.803) (-1180.683) (-1183.904) [-1180.798] * (-1181.835) (-1181.448) (-1183.416) [-1186.756] -- 0:00:05
921000 -- (-1187.340) (-1181.062) [-1182.145] (-1182.260) * (-1183.700) [-1182.538] (-1181.209) (-1182.542) -- 0:00:04
921500 -- (-1182.393) (-1183.880) (-1182.513) [-1180.747] * (-1181.560) (-1182.571) (-1184.029) [-1183.455] -- 0:00:04
922000 -- (-1182.660) (-1185.830) (-1182.326) [-1182.282] * (-1181.745) (-1182.574) [-1181.066] (-1182.499) -- 0:00:04
922500 -- (-1184.058) (-1184.499) [-1181.968] (-1182.718) * (-1181.638) (-1182.249) [-1181.667] (-1181.257) -- 0:00:04
923000 -- (-1188.574) (-1187.069) [-1182.060] (-1182.568) * (-1182.870) (-1184.005) [-1181.826] (-1182.435) -- 0:00:04
923500 -- [-1180.383] (-1181.385) (-1181.251) (-1184.633) * (-1183.532) (-1185.549) (-1182.603) [-1183.199] -- 0:00:04
924000 -- (-1181.403) (-1184.185) (-1186.674) [-1181.167] * (-1184.549) (-1185.918) [-1181.731] (-1186.454) -- 0:00:04
924500 -- (-1181.553) (-1181.902) [-1183.453] (-1181.308) * (-1184.026) [-1183.225] (-1187.173) (-1186.018) -- 0:00:04
925000 -- (-1180.866) (-1181.497) (-1185.123) [-1183.410] * (-1182.205) (-1181.764) (-1185.542) [-1180.846] -- 0:00:04
Average standard deviation of split frequencies: 0.008043
925500 -- [-1183.406] (-1184.108) (-1184.080) (-1187.456) * (-1180.546) (-1184.615) (-1182.165) [-1182.459] -- 0:00:04
926000 -- (-1183.413) [-1181.183] (-1183.855) (-1181.107) * (-1184.093) (-1181.583) [-1181.379] (-1181.833) -- 0:00:04
926500 -- (-1182.431) (-1184.448) [-1184.866] (-1180.712) * (-1185.004) (-1182.422) (-1182.518) [-1181.761] -- 0:00:04
927000 -- (-1184.200) (-1184.450) [-1189.758] (-1181.333) * [-1181.650] (-1182.417) (-1183.236) (-1182.782) -- 0:00:04
927500 -- (-1180.908) [-1182.557] (-1184.241) (-1182.616) * (-1184.036) [-1183.156] (-1181.797) (-1186.225) -- 0:00:04
928000 -- (-1181.889) (-1186.140) [-1181.335] (-1182.549) * (-1180.575) (-1182.715) [-1181.259] (-1183.281) -- 0:00:04
928500 -- (-1185.443) (-1187.573) (-1185.677) [-1181.776] * (-1180.872) [-1181.766] (-1182.455) (-1182.672) -- 0:00:04
929000 -- (-1182.588) (-1181.309) (-1182.132) [-1181.180] * (-1183.245) (-1182.216) [-1181.476] (-1182.769) -- 0:00:04
929500 -- [-1181.991] (-1183.107) (-1181.380) (-1182.497) * (-1182.062) (-1180.907) (-1180.819) [-1181.996] -- 0:00:04
930000 -- (-1184.139) [-1182.090] (-1181.617) (-1185.337) * [-1181.339] (-1184.318) (-1182.269) (-1185.178) -- 0:00:04
Average standard deviation of split frequencies: 0.007969
930500 -- (-1183.768) [-1184.938] (-1182.199) (-1182.359) * (-1182.284) (-1181.709) [-1180.775] (-1181.982) -- 0:00:04
931000 -- (-1183.900) (-1181.806) (-1182.361) [-1185.775] * (-1186.784) (-1180.352) (-1182.923) [-1180.669] -- 0:00:04
931500 -- (-1184.001) (-1181.840) [-1182.282] (-1182.040) * (-1190.423) [-1182.290] (-1183.811) (-1182.511) -- 0:00:04
932000 -- [-1180.924] (-1180.770) (-1184.307) (-1181.509) * (-1184.309) (-1180.695) [-1182.136] (-1182.959) -- 0:00:04
932500 -- [-1180.621] (-1183.744) (-1184.558) (-1182.798) * (-1190.794) (-1181.023) (-1185.583) [-1186.904] -- 0:00:04
933000 -- (-1180.869) (-1193.578) [-1182.065] (-1185.608) * (-1184.688) [-1181.117] (-1182.161) (-1182.829) -- 0:00:04
933500 -- (-1185.120) (-1182.611) [-1184.266] (-1182.940) * [-1186.864] (-1181.293) (-1184.577) (-1187.448) -- 0:00:04
934000 -- (-1184.368) [-1181.227] (-1182.898) (-1181.522) * (-1183.189) [-1184.267] (-1187.320) (-1183.350) -- 0:00:04
934500 -- [-1184.082] (-1183.472) (-1182.158) (-1181.954) * [-1181.639] (-1181.201) (-1182.497) (-1186.515) -- 0:00:04
935000 -- (-1184.390) [-1181.557] (-1182.508) (-1181.004) * (-1180.515) [-1181.577] (-1182.543) (-1185.594) -- 0:00:04
Average standard deviation of split frequencies: 0.007823
935500 -- (-1182.591) (-1181.891) (-1183.291) [-1182.078] * (-1182.688) (-1181.234) [-1182.135] (-1183.081) -- 0:00:04
936000 -- (-1185.373) [-1184.325] (-1184.915) (-1182.538) * (-1181.757) (-1183.347) (-1188.614) [-1181.281] -- 0:00:04
936500 -- (-1183.740) (-1182.550) (-1186.812) [-1181.172] * (-1181.476) (-1182.050) (-1183.683) [-1182.166] -- 0:00:04
937000 -- (-1181.539) (-1182.107) [-1181.459] (-1181.590) * (-1181.712) [-1182.143] (-1183.897) (-1181.611) -- 0:00:03
937500 -- (-1183.425) (-1181.960) (-1181.180) [-1182.075] * (-1183.632) (-1183.574) (-1184.685) [-1181.394] -- 0:00:03
938000 -- (-1183.138) [-1184.637] (-1182.656) (-1185.137) * (-1186.185) [-1183.234] (-1182.631) (-1181.187) -- 0:00:03
938500 -- (-1183.413) [-1182.683] (-1181.695) (-1181.831) * (-1185.226) (-1184.720) [-1184.396] (-1180.587) -- 0:00:03
939000 -- [-1180.394] (-1184.761) (-1184.246) (-1181.727) * (-1181.569) [-1187.751] (-1181.786) (-1182.357) -- 0:00:03
939500 -- (-1184.732) (-1182.736) (-1182.196) [-1181.521] * (-1181.551) [-1182.100] (-1182.015) (-1182.438) -- 0:00:03
940000 -- (-1182.392) (-1185.225) (-1187.715) [-1183.645] * (-1183.019) [-1181.552] (-1185.433) (-1183.760) -- 0:00:03
Average standard deviation of split frequencies: 0.007417
