--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:55:00 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2392/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -588.93 -592.94
2 -588.87 -592.14
--------------------------------------
TOTAL -588.90 -592.62
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891530 0.087313 0.347974 1.467001 0.861369 1372.68 1436.84 1.000
r(A<->C){all} 0.168838 0.020818 0.000161 0.460192 0.129014 183.73 227.97 1.000
r(A<->G){all} 0.170234 0.019051 0.000550 0.442348 0.139500 153.76 218.29 1.005
r(A<->T){all} 0.157609 0.017899 0.000016 0.429874 0.123367 193.93 229.60 1.000
r(C<->G){all} 0.159208 0.019369 0.000002 0.439756 0.119861 270.25 297.30 1.013
r(C<->T){all} 0.162124 0.019047 0.000112 0.442701 0.123054 117.80 221.87 1.000
r(G<->T){all} 0.181987 0.022866 0.000001 0.482234 0.141771 155.48 175.44 1.006
pi(A){all} 0.197535 0.000375 0.161074 0.236939 0.196976 1146.16 1206.07 1.000
pi(C){all} 0.308741 0.000498 0.264717 0.350346 0.308349 1216.07 1343.25 1.000
pi(G){all} 0.305193 0.000488 0.263354 0.350390 0.304971 1334.62 1383.07 1.000
pi(T){all} 0.188531 0.000351 0.151366 0.223611 0.188087 1181.23 1230.63 1.000
alpha{1,2} 0.422952 0.227647 0.000491 1.400559 0.249429 1244.95 1266.19 1.000
alpha{3} 0.461538 0.250938 0.000175 1.458216 0.295714 1060.63 1116.22 1.001
pinvar{all} 0.996351 0.000019 0.988080 0.999997 0.997722 1292.11 1396.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -573.20013
Model 2: PositiveSelection -573.200119
Model 0: one-ratio -573.200135
Model 7: beta -573.20013
Model 8: beta&w>1 -573.200128
Model 0 vs 1 1.0000000202126103E-5
Model 2 vs 1 2.199999994445534E-5
Model 8 vs 7 3.999999989900971E-6
>C1
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C2
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C3
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C4
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C5
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C6
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=144
C1 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C2 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C3 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C4 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C5 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C6 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
**************************************************
C1 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C2 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C3 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C4 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C5 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C6 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
**************************************************
C1 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C2 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C3 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C4 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C5 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C6 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 144 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 144 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4320]--->[4320]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.677 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C2 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C3 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C4 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C5 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
C6 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
**************************************************
C1 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C2 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C3 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C4 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C5 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
C6 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