940500 -- (-1186.861) (-1180.863) (-1184.172) [-1181.892] * (-1180.704) [-1181.306] (-1185.042) (-1181.809) -- 0:00:03
941000 -- (-1185.967) (-1184.238) (-1182.325) [-1184.467] * (-1180.705) [-1183.287] (-1183.142) (-1182.764) -- 0:00:03
941500 -- (-1185.758) (-1181.209) (-1183.956) [-1184.036] * (-1182.723) (-1186.149) [-1186.117] (-1181.996) -- 0:00:03
942000 -- (-1184.175) (-1182.791) [-1185.137] (-1183.964) * (-1181.600) (-1183.441) (-1186.400) [-1184.257] -- 0:00:03
942500 -- (-1182.129) [-1180.975] (-1182.753) (-1181.207) * (-1185.701) [-1180.484] (-1185.898) (-1182.477) -- 0:00:03
943000 -- [-1181.683] (-1182.318) (-1186.573) (-1180.878) * (-1183.894) (-1183.180) [-1181.471] (-1187.075) -- 0:00:03
943500 -- [-1181.714] (-1183.240) (-1181.007) (-1180.783) * (-1182.569) (-1181.052) [-1181.652] (-1183.944) -- 0:00:03
944000 -- (-1182.200) (-1183.565) (-1180.943) [-1181.393] * (-1187.471) (-1183.039) [-1180.552] (-1183.374) -- 0:00:03
944500 -- (-1182.191) (-1181.672) [-1183.640] (-1184.355) * (-1181.183) [-1184.328] (-1180.889) (-1183.482) -- 0:00:03
945000 -- [-1181.777] (-1182.453) (-1181.045) (-1180.991) * (-1181.967) (-1182.966) (-1181.936) [-1181.547] -- 0:00:03
Average standard deviation of split frequencies: 0.007309
945500 -- [-1184.399] (-1190.374) (-1182.773) (-1183.341) * (-1181.990) (-1180.690) (-1182.691) [-1182.707] -- 0:00:03
946000 -- (-1183.253) (-1183.054) (-1181.539) [-1181.408] * (-1183.108) (-1182.707) [-1182.687] (-1185.355) -- 0:00:03
946500 -- (-1181.007) (-1180.632) [-1182.254] (-1184.080) * (-1180.987) (-1184.294) [-1182.169] (-1186.077) -- 0:00:03
947000 -- (-1185.147) (-1186.322) [-1184.876] (-1184.230) * [-1180.910] (-1183.006) (-1181.415) (-1185.861) -- 0:00:03
947500 -- (-1184.328) (-1184.664) [-1183.725] (-1183.413) * (-1184.809) (-1181.729) (-1181.345) [-1181.640] -- 0:00:03
948000 -- (-1182.755) [-1182.656] (-1183.028) (-1184.991) * (-1183.108) (-1184.601) (-1181.584) [-1181.501] -- 0:00:03
948500 -- (-1181.068) (-1184.100) (-1181.816) [-1182.264] * (-1182.864) [-1185.169] (-1182.037) (-1180.707) -- 0:00:03
949000 -- [-1185.974] (-1184.180) (-1185.277) (-1185.940) * (-1184.691) (-1184.609) (-1185.938) [-1181.103] -- 0:00:03
949500 -- (-1181.412) [-1181.126] (-1183.808) (-1181.790) * (-1182.175) (-1181.639) (-1183.319) [-1180.848] -- 0:00:03
950000 -- (-1184.830) (-1181.557) [-1180.423] (-1182.302) * (-1182.324) (-1182.932) [-1181.244] (-1183.177) -- 0:00:03
Average standard deviation of split frequencies: 0.007207
950500 -- (-1183.134) [-1181.076] (-1180.788) (-1181.883) * (-1183.429) (-1183.793) [-1182.863] (-1181.078) -- 0:00:03
951000 -- [-1185.377] (-1180.846) (-1180.823) (-1182.087) * (-1182.414) [-1181.687] (-1182.256) (-1188.435) -- 0:00:03
951500 -- [-1181.262] (-1186.816) (-1184.009) (-1185.471) * (-1185.885) (-1183.404) (-1184.716) [-1186.922] -- 0:00:03
952000 -- (-1182.345) (-1182.231) (-1181.619) [-1184.384] * (-1186.576) (-1181.679) [-1183.239] (-1191.981) -- 0:00:03
952500 -- (-1181.302) (-1187.781) [-1181.469] (-1182.617) * [-1181.431] (-1183.302) (-1182.311) (-1184.489) -- 0:00:02
953000 -- [-1181.878] (-1181.854) (-1182.680) (-1183.920) * (-1185.572) (-1182.630) [-1182.489] (-1181.314) -- 0:00:02
953500 -- (-1181.897) [-1182.795] (-1182.245) (-1184.758) * (-1182.649) (-1183.924) (-1183.816) [-1182.246] -- 0:00:02
954000 -- [-1182.984] (-1182.658) (-1181.688) (-1189.739) * (-1182.332) (-1183.412) (-1185.792) [-1181.219] -- 0:00:02
954500 -- (-1181.813) (-1181.833) (-1182.199) [-1183.407] * [-1180.378] (-1183.818) (-1180.804) (-1183.995) -- 0:00:02
955000 -- (-1182.215) [-1181.683] (-1182.041) (-1182.828) * (-1181.953) (-1185.197) [-1180.818] (-1182.793) -- 0:00:02
Average standard deviation of split frequencies: 0.007101
955500 -- (-1182.885) [-1182.464] (-1181.779) (-1182.594) * [-1183.435] (-1185.499) (-1181.490) (-1188.082) -- 0:00:02
956000 -- (-1181.463) (-1186.448) (-1186.950) [-1182.030] * (-1182.825) (-1182.402) (-1182.809) [-1182.967] -- 0:00:02
956500 -- [-1181.291] (-1182.833) (-1183.103) (-1183.851) * (-1183.597) (-1181.567) [-1182.401] (-1181.484) -- 0:00:02
957000 -- (-1181.278) (-1182.729) (-1180.961) [-1181.095] * (-1181.403) (-1183.184) (-1184.856) [-1180.594] -- 0:00:02
957500 -- (-1186.247) (-1181.701) [-1182.417] (-1184.593) * (-1182.619) (-1184.073) [-1182.083] (-1187.077) -- 0:00:02
958000 -- (-1181.401) [-1183.890] (-1186.718) (-1183.835) * (-1186.024) (-1184.969) [-1181.227] (-1183.910) -- 0:00:02
958500 -- (-1181.405) (-1186.276) (-1182.382) [-1182.398] * (-1186.224) (-1185.252) (-1181.826) [-1185.726] -- 0:00:02
959000 -- [-1181.913] (-1181.231) (-1182.008) (-1181.517) * (-1182.203) (-1183.030) [-1182.851] (-1181.625) -- 0:00:02
959500 -- (-1183.941) (-1182.582) [-1184.785] (-1181.363) * [-1183.558] (-1181.774) (-1184.213) (-1184.403) -- 0:00:02
960000 -- (-1183.119) (-1180.926) (-1181.804) [-1182.361] * [-1184.622] (-1183.513) (-1183.923) (-1182.728) -- 0:00:02
Average standard deviation of split frequencies: 0.006968
960500 -- (-1183.028) (-1180.690) [-1181.431] (-1184.163) * (-1186.301) (-1181.375) (-1182.834) [-1184.511] -- 0:00:02
961000 -- (-1182.600) (-1182.017) [-1182.850] (-1183.021) * [-1186.760] (-1181.861) (-1185.887) (-1183.107) -- 0:00:02
961500 -- (-1182.321) (-1183.844) [-1182.786] (-1183.879) * (-1183.615) (-1182.777) (-1184.116) [-1183.585] -- 0:00:02
962000 -- [-1181.322] (-1184.740) (-1183.815) (-1180.383) * [-1181.847] (-1185.392) (-1181.201) (-1181.916) -- 0:00:02
962500 -- (-1181.237) (-1184.600) (-1183.027) [-1180.371] * (-1183.498) (-1182.503) (-1182.244) [-1181.441] -- 0:00:02
963000 -- (-1182.952) (-1186.207) (-1180.759) [-1180.373] * [-1182.929] (-1183.023) (-1181.480) (-1182.413) -- 0:00:02
963500 -- [-1181.386] (-1183.132) (-1182.002) (-1183.772) * (-1181.980) (-1183.044) [-1181.294] (-1181.661) -- 0:00:02
964000 -- [-1181.575] (-1180.731) (-1181.021) (-1186.592) * (-1180.998) [-1183.143] (-1183.942) (-1184.684) -- 0:00:02
964500 -- [-1184.098] (-1181.145) (-1182.725) (-1181.104) * (-1181.134) [-1181.783] (-1184.526) (-1181.121) -- 0:00:02
965000 -- (-1181.794) [-1180.857] (-1183.714) (-1181.713) * [-1183.443] (-1181.676) (-1180.566) (-1182.753) -- 0:00:02
Average standard deviation of split frequencies: 0.007222
965500 -- [-1185.139] (-1183.949) (-1182.268) (-1186.274) * (-1183.159) (-1185.131) [-1182.184] (-1182.453) -- 0:00:02
966000 -- (-1182.460) [-1180.811] (-1180.156) (-1183.880) * [-1183.004] (-1183.398) (-1181.248) (-1182.356) -- 0:00:02
966500 -- [-1184.011] (-1183.994) (-1183.238) (-1183.219) * (-1183.086) (-1182.963) [-1181.991] (-1182.163) -- 0:00:02
967000 -- (-1183.287) (-1189.314) (-1181.054) [-1183.775] * (-1183.032) (-1182.148) (-1183.549) [-1185.974] -- 0:00:02
967500 -- (-1182.051) (-1188.668) [-1183.410] (-1186.566) * (-1183.175) [-1185.917] (-1182.513) (-1185.342) -- 0:00:02
968000 -- [-1182.374] (-1186.472) (-1182.459) (-1182.380) * (-1182.603) (-1182.738) [-1184.000] (-1186.429) -- 0:00:02
968500 -- [-1182.146] (-1189.739) (-1184.369) (-1185.082) * (-1187.585) (-1180.566) (-1182.284) [-1183.118] -- 0:00:01
969000 -- [-1182.594] (-1183.504) (-1185.824) (-1185.720) * (-1182.561) [-1180.596] (-1181.368) (-1182.372) -- 0:00:01
969500 -- (-1181.988) [-1183.637] (-1182.088) (-1183.974) * (-1181.193) (-1186.301) [-1184.968] (-1180.666) -- 0:00:01
970000 -- (-1182.579) [-1180.535] (-1180.976) (-1182.092) * [-1182.154] (-1182.514) (-1182.234) (-1180.666) -- 0:00:01
Average standard deviation of split frequencies: 0.007123
970500 -- (-1183.749) (-1180.991) (-1181.335) [-1185.056] * (-1182.856) (-1183.741) [-1182.336] (-1180.666) -- 0:00:01
971000 -- (-1181.380) (-1180.896) (-1184.149) [-1181.422] * (-1185.894) [-1183.018] (-1184.369) (-1182.392) -- 0:00:01
971500 -- (-1184.164) [-1180.470] (-1184.601) (-1181.937) * (-1182.228) [-1181.729] (-1184.686) (-1181.921) -- 0:00:01
972000 -- (-1183.974) (-1180.318) (-1183.382) [-1181.069] * [-1184.431] (-1183.222) (-1181.738) (-1181.732) -- 0:00:01
972500 -- (-1184.437) (-1184.243) [-1187.715] (-1183.339) * (-1184.645) (-1183.386) (-1182.550) [-1184.049] -- 0:00:01
973000 -- (-1181.258) (-1187.551) (-1182.847) [-1182.808] * [-1185.684] (-1180.332) (-1183.922) (-1182.322) -- 0:00:01
973500 -- (-1181.540) (-1184.155) [-1181.644] (-1181.033) * (-1188.174) [-1181.610] (-1181.277) (-1182.190) -- 0:00:01
974000 -- (-1181.614) [-1184.172] (-1185.211) (-1183.436) * (-1184.285) (-1181.027) (-1180.848) [-1181.878] -- 0:00:01
974500 -- (-1181.873) (-1182.921) (-1183.969) [-1185.193] * (-1187.721) [-1187.167] (-1181.880) (-1183.049) -- 0:00:01
975000 -- (-1182.764) (-1184.142) (-1182.386) [-1181.307] * (-1183.136) (-1185.370) (-1181.098) [-1184.167] -- 0:00:01
Average standard deviation of split frequencies: 0.007084
975500 -- (-1182.047) (-1185.496) (-1184.289) [-1182.533] * [-1183.002] (-1182.681) (-1181.526) (-1182.451) -- 0:00:01
976000 -- (-1181.654) [-1181.703] (-1183.449) (-1182.759) * (-1182.663) (-1184.090) (-1183.800) [-1182.581] -- 0:00:01
976500 -- (-1183.944) [-1182.140] (-1180.623) (-1184.004) * (-1181.172) [-1182.200] (-1182.443) (-1182.694) -- 0:00:01
977000 -- (-1184.839) (-1182.054) [-1180.523] (-1185.475) * [-1180.536] (-1184.085) (-1183.829) (-1183.716) -- 0:00:01
977500 -- (-1186.323) (-1182.844) [-1181.144] (-1186.900) * [-1180.576] (-1186.080) (-1186.563) (-1181.561) -- 0:00:01
978000 -- (-1183.781) (-1182.723) [-1181.566] (-1185.219) * (-1181.030) (-1181.464) (-1184.007) [-1182.724] -- 0:00:01
978500 -- (-1182.782) (-1183.311) (-1181.717) [-1184.463] * (-1182.339) [-1183.531] (-1184.471) (-1182.506) -- 0:00:01
979000 -- (-1184.233) (-1182.408) (-1182.238) [-1183.104] * (-1182.551) (-1181.716) (-1185.495) [-1185.359] -- 0:00:01
979500 -- (-1185.773) (-1187.203) [-1182.019] (-1183.208) * (-1182.867) (-1183.787) [-1182.398] (-1181.307) -- 0:00:01
980000 -- [-1183.219] (-1180.872) (-1183.916) (-1182.699) * [-1182.905] (-1182.834) (-1182.579) (-1185.832) -- 0:00:01
Average standard deviation of split frequencies: 0.006922
980500 -- (-1182.864) (-1184.179) (-1181.140) [-1182.450] * (-1185.088) [-1181.051] (-1183.284) (-1185.343) -- 0:00:01