**************************************************
C1 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C2 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C3 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C4 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C5 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
C6 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
C2 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
C3 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
C4 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
C5 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
C6 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
**************************************************
C1 ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
C2 ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
C3 ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
C4 ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
C5 ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
C6 ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
**************************************************
C1 CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
C2 CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
C3 CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
C4 CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
C5 CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
C6 CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
**************************************************
C1 ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
C2 ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
C3 ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
C4 ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
C5 ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
C6 ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
**************************************************
C1 GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
C2 GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
C3 GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
C4 GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
C5 GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
C6 GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
**************************************************
C1 TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
C2 TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
C3 TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
C4 TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
C5 TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
C6 TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
**************************************************
C1 CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
C2 CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
C3 CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
C4 CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
C5 CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
C6 CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
**************************************************
C1 GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
C2 GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
C3 GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
C4 GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
C5 GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
C6 GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
**************************************************
C1 GAACCGATGTACCGGGCTACCTGCGCCCAGCC
C2 GAACCGATGTACCGGGCTACCTGCGCCCAGCC
C3 GAACCGATGTACCGGGCTACCTGCGCCCAGCC
C4 GAACCGATGTACCGGGCTACCTGCGCCCAGCC
C5 GAACCGATGTACCGGGCTACCTGCGCCCAGCC
C6 GAACCGATGTACCGGGCTACCTGCGCCCAGCC
********************************
>C1
ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>C2
ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>C3
ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>C4
ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>C5
ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>C6
ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG
ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG
CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC
ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA
GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG
TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA
CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC
GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG
GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>C1
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C2
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C3
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C4
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C5
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
>C6
MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 432 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856023
Setting output file names to "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 461188711
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5823832713
Seed = 186589257
Swapseed = 1579856023
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -966.836711 -- -24.965149
Chain 2 -- -966.836656 -- -24.965149
Chain 3 -- -966.836711 -- -24.965149
Chain 4 -- -966.836656 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -966.836564 -- -24.965149
Chain 2 -- -966.836711 -- -24.965149
Chain 3 -- -966.836711 -- -24.965149
Chain 4 -- -966.836711 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-966.837] (-966.837) (-966.837) (-966.837) * [-966.837] (-966.837) (-966.837) (-966.837)
500 -- [-598.471] (-611.422) (-612.506) (-607.365) * (-605.928) (-602.312) [-596.179] (-605.236) -- 0:00:00
1000 -- [-593.946] (-612.197) (-599.466) (-600.034) * [-597.502] (-597.442) (-604.652) (-606.471) -- 0:00:00
1500 -- (-593.779) [-596.052] (-608.787) (-600.103) * (-601.870) (-594.998) [-605.628] (-611.900) -- 0:00:00
2000 -- [-597.156] (-598.188) (-595.139) (-604.654) * (-599.520) [-597.780] (-598.543) (-599.457) -- 0:00:00
2500 -- (-604.962) (-606.875) [-594.021] (-600.296) * (-600.252) [-595.492] (-598.185) (-599.111) -- 0:00:00
3000 -- (-601.770) (-600.928) (-596.118) [-598.025] * [-597.792] (-596.322) (-601.867) (-600.894) -- 0:00:00
3500 -- (-600.364) (-598.350) [-594.177] (-602.079) * (-599.806) [-597.069] (-598.155) (-594.896) -- 0:00:00
4000 -- (-600.270) (-605.726) (-600.581) [-594.521] * [-599.828] (-601.794) (-594.392) (-609.828) -- 0:00:00
4500 -- (-598.550) [-600.204] (-602.121) (-598.778) * (-595.586) (-600.292) [-599.512] (-597.259) -- 0:00:00
5000 -- (-599.273) (-605.116) (-604.531) [-596.578] * [-597.192] (-597.442) (-605.967) (-599.702) -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- (-598.903) (-598.366) (-607.280) [-598.545] * (-596.086) [-597.587] (-604.225) (-594.556) -- 0:00:00
6000 -- [-597.281] (-604.558) (-599.503) (-594.743) * (-600.539) (-595.245) [-596.838] (-603.168) -- 0:00:00
6500 -- (-596.616) (-602.803) [-598.560] (-594.945) * [-595.684] (-603.715) (-599.012) (-606.704) -- 0:00:00
7000 -- (-596.293) (-593.581) (-596.015) [-596.542] * [-595.869] (-597.210) (-597.333) (-601.220) -- 0:00:00
7500 -- (-593.696) (-588.314) (-604.595) [-598.551] * (-595.485) [-594.976] (-596.856) (-603.854) -- 0:00:00
8000 -- (-598.996) (-589.071) [-598.222] (-595.167) * (-609.420) (-594.708) (-597.302) [-587.887] -- 0:00:00
8500 -- (-603.624) (-589.774) [-602.983] (-605.952) * (-602.408) (-594.784) (-603.868) [-587.699] -- 0:00:00
9000 -- (-596.381) (-591.561) [-595.730] (-597.598) * (-606.686) (-601.949) [-595.821] (-589.025) -- 0:00:00
9500 -- (-599.785) (-590.707) (-598.777) [-593.237] * (-600.394) (-601.852) [-597.302] (-588.369) -- 0:00:00
10000 -- (-598.874) [-588.480] (-609.046) (-597.496) * [-595.249] (-598.149) (-614.526) (-588.342) -- 0:01:39
Average standard deviation of split frequencies: 0.068300
10500 -- (-594.317) (-593.757) (-599.654) [-598.689] * (-604.047) (-597.262) (-596.174) [-587.845] -- 0:01:34
11000 -- (-601.652) (-592.679) [-598.278] (-594.447) * [-598.382] (-603.369) (-588.477) (-587.995) -- 0:01:29
11500 -- [-598.316] (-589.848) (-601.258) (-600.416) * (-600.057) (-596.200) [-589.285] (-590.303) -- 0:01:25
12000 -- (-596.282) (-587.704) (-607.080) [-591.588] * (-598.737) (-598.206) [-588.171] (-588.551) -- 0:01:22
12500 -- [-596.123] (-589.995) (-597.460) (-601.066) * (-596.144) [-594.968] (-592.510) (-589.866) -- 0:01:19
13000 -- (-599.502) (-587.807) (-595.820) [-601.567] * (-598.065) [-593.199] (-590.551) (-591.196) -- 0:01:15
13500 -- (-605.296) (-587.861) (-603.320) [-598.503] * [-602.294] (-600.939) (-594.852) (-590.876) -- 0:01:13
14000 -- (-605.189) (-588.489) (-594.808) [-595.376] * (-598.635) [-597.291] (-591.201) (-596.732) -- 0:01:10
14500 -- (-597.971) (-588.905) [-596.619] (-599.544) * (-596.937) (-597.932) (-588.202) [-588.178] -- 0:01:07
15000 -- (-597.837) [-588.336] (-600.087) (-596.144) * (-595.595) (-599.046) [-589.657] (-587.561) -- 0:01:05
Average standard deviation of split frequencies: 0.083189
15500 -- (-599.466) [-588.091] (-596.838) (-606.345) * [-596.018] (-594.610) (-591.175) (-588.099) -- 0:01:03
16000 -- (-594.708) (-589.910) [-593.988] (-600.662) * (-594.432) (-593.254) (-588.601) [-590.702] -- 0:01:01
16500 -- (-594.771) [-587.818] (-597.454) (-601.679) * (-602.644) [-597.693] (-588.458) (-588.948) -- 0:00:59
17000 -- (-605.762) (-588.256) [-594.687] (-609.281) * (-597.943) [-601.149] (-591.458) (-590.406) -- 0:00:57
17500 -- (-600.705) (-588.101) [-597.034] (-589.913) * [-598.996] (-599.669) (-590.314) (-589.524) -- 0:00:56
18000 -- (-605.028) (-589.524) (-600.589) [-592.506] * (-603.509) [-597.333] (-588.463) (-588.266) -- 0:00:54
18500 -- (-597.283) (-589.552) (-597.941) [-589.185] * (-600.009) [-597.421] (-589.288) (-591.287) -- 0:00:53
19000 -- (-607.859) (-588.584) [-595.056] (-589.865) * (-600.996) [-599.991] (-588.696) (-589.361) -- 0:00:51
19500 -- (-599.762) (-590.231) [-607.225] (-588.554) * (-601.898) (-595.174) (-588.217) [-590.146] -- 0:00:50
20000 -- (-594.709) (-591.123) [-597.431] (-591.611) * (-604.141) (-597.091) [-589.042] (-591.220) -- 0:00:49
Average standard deviation of split frequencies: 0.078034
20500 -- (-600.371) (-588.054) (-599.537) [-587.461] * (-605.204) [-595.391] (-590.340) (-589.873) -- 0:00:47
21000 -- (-600.040) [-588.653] (-598.272) (-592.500) * (-599.213) [-595.876] (-588.902) (-589.927) -- 0:00:46
21500 -- (-598.103) (-588.419) [-599.149] (-588.587) * (-598.406) (-596.815) (-590.094) [-591.068] -- 0:00:45
22000 -- (-597.068) (-588.401) (-601.038) [-589.294] * [-594.637] (-605.251) (-589.782) (-600.310) -- 0:00:44
22500 -- [-595.768] (-588.003) (-597.905) (-589.937) * (-596.778) (-603.191) (-591.652) [-588.968] -- 0:00:43
23000 -- [-600.210] (-588.755) (-598.329) (-590.820) * (-598.912) [-598.458] (-589.724) (-588.764) -- 0:00:42
23500 -- (-595.129) [-589.355] (-599.698) (-591.571) * (-605.911) (-607.690) (-590.118) [-588.926] -- 0:00:41
24000 -- (-596.921) [-588.641] (-596.779) (-590.109) * (-608.018) [-588.793] (-589.730) (-590.290) -- 0:00:40
24500 -- (-599.662) (-589.455) (-598.009) [-588.325] * (-597.443) (-590.238) (-590.267) [-588.520] -- 0:00:39
25000 -- (-601.271) (-590.058) [-595.121] (-588.457) * [-596.445] (-591.460) (-593.786) (-589.347) -- 0:00:39
Average standard deviation of split frequencies: 0.054393
25500 -- [-590.304] (-589.227) (-594.936) (-594.782) * (-595.852) (-589.049) (-587.881) [-590.237] -- 0:01:16
26000 -- [-590.589] (-590.822) (-596.388) (-594.572) * (-598.173) (-589.492) [-588.638] (-590.416) -- 0:01:14
26500 -- (-596.248) (-589.839) [-603.768] (-589.758) * (-604.490) (-589.377) [-589.341] (-591.268) -- 0:01:13
27000 -- [-590.421] (-590.841) (-600.116) (-589.293) * [-601.100] (-590.331) (-589.215) (-588.375) -- 0:01:12
27500 -- (-588.530) (-590.672) (-596.029) [-588.512] * (-607.617) (-588.989) (-592.838) [-587.972] -- 0:01:10
28000 -- [-589.481] (-588.799) (-600.383) (-593.580) * (-605.196) [-590.384] (-589.030) (-588.096) -- 0:01:09
28500 -- [-589.124] (-589.350) (-598.454) (-589.045) * [-598.170] (-589.513) (-591.500) (-591.382) -- 0:01:08