981000 -- [-1181.306] (-1181.840) (-1180.574) (-1183.268) * (-1182.503) [-1181.726] (-1183.099) (-1182.180) -- 0:00:01
981500 -- (-1180.561) (-1181.611) [-1181.001] (-1180.787) * (-1181.955) (-1183.240) [-1181.108] (-1185.009) -- 0:00:01
982000 -- (-1185.472) (-1181.925) (-1181.174) [-1188.103] * (-1181.629) [-1181.490] (-1182.711) (-1183.039) -- 0:00:01
982500 -- (-1187.407) (-1182.813) (-1180.410) [-1183.918] * (-1181.746) [-1182.733] (-1181.348) (-1184.826) -- 0:00:01
983000 -- [-1187.031] (-1183.386) (-1181.292) (-1186.182) * (-1181.088) [-1181.764] (-1185.510) (-1181.272) -- 0:00:01
983500 -- (-1183.592) [-1182.324] (-1192.625) (-1181.649) * (-1181.598) (-1187.621) (-1184.316) [-1181.827] -- 0:00:01
984000 -- (-1183.678) (-1180.926) [-1184.024] (-1182.567) * [-1181.310] (-1183.095) (-1185.461) (-1181.696) -- 0:00:01
984500 -- [-1182.850] (-1183.130) (-1184.590) (-1182.813) * [-1182.875] (-1183.454) (-1184.077) (-1180.383) -- 0:00:00
985000 -- (-1184.815) (-1182.345) (-1182.133) [-1183.138] * [-1186.350] (-1181.172) (-1182.470) (-1181.093) -- 0:00:00
Average standard deviation of split frequencies: 0.006630
985500 -- (-1185.327) (-1182.299) (-1189.159) [-1182.929] * (-1183.869) [-1184.551] (-1184.522) (-1186.444) -- 0:00:00
986000 -- (-1189.983) [-1181.475] (-1187.258) (-1182.543) * (-1182.343) (-1181.321) [-1181.567] (-1182.481) -- 0:00:00
986500 -- (-1192.296) [-1181.433] (-1182.644) (-1182.977) * (-1183.557) (-1184.110) [-1182.753] (-1183.378) -- 0:00:00
987000 -- (-1189.027) [-1181.206] (-1182.583) (-1181.878) * (-1181.492) (-1185.110) [-1183.117] (-1183.273) -- 0:00:00
987500 -- (-1185.246) (-1182.219) [-1184.440] (-1188.608) * (-1182.273) [-1181.902] (-1181.763) (-1180.975) -- 0:00:00
988000 -- (-1183.083) (-1181.348) (-1181.113) [-1180.715] * (-1181.832) [-1182.210] (-1181.576) (-1181.398) -- 0:00:00
988500 -- [-1183.354] (-1181.049) (-1181.199) (-1181.582) * [-1182.797] (-1184.668) (-1183.127) (-1185.264) -- 0:00:00
989000 -- (-1180.946) [-1181.481] (-1184.757) (-1182.728) * [-1190.475] (-1185.422) (-1182.566) (-1183.306) -- 0:00:00
989500 -- (-1180.642) [-1182.187] (-1185.747) (-1184.478) * (-1181.395) (-1187.109) (-1183.334) [-1183.714] -- 0:00:00
990000 -- (-1185.766) [-1182.577] (-1185.986) (-1183.936) * [-1181.768] (-1182.579) (-1181.907) (-1183.575) -- 0:00:00
Average standard deviation of split frequencies: 0.006725
990500 -- (-1187.464) [-1181.606] (-1181.163) (-1183.025) * (-1181.634) (-1183.282) (-1184.152) [-1181.863] -- 0:00:00
991000 -- [-1185.273] (-1180.242) (-1183.674) (-1183.637) * (-1183.185) [-1182.207] (-1186.864) (-1182.725) -- 0:00:00
991500 -- (-1183.768) (-1181.401) [-1181.866] (-1188.826) * (-1183.707) (-1183.313) (-1186.982) [-1180.918] -- 0:00:00
992000 -- (-1185.699) (-1182.457) [-1182.331] (-1185.302) * (-1180.740) [-1181.878] (-1185.013) (-1180.500) -- 0:00:00
992500 -- (-1182.739) [-1181.672] (-1182.275) (-1184.520) * [-1180.492] (-1181.689) (-1181.235) (-1186.565) -- 0:00:00
993000 -- [-1182.261] (-1182.668) (-1181.643) (-1182.835) * (-1182.350) (-1183.716) (-1181.139) [-1185.971] -- 0:00:00
993500 -- [-1184.231] (-1184.512) (-1184.119) (-1182.679) * (-1182.448) (-1182.666) (-1181.936) [-1183.913] -- 0:00:00
994000 -- [-1186.889] (-1181.361) (-1180.771) (-1183.771) * (-1180.957) [-1182.509] (-1182.773) (-1185.114) -- 0:00:00
994500 -- [-1184.943] (-1180.686) (-1181.582) (-1180.601) * (-1184.227) (-1184.069) [-1181.067] (-1183.410) -- 0:00:00
995000 -- (-1182.938) [-1182.284] (-1180.925) (-1181.391) * (-1183.050) [-1183.222] (-1180.399) (-1187.155) -- 0:00:00
Average standard deviation of split frequencies: 0.006784
995500 -- (-1184.252) (-1181.619) (-1181.087) [-1181.686] * (-1183.136) [-1181.371] (-1180.518) (-1185.348) -- 0:00:00
996000 -- [-1181.552] (-1181.076) (-1182.925) (-1181.213) * (-1180.647) (-1183.471) [-1182.181] (-1183.087) -- 0:00:00
996500 -- [-1182.392] (-1182.202) (-1183.042) (-1181.824) * (-1180.897) (-1182.692) (-1182.751) [-1180.312] -- 0:00:00
997000 -- (-1183.207) (-1183.968) [-1182.797] (-1183.459) * [-1183.143] (-1182.613) (-1183.814) (-1186.790) -- 0:00:00
997500 -- (-1185.501) (-1181.490) (-1182.071) [-1183.000] * (-1191.720) (-1182.351) (-1181.847) [-1182.341] -- 0:00:00
998000 -- (-1185.957) (-1182.013) [-1182.255] (-1182.000) * (-1190.125) (-1181.353) (-1182.539) [-1181.714] -- 0:00:00
998500 -- (-1183.219) (-1184.367) (-1180.790) [-1181.330] * (-1185.132) (-1183.118) (-1181.000) [-1182.012] -- 0:00:00
999000 -- (-1184.574) [-1182.540] (-1180.361) (-1181.456) * (-1182.020) [-1181.690] (-1182.600) (-1187.659) -- 0:00:00
999500 -- [-1183.481] (-1183.658) (-1180.760) (-1184.701) * (-1184.102) (-1182.278) (-1181.655) [-1183.597] -- 0:00:00
1000000 -- [-1183.052] (-1180.191) (-1181.616) (-1184.307) * (-1183.266) (-1184.531) (-1182.281) [-1182.101] -- 0:00:00
Average standard deviation of split frequencies: 0.006438
Analysis completed in 1 mins 3 seconds
Analysis used 61.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1180.16
Likelihood of best state for "cold" chain of run 2 was -1180.16
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.8 % ( 29 %) Dirichlet(Pi{all})
28.2 % ( 28 %) Slider(Pi{all})
78.7 % ( 61 %) Multiplier(Alpha{1,2})
77.7 % ( 54 %) Multiplier(Alpha{3})
19.1 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.5 % ( 95 %) Nodeslider(V{all})
30.2 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.7 % ( 29 %) Dirichlet(Pi{all})
28.0 % ( 25 %) Slider(Pi{all})
79.3 % ( 51 %) Multiplier(Alpha{1,2})
77.3 % ( 46 %) Multiplier(Alpha{3})
18.9 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 93 %) Nodeslider(V{all})
30.4 % ( 35 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166430 0.82 0.67
3 | 166681 167620 0.84
4 | 166165 166681 166423
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166739 0.82 0.67
3 | 166185 166726 0.84
4 | 167453 166012 166885
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1181.89
| 1 |
| 2 2 1 |
| 2 1 1 2 |
| 2 1 21 * 1 2 1 11 |
|1 2 1 12 1 2 22 2 1 1 |
| 2 22 1 1 1 2 1 |
| 1 1 1 2 1 21 2 2 12 121 2 1 2 2 22|
| 11 1 1 21 * 2 2 2 11 |
| 2 2 1 2 2 2 * 2 2 122112 1|
| 2 1 1 12 1 2 |
|2 1 1 2 2 12 12 1 |
| 2 1 2 2 |
| 1 1 1 2 2 |
| 1 1 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1183.46
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1181.88 -1185.05
2 -1181.86 -1185.68
--------------------------------------
TOTAL -1181.87 -1185.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900077 0.095081 0.360174 1.511521 0.866776 1283.86 1392.43 1.000
r(A<->C){all} 0.167642 0.021515 0.000001 0.459653 0.126535 160.92 208.06 1.001
r(A<->G){all} 0.163380 0.017725 0.000032 0.433251 0.130393 190.98 216.49 1.000
r(A<->T){all} 0.164845 0.021016 0.000066 0.464621 0.120547 191.04 251.47 1.000
r(C<->G){all} 0.178238 0.020281 0.000134 0.453595 0.144965 250.71 273.80 1.000
r(C<->T){all} 0.164093 0.018995 0.000077 0.436386 0.131833 135.60 238.58 1.000
r(G<->T){all} 0.161803 0.020488 0.000004 0.444117 0.119407 137.52 160.18 1.001
pi(A){all} 0.182244 0.000176 0.157468 0.209985 0.181882 1377.15 1439.07 1.000
pi(C){all} 0.305450 0.000244 0.274072 0.335397 0.305581 1457.18 1479.09 1.000
pi(G){all} 0.314678 0.000244 0.283135 0.344806 0.314433 1383.62 1415.34 1.000
pi(T){all} 0.197628 0.000176 0.171086 0.222661 0.197256 1173.18 1337.09 1.000
alpha{1,2} 0.423145 0.239888 0.000148 1.393650 0.255897 1127.65 1177.33 1.000
alpha{3} 0.476202 0.248250 0.000158 1.531974 0.305838 977.47 1118.64 1.000
pinvar{all} 0.998265 0.000004 0.994514 1.000000 0.998908 1124.48 1138.57 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ..**..
9 -- ...*.*
10 -- .**...
11 -- .*...*
12 -- ....**
13 -- ..*.*.
14 -- .*.*..
15 -- .**.**
16 -- ..****
17 -- .****.
18 -- ..*..*
19 -- .*..*.
20 -- .*.***
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.002355 0.148568 0.151899 2
8 445 0.148235 0.005182 0.144570 0.151899 2
9 443 0.147568 0.005182 0.143904 0.151233 2
10 441 0.146902 0.000471 0.146569 0.147235 2
11 436 0.145237 0.000942 0.144570 0.145903 2
12 435 0.144903 0.003298 0.142572 0.147235 2
13 429 0.142905 0.000471 0.142572 0.143238 2
14 427 0.142239 0.001413 0.141239 0.143238 2
15 425 0.141572 0.013662 0.131912 0.151233 2
16 423 0.140906 0.008951 0.134577 0.147235 2
17 422 0.140573 0.015075 0.129913 0.151233 2
18 418 0.139241 0.009422 0.132578 0.145903 2
19 408 0.135909 0.008480 0.129913 0.141905 2
20 407 0.135576 0.002355 0.133911 0.137242 2
21 401 0.133578 0.019315 0.119920 0.147235 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2391/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100159 0.009877 0.000018 0.296583 0.069274 1.000 2
length{all}[2] 0.102141 0.011369 0.000027 0.306909 0.069513 1.000 2
length{all}[3] 0.102495 0.010554 0.000020 0.309223 0.070139 1.000 2
length{all}[4] 0.099957 0.010416 0.000006 0.296867 0.069222 1.000 2
length{all}[5] 0.099904 0.010385 0.000049 0.309377 0.067678 1.001 2
length{all}[6] 0.099098 0.009737 0.000001 0.300738 0.070460 1.000 2
length{all}[7] 0.092200 0.007662 0.000192 0.281743 0.066986 1.001 2
length{all}[8] 0.090605 0.009587 0.000098 0.270648 0.059053 0.999 2
length{all}[9] 0.095002 0.009894 0.000650 0.310584 0.063176 1.000 2
length{all}[10] 0.097145 0.011141 0.000835 0.291739 0.063054 1.001 2
length{all}[11] 0.099191 0.009099 0.000237 0.281656 0.071691 0.998 2
length{all}[12] 0.096326 0.009534 0.000295 0.267006 0.066307 1.007 2
length{all}[13] 0.100794 0.009802 0.000018 0.306301 0.070920 1.007 2
length{all}[14] 0.102216 0.009580 0.000781 0.299653 0.073517 0.999 2
length{all}[15] 0.099306 0.008993 0.000297 0.309690 0.066586 1.000 2
length{all}[16] 0.093567 0.009234 0.000256 0.275055 0.064377 0.998 2
length{all}[17] 0.100481 0.011870 0.000158 0.310125 0.067287 1.000 2
length{all}[18] 0.100344 0.010062 0.000126 0.287904 0.070495 1.001 2
length{all}[19] 0.097616 0.008639 0.000070 0.281055 0.067818 0.999 2
length{all}[20] 0.091091 0.007710 0.000308 0.270098 0.065972 0.999 2
length{all}[21] 0.098014 0.009165 0.000036 0.308574 0.067842 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006438
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 870