29000 -- (-591.607) [-589.771] (-599.509) (-589.826) * [-597.939] (-590.235) (-590.180) (-589.617) -- 0:01:06
29500 -- (-588.661) [-588.027] (-594.888) (-588.250) * (-597.997) [-590.980] (-591.887) (-592.780) -- 0:01:05
30000 -- [-588.693] (-588.396) (-600.595) (-588.448) * (-599.051) (-589.982) (-588.906) [-587.398] -- 0:01:04
Average standard deviation of split frequencies: 0.059182
30500 -- (-589.751) (-589.868) (-601.660) [-588.811] * (-599.223) (-591.265) [-587.664] (-589.513) -- 0:01:03
31000 -- (-589.872) [-594.623] (-600.408) (-587.322) * (-593.196) (-592.702) [-590.071] (-588.543) -- 0:01:02
31500 -- (-594.555) (-588.602) [-601.761] (-587.617) * (-600.375) [-591.942] (-589.419) (-589.352) -- 0:01:01
32000 -- (-588.570) (-589.151) (-598.849) [-588.798] * (-599.479) (-590.370) [-592.865] (-595.589) -- 0:01:00
32500 -- (-591.017) [-588.004] (-598.649) (-590.036) * (-600.197) (-590.792) (-590.815) [-589.445] -- 0:00:59
33000 -- (-589.113) (-595.393) [-596.642] (-590.419) * (-602.426) (-589.234) [-588.262] (-590.905) -- 0:00:58
33500 -- [-590.180] (-592.332) (-599.917) (-589.418) * (-595.925) (-590.371) (-592.325) [-588.903] -- 0:00:57
34000 -- (-588.622) (-592.551) (-607.137) [-589.562] * (-602.562) (-591.527) [-588.637] (-588.191) -- 0:00:56
34500 -- [-588.691] (-590.395) (-596.962) (-591.763) * [-598.724] (-589.476) (-587.400) (-591.810) -- 0:00:55
35000 -- (-589.107) [-588.891] (-599.353) (-591.549) * (-599.257) (-591.206) [-590.920] (-588.888) -- 0:00:55
Average standard deviation of split frequencies: 0.041903
35500 -- (-590.964) (-588.493) [-596.062] (-596.917) * (-599.452) [-593.893] (-590.105) (-589.120) -- 0:00:54
36000 -- [-588.943] (-587.864) (-603.091) (-592.355) * (-600.027) (-591.287) [-589.580] (-591.032) -- 0:00:53
36500 -- (-591.688) [-589.694] (-597.205) (-590.575) * (-597.999) (-591.498) (-590.379) [-589.175] -- 0:00:52
37000 -- (-590.631) (-588.092) (-600.750) [-589.954] * (-598.783) [-592.096] (-588.598) (-588.721) -- 0:00:52
37500 -- [-592.129] (-587.698) (-596.941) (-590.823) * (-594.953) [-589.230] (-587.958) (-588.907) -- 0:00:51
38000 -- (-591.060) (-595.497) [-594.941] (-587.663) * (-597.352) [-588.548] (-589.389) (-588.776) -- 0:00:50
38500 -- (-590.771) (-590.466) (-600.723) [-588.776] * (-598.334) (-593.409) [-589.947] (-588.181) -- 0:00:49
39000 -- (-588.939) (-589.164) [-601.838] (-589.056) * [-602.215] (-588.594) (-589.364) (-589.588) -- 0:00:49
39500 -- [-588.169] (-589.630) (-597.423) (-590.933) * [-605.888] (-588.804) (-588.259) (-590.337) -- 0:00:48
40000 -- [-589.327] (-589.163) (-606.906) (-594.085) * (-600.360) (-587.665) [-593.086] (-588.718) -- 0:00:48
Average standard deviation of split frequencies: 0.038640
40500 -- (-590.234) (-589.045) [-599.548] (-591.278) * [-602.129] (-588.985) (-593.934) (-588.647) -- 0:00:47
41000 -- [-587.701] (-589.357) (-600.888) (-590.580) * (-602.306) (-593.111) (-591.624) [-587.738] -- 0:00:46
41500 -- (-591.050) (-589.211) [-597.450] (-589.972) * (-602.172) (-590.340) (-587.965) [-591.154] -- 0:00:46
42000 -- [-590.129] (-590.109) (-612.390) (-590.605) * (-607.089) [-590.243] (-589.101) (-588.536) -- 0:01:08
42500 -- (-590.757) [-590.111] (-598.465) (-588.010) * (-595.744) (-593.762) (-588.704) [-588.594] -- 0:01:07
43000 -- (-588.583) (-589.259) [-595.668] (-589.786) * (-605.484) (-592.464) [-588.876] (-589.313) -- 0:01:06
43500 -- (-587.504) (-594.656) (-595.606) [-589.320] * [-593.439] (-590.894) (-588.936) (-589.797) -- 0:01:05
44000 -- [-590.225] (-591.313) (-606.225) (-590.332) * (-614.627) [-590.420] (-588.281) (-589.945) -- 0:01:05
44500 -- [-591.288] (-590.366) (-599.500) (-589.842) * (-597.373) (-590.789) (-588.901) [-588.154] -- 0:01:04
45000 -- (-593.576) (-589.677) [-602.721] (-588.291) * (-601.531) (-590.086) [-589.885] (-588.321) -- 0:01:03
Average standard deviation of split frequencies: 0.036677
45500 -- (-590.700) [-590.563] (-602.632) (-590.056) * [-594.429] (-588.248) (-591.536) (-591.067) -- 0:01:02
46000 -- (-590.915) (-589.263) [-591.921] (-589.259) * (-600.237) (-587.763) (-587.811) [-593.614] -- 0:01:02