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 290 / 290 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 290 / 290 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108866 0.014313 0.014406 0.019409 0.063259 0.024972 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1205.570073
Iterating by ming2
Initial: fx= 1205.570073
x= 0.10887 0.01431 0.01441 0.01941 0.06326 0.02497 0.30000 1.30000
1 h-m-p 0.0000 0.0000 699.6642 ++ 1181.134640 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0001 82.4623 --------.. | 1/8
3 h-m-p 0.0000 0.0000 639.7595 ++ 1181.002408 m 0.0000 41 | 2/8
4 h-m-p 0.0000 0.0076 67.9408 --------.. | 2/8
5 h-m-p 0.0000 0.0000 571.3835 ++ 1175.304197 m 0.0000 69 | 3/8
6 h-m-p 0.0002 0.0086 55.9980 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 494.2228 ++ 1170.558477 m 0.0000 99 | 4/8
8 h-m-p 0.0002 0.0103 43.3932 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 402.4089 ++ 1148.684496 m 0.0001 129 | 5/8
10 h-m-p 0.0013 0.0158 28.7515 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 285.3558 +++ 1135.459235 m 0.0002 161 | 6/8
12 h-m-p 1.3631 8.0000 0.0000 ++ 1135.459235 m 8.0000 172 | 6/8
13 h-m-p 0.0999 8.0000 0.0011 -----C 1135.459235 0 0.0000 190 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1135.459235 m 8.0000 206 | 6/8
15 h-m-p 0.0160 8.0000 0.2413 ++++C 1135.459227 0 4.4188 223 | 6/8
16 h-m-p 1.6000 8.0000 0.1077 Y 1135.459227 0 0.8637 236 | 6/8
17 h-m-p 1.6000 8.0000 0.0027 Y 1135.459227 0 0.9879 249 | 6/8
18 h-m-p 1.6000 8.0000 0.0003 -Y 1135.459227 0 0.1000 263 | 6/8
19 h-m-p 1.6000 8.0000 0.0000 ++ 1135.459227 m 8.0000 276 | 6/8
20 h-m-p 0.2591 8.0000 0.0006 ++C 1135.459227 0 4.5935 291 | 6/8
21 h-m-p 1.6000 8.0000 0.0000 ++ 1135.459227 m 8.0000 304 | 6/8
22 h-m-p 0.0160 8.0000 0.0120 +++C 1135.459227 0 1.4898 320 | 6/8
23 h-m-p 1.6000 8.0000 0.0002 ----------------.. | 6/8
24 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.459227 m 8.0000 363 | 6/8
25 h-m-p 0.0160 8.0000 0.5037 ---------C 1135.459227 0 0.0000 385 | 6/8
26 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.459227 m 8.0000 401 | 6/8
27 h-m-p 0.0160 8.0000 0.4724 ---------C 1135.459227 0 0.0000 423 | 6/8
28 h-m-p 0.0160 8.0000 0.0008 +++++ 1135.459226 m 8.0000 439 | 6/8
29 h-m-p 0.0160 8.0000 0.4548 ----------Y 1135.459226 0 0.0000 462 | 6/8
30 h-m-p 0.0160 8.0000 0.0000 +++++ 1135.459226 m 8.0000 478 | 6/8
31 h-m-p 0.0160 8.0000 0.2688 ---------C 1135.459226 0 0.0000 500 | 6/8
32 h-m-p 0.0160 8.0000 0.0000 -----Y 1135.459226 0 0.0000 518 | 6/8
33 h-m-p 0.0160 8.0000 0.0000 +++++ 1135.459226 m 8.0000 534 | 6/8
34 h-m-p 0.0160 8.0000 0.4071 ---------Y 1135.459226 0 0.0000 556 | 6/8
35 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
36 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.459226 m 8.0000 596 | 6/8
37 h-m-p 0.0160 8.0000 0.3847 -------------.. | 6/8
38 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.459226 m 8.0000 636 | 6/8
39 h-m-p 0.0160 8.0000 0.5521 ---------C 1135.459226 0 0.0000 658 | 6/8
40 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.459226 m 8.0000 674 | 6/8
41 h-m-p 0.0160 8.0000 0.4530 ---------C 1135.459226 0 0.0000 696 | 6/8
42 h-m-p 0.0160 8.0000 0.0001 ---------Y 1135.459226 0 0.0000 718 | 6/8
43 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.459226 m 8.0000 734 | 6/8
44 h-m-p 0.0160 8.0000 0.5862 ----------Y 1135.459226 0 0.0000 757 | 6/8
45 h-m-p 0.0160 8.0000 0.0000 ---------Y 1135.459226 0 0.0000 779 | 6/8
46 h-m-p 0.0160 8.0000 0.0000 ---------Y 1135.459226 0 0.0000 801
Out..
lnL = -1135.459226
802 lfun, 802 eigenQcodon, 4812 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107819 0.047400 0.091167 0.101793 0.032924 0.014855 1.277778 0.677917 0.249869
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.644560
np = 9
lnL0 = -1243.467258
Iterating by ming2
Initial: fx= 1243.467258
x= 0.10782 0.04740 0.09117 0.10179 0.03292 0.01486 1.27778 0.67792 0.24987
1 h-m-p 0.0000 0.0001 639.2261 ++ 1220.210621 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 530.2522 ++ 1195.406676 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0001 510.7881 ++ 1181.294261 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0003 500.5598 ++ 1144.420476 m 0.0003 50 | 4/9
5 h-m-p 0.0000 0.0000 8914.4711 ++ 1138.985682 m 0.0000 62 | 5/9
6 h-m-p 0.0006 0.0031 13.9420 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 399.4662 ++ 1137.476106 m 0.0000 95 | 6/9
8 h-m-p 0.0002 0.0216 12.2017 ----------.. | 6/9
9 h-m-p 0.0000 0.0000 283.4415 ++ 1135.459182 m 0.0000 127 | 7/9
10 h-m-p 0.1696 8.0000 0.0000 +++ 1135.459182 m 8.0000 140 | 7/9
11 h-m-p 0.0223 8.0000 0.0035 -----Y 1135.459182 0 0.0000 159 | 7/9
12 h-m-p 0.0160 8.0000 0.0002 +++++ 1135.459182 m 8.0000 176 | 7/9
13 h-m-p 0.0023 1.1537 1.1872 +++++ 1135.459176 m 1.1537 193 | 8/9
14 h-m-p 0.0100 0.0499 4.5755 ------------Y 1135.459176 0 0.0000 217 | 8/9
15 h-m-p 0.0013 0.6284 1.2282 +++++ 1135.458655 m 0.6284 232 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 Y 1135.458655 0 0.0160 244
Out..
lnL = -1135.458655
245 lfun, 735 eigenQcodon, 2940 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.075512 0.052720 0.071831 0.091669 0.016887 0.010869 0.000100 1.746055 0.151874 0.412722 2.269860
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.479649
np = 11
lnL0 = -1219.704862
Iterating by ming2
Initial: fx= 1219.704862
x= 0.07551 0.05272 0.07183 0.09167 0.01689 0.01087 0.00011 1.74606 0.15187 0.41272 2.26986
1 h-m-p 0.0000 0.0000 605.8833 ++ 1219.060710 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 310.0527 +++ 1201.053349 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0001 173.0285 ++ 1194.636702 m 0.0001 45 | 3/11
4 h-m-p 0.0001 0.0027 82.3153 +++ 1161.112512 m 0.0027 60 | 4/11
5 h-m-p 0.0000 0.0000 2309.9914 ++ 1144.322057 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 941.1955 ++ 1141.704379 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 10229.5490 ++ 1138.935098 m 0.0000 102 | 7/11
8 h-m-p 0.0160 8.0000 5.0593 -------------.. | 7/11
9 h-m-p 0.0000 0.0000 272.4073 ++ 1135.459065 m 0.0000 141 | 8/11
10 h-m-p 0.1034 8.0000 0.0000 ++++ 1135.459065 m 8.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 1.0269 ----------Y 1135.459065 0 0.0000 184 | 8/11
12 h-m-p 0.0160 8.0000 0.0010 +++++ 1135.459065 m 8.0000 201 | 8/11
13 h-m-p 0.0012 0.1887 6.8842 ++++ 1135.459023 m 0.1887 220 | 9/11
14 h-m-p 0.8331 8.0000 0.7548 +C 1135.458967 0 3.3324 235 | 9/11
15 h-m-p 1.6000 8.0000 0.3235 Y 1135.458965 0 1.2128 251 | 9/11
16 h-m-p 1.6000 8.0000 0.0446 Y 1135.458965 0 0.8715 267 | 9/11
17 h-m-p 1.6000 8.0000 0.0003 C 1135.458965 0 1.6000 283 | 9/11
18 h-m-p 1.6000 8.0000 0.0000 ++ 1135.458965 m 8.0000 299 | 9/11
19 h-m-p 0.0160 8.0000 0.0192 ----N 1135.458965 0 0.0000 319 | 9/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 1135.458965 m 8.0000 338 | 9/11
21 h-m-p 0.0160 8.0000 0.3772 +++Y 1135.458964 0 0.8041 357 | 9/11
22 h-m-p 1.6000 8.0000 0.0107 -----------N 1135.458964 0 0.0000 384 | 9/11
23 h-m-p 0.0160 8.0000 0.5496 +++C 1135.458961 0 0.9996 403 | 9/11
24 h-m-p 1.6000 8.0000 0.0639 ++ 1135.458936 m 8.0000 419 | 9/11
25 h-m-p 0.1218 8.0000 4.1952 ++++ 1135.458670 m 8.0000 437 | 9/11
26 h-m-p 1.6000 8.0000 0.2488 ++ 1135.458657 m 8.0000 451 | 9/11
27 h-m-p 1.6000 8.0000 0.3679 ++ 1135.458655 m 8.0000 467 | 9/11
28 h-m-p 1.6000 8.0000 0.1905 ++ 1135.458655 m 8.0000 483 | 9/11
29 h-m-p 1.6000 8.0000 0.4624 ++ 1135.458655 m 8.0000 499 | 9/11
30 h-m-p 1.6000 8.0000 0.1528 ++ 1135.458655 m 8.0000 515 | 9/11
31 h-m-p 1.6000 8.0000 0.7629 ++ 1135.458655 m 8.0000 531 | 9/11
32 h-m-p 1.6000 8.0000 0.0000 N 1135.458655 0 1.6000 547 | 9/11
33 h-m-p 0.0160 8.0000 0.0000 Y 1135.458655 0 0.0160 563
Out..
lnL = -1135.458655
564 lfun, 2256 eigenQcodon, 10152 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1135.532293 S = -1135.460153 -0.028023
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:05
did 20 / 55 patterns 0:05
did 30 / 55 patterns 0:05
did 40 / 55 patterns 0:05
did 50 / 55 patterns 0:05
did 55 / 55 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109127 0.030426 0.011593 0.042230 0.020946 0.040089 0.000100 0.352021 1.923681
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 26.357817
np = 9
lnL0 = -1201.785937
Iterating by ming2
Initial: fx= 1201.785937
x= 0.10913 0.03043 0.01159 0.04223 0.02095 0.04009 0.00011 0.35202 1.92368
1 h-m-p 0.0000 0.0000 614.4948 ++ 1201.459503 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0049 61.9830 +++++ 1186.477152 m 0.0049 29 | 2/9
3 h-m-p 0.0000 0.0000 1726.4440 ++ 1183.487596 m 0.0000 41 | 3/9
4 h-m-p 0.0002 0.0008 35.1554 ++ 1175.932970 m 0.0008 53 | 4/9
5 h-m-p 0.0002 0.0012 63.9723 ++ 1172.119119 m 0.0012 65 | 5/9
6 h-m-p 0.0001 0.0003 526.5844 ++ 1156.723316 m 0.0003 77 | 6/9
7 h-m-p 0.0059 0.0518 26.5282 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 355.6430 ++ 1154.309224 m 0.0000 111 | 7/9
9 h-m-p 0.0160 8.0000 0.8279 -------------.. | 7/9
10 h-m-p 0.0000 0.0003 241.6856 +++ 1135.458655 m 0.0003 149 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 1135.458655 0 0.4000 161 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 ------N 1135.458655 0 0.0001 180
Out..
lnL = -1135.458655
181 lfun, 1991 eigenQcodon, 10860 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.084960 0.054727 0.091772 0.023503 0.056658 0.108480 0.000100 0.900000 1.111763 1.539065 2.656887
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.580838
np = 11
lnL0 = -1238.960818
Iterating by ming2
Initial: fx= 1238.960818
x= 0.08496 0.05473 0.09177 0.02350 0.05666 0.10848 0.00011 0.90000 1.11176 1.53906 2.65689
1 h-m-p 0.0000 0.0000 539.9453 ++ 1238.690966 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 1046.5734 ++ 1206.176151 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0002 508.1254 ++ 1168.949641 m 0.0002 44 | 3/11
4 h-m-p 0.0016 0.0113 46.9801 ++ 1144.916723 m 0.0113 58 | 4/11
5 h-m-p 0.0000 0.0000 123506.3615 ++ 1143.012320 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0001 1956.9273 ++ 1140.785032 m 0.0001 86 | 6/11
7 h-m-p 0.0000 0.0000 52443.4435 ++ 1135.459197 m 0.0000 100 | 7/11
8 h-m-p 1.6000 8.0000 0.0008 ++ 1135.459197 m 8.0000 114 | 7/11
9 h-m-p 0.0087 2.8924 0.7327 +++++ 1135.459139 m 2.8924 135 | 8/11
10 h-m-p 0.1975 0.9873 2.4480 +
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
+ 1135.458655 m 0.9873 153
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.202224e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161669e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
| 9/11
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
N 1135.458655 0 1.6000 167
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.202224e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24892) = 1.161591e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24867) = 1.161750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
| 9/11
12 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
N 1135.458655 0 0.0160 183
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
Out..
lnL = -1135.458655
184 lfun, 2208 eigenQcodon, 12144 P(t)
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1135.553722 S = -1135.460152 -0.041953
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:11
did 20 / 55 patterns 0:11
did 30 / 55 patterns 0:11
did 40 / 55 patterns 0:12
did 50 / 55 patterns 0:12
did 55 / 55 patterns 0:12
QuantileBeta(0.15, 0.00500, 2.24880) = 1.161670e-160 2000 rounds
Time used: 0:12
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2391/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 290
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 6 6 6 6 6 6 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 7 7 7 7 7 7 | TCC 5 5 5 5 5 5 | TAC 6 6 6 6 6 6 | TGC 5 5 5 5 5 5
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 9 9 9 9 9 9 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 6 6 6 6 6 6 | Arg CGT 4 4 4 4 4 4
CTC 3 3 3 3 3 3 | CCC 7 7 7 7 7 7 | CAC 10 10 10 10 10 10 | CGC 7 7 7 7 7 7
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 10 10 10 10 10 10 | CCG 12 12 12 12 12 12 | CAG 6 6 6 6 6 6 | CGG 10 10 10 10 10 10
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 5 5 5 5 5 5 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 3 3 3 3 3 3 | AAG 8 8 8 8 8 8 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 8 8 8 8 8 8 | Asp GAT 8 8 8 8 8 8 | Gly GGT 3 3 3 3 3 3
GTC 3 3 3 3 3 3 | GCC 11 11 11 11 11 11 | GAC 14 14 14 14 14 14 | GGC 12 12 12 12 12 12
GTA 2 2 2 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 9 9 9 9 9 9 | GGA 2 2 2 2 2 2
GTG 12 12 12 12 12 12 | GCG 10 10 10 10 10 10 | GAG 13 13 13 13 13 13 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908867_1_2558_MLBR_RS12185
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
#2: NC_002677_1_NP_302547_1_1419_ML2391
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
#3: NZ_LVXE01000076_1_WP_010908867_1_2652_A3216_RS13400
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
#4: NZ_LYPH01000076_1_WP_010908867_1_2524_A8144_RS12120
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
#5: NZ_CP029543_1_WP_010908867_1_2583_mca
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
#6: NZ_AP014567_1_WP_010908867_1_2647_mca
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 36 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 42 | TCC 30 | TAC 36 | TGC 30
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 54 | TCG 24 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 36 | Arg R CGT 24
CTC 18 | CCC 42 | CAC 60 | CGC 42
CTA 6 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 60 | CCG 72 | CAG 36 | CGG 60
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 30 | Asn N AAT 6 | Ser S AGT 0
ATC 24 | ACC 24 | AAC 18 | AGC 18
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 24 | ACG 18 | AAG 48 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 48 | Asp D GAT 48 | Gly G GGT 18
GTC 18 | GCC 66 | GAC 84 | GGC 72
GTA 12 | GCA 24 | Glu E GAA 54 | GGA 12
GTG 72 | GCG 60 | GAG 78 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17241 C:0.28966 A:0.14483 G:0.39310
position 2: T:0.24138 C:0.26897 A:0.30690 G:0.18276
position 3: T:0.17931 C:0.35862 A:0.09310 G:0.36897
Average T:0.19770 C:0.30575 A:0.18161 G:0.31494
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1135.459226 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.277778 0.702277
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908867_1_2558_MLBR_RS12185: 0.000004, NC_002677_1_NP_302547_1_1419_ML2391: 0.000004, NZ_LVXE01000076_1_WP_010908867_1_2652_A3216_RS13400: 0.000004, NZ_LYPH01000076_1_WP_010908867_1_2524_A8144_RS12120: 0.000004, NZ_CP029543_1_WP_010908867_1_2583_mca: 0.000004, NZ_AP014567_1_WP_010908867_1_2647_mca: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.27778
omega (dN/dS) = 0.70228
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 670.6 199.4 0.7023 0.0000 0.0000 0.0 0.0
7..2 0.000 670.6 199.4 0.7023 0.0000 0.0000 0.0 0.0
7..3 0.000 670.6 199.4 0.7023 0.0000 0.0000 0.0 0.0
7..4 0.000 670.6 199.4 0.7023 0.0000 0.0000 0.0 0.0
7..5 0.000 670.6 199.4 0.7023 0.0000 0.0000 0.0 0.0
7..6 0.000 670.6 199.4 0.7023 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1135.458655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908867_1_2558_MLBR_RS12185: 0.000004, NC_002677_1_NP_302547_1_1419_ML2391: 0.000004, NZ_LVXE01000076_1_WP_010908867_1_2652_A3216_RS13400: 0.000004, NZ_LYPH01000076_1_WP_010908867_1_2524_A8144_RS12120: 0.000004, NZ_CP029543_1_WP_010908867_1_2583_mca: 0.000004, NZ_AP014567_1_WP_010908867_1_2647_mca: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1135.458655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908867_1_2558_MLBR_RS12185: 0.000004, NC_002677_1_NP_302547_1_1419_ML2391: 0.000004, NZ_LVXE01000076_1_WP_010908867_1_2652_A3216_RS13400: 0.000004, NZ_LYPH01000076_1_WP_010908867_1_2524_A8144_RS12120: 0.000004, NZ_CP029543_1_WP_010908867_1_2583_mca: 0.000004, NZ_AP014567_1_WP_010908867_1_2647_mca: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908867_1_2558_MLBR_RS12185)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.104 0.103 0.102 0.101 0.100 0.099 0.098 0.098 0.097 0.096
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011
0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011
0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1135.458655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.665007
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908867_1_2558_MLBR_RS12185: 0.000004, NC_002677_1_NP_302547_1_1419_ML2391: 0.000004, NZ_LVXE01000076_1_WP_010908867_1_2652_A3216_RS13400: 0.000004, NZ_LYPH01000076_1_WP_010908867_1_2524_A8144_RS12120: 0.000004, NZ_CP029543_1_WP_010908867_1_2583_mca: 0.000004, NZ_AP014567_1_WP_010908867_1_2647_mca: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.66501
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1135.458655 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.248798 3.529048
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908867_1_2558_MLBR_RS12185: 0.000004, NC_002677_1_NP_302547_1_1419_ML2391: 0.000004, NZ_LVXE01000076_1_WP_010908867_1_2652_A3216_RS13400: 0.000004, NZ_LYPH01000076_1_WP_010908867_1_2524_A8144_RS12120: 0.000004, NZ_CP029543_1_WP_010908867_1_2583_mca: 0.000004, NZ_AP014567_1_WP_010908867_1_2647_mca: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.24880
(p1 = 0.00001) w = 3.52905
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.52905
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 705.2 164.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908867_1_2558_MLBR_RS12185)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.093 0.094 0.096 0.097 0.099 0.101 0.102 0.104 0.106 0.107
p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.107 0.105 0.104 0.102 0.101 0.099 0.098 0.096 0.095 0.094
Time used: 0:12