46500 -- (-590.600) (-589.010) [-594.924] (-589.756) * (-601.265) (-588.545) [-589.155] (-592.427) -- 0:01:01
47000 -- (-588.708) (-590.313) (-598.021) [-589.591] * (-602.405) (-589.529) [-591.497] (-589.979) -- 0:01:00
47500 -- (-596.570) (-588.354) (-598.532) [-588.281] * (-612.990) [-590.163] (-589.581) (-591.989) -- 0:01:00
48000 -- (-588.773) (-588.816) [-601.289] (-588.764) * (-588.269) (-591.763) (-594.241) [-591.506] -- 0:00:59
48500 -- [-595.126] (-588.166) (-608.611) (-589.808) * (-588.527) [-590.876] (-590.819) (-591.236) -- 0:00:58
49000 -- (-590.193) (-589.192) (-608.875) [-588.151] * [-588.473] (-589.216) (-590.011) (-592.855) -- 0:00:58
49500 -- (-591.878) [-590.806] (-599.635) (-590.391) * (-588.951) (-590.963) [-590.703] (-593.903) -- 0:00:57
50000 -- (-588.611) [-590.054] (-596.453) (-591.487) * [-590.310] (-592.075) (-588.372) (-589.139) -- 0:00:57
Average standard deviation of split frequencies: 0.033029
50500 -- [-589.591] (-590.346) (-590.712) (-589.509) * (-592.516) (-590.022) (-589.072) [-589.135] -- 0:00:56
51000 -- (-592.306) (-589.996) [-589.511] (-591.830) * (-589.009) [-588.801] (-590.413) (-589.196) -- 0:00:55
51500 -- (-591.777) (-588.425) [-590.632] (-592.272) * (-588.374) [-588.137] (-589.419) (-590.229) -- 0:00:55
52000 -- [-588.761] (-589.674) (-592.897) (-592.743) * (-588.189) (-590.840) (-590.248) [-588.642] -- 0:00:54
52500 -- (-590.281) [-588.230] (-591.657) (-590.397) * (-587.749) (-589.686) (-589.384) [-588.867] -- 0:00:54
53000 -- (-590.505) (-590.787) (-590.509) [-591.226] * (-587.787) [-588.523] (-588.580) (-588.468) -- 0:00:53
53500 -- (-591.744) [-587.825] (-588.597) (-593.091) * (-588.570) (-593.611) [-590.416] (-589.915) -- 0:00:53
54000 -- (-592.038) [-588.778] (-593.042) (-591.887) * (-589.797) (-589.907) (-589.349) [-587.812] -- 0:00:52
54500 -- [-587.907] (-588.630) (-588.409) (-591.762) * [-590.186] (-589.725) (-588.767) (-587.928) -- 0:00:52
55000 -- (-588.851) [-589.608] (-589.424) (-589.124) * [-589.551] (-591.994) (-587.828) (-590.115) -- 0:00:51
Average standard deviation of split frequencies: 0.023149
55500 -- (-588.724) (-590.719) [-590.356] (-591.544) * (-591.389) (-589.168) [-588.317] (-591.174) -- 0:00:51
56000 -- [-589.516] (-589.032) (-588.925) (-591.310) * (-591.171) [-589.169] (-588.359) (-588.291) -- 0:00:50
56500 -- (-589.860) (-593.230) [-588.374] (-588.493) * [-590.607] (-588.285) (-593.644) (-587.964) -- 0:00:50
57000 -- (-587.656) (-593.228) (-587.678) [-589.703] * (-589.330) (-588.877) [-589.211] (-590.296) -- 0:00:49
57500 -- (-591.594) (-591.632) [-589.045] (-592.108) * [-589.658] (-587.757) (-589.617) (-593.291) -- 0:00:49
58000 -- (-590.237) [-588.941] (-589.246) (-587.529) * (-588.911) (-587.757) (-588.301) [-590.158] -- 0:00:48
58500 -- (-589.220) (-589.584) [-589.108] (-589.367) * (-592.467) (-588.463) (-590.490) [-589.485] -- 0:00:48
59000 -- (-588.757) (-590.717) (-594.486) [-592.326] * (-588.920) (-590.450) [-592.803] (-588.300) -- 0:01:03
59500 -- (-589.186) (-590.637) [-590.055] (-589.724) * [-590.324] (-593.629) (-593.504) (-593.318) -- 0:01:03
60000 -- (-589.705) (-589.577) (-590.010) [-588.347] * (-592.549) (-592.048) (-589.101) [-594.699] -- 0:01:02
Average standard deviation of split frequencies: 0.022534
60500 -- (-591.470) (-590.867) (-588.630) [-588.156] * [-590.450] (-592.167) (-589.182) (-592.717) -- 0:01:02
61000 -- (-599.448) (-592.107) (-590.575) [-589.819] * (-588.858) [-595.901] (-588.199) (-589.155) -- 0:01:01
61500 -- (-589.166) (-590.449) (-590.844) [-591.457] * (-594.509) (-591.511) [-587.863] (-590.396) -- 0:01:01
62000 -- (-593.688) (-590.494) [-587.763] (-591.848) * (-591.473) (-594.067) (-592.168) [-590.800] -- 0:01:00
62500 -- (-588.863) (-588.663) (-589.285) [-588.428] * (-590.541) (-589.687) [-591.605] (-588.938) -- 0:01:00
63000 -- (-591.341) (-588.871) (-589.368) [-588.825] * (-592.978) (-589.405) [-588.911] (-589.277) -- 0:00:59
63500 -- [-587.807] (-588.044) (-587.836) (-587.722) * (-588.059) (-587.733) (-590.014) [-589.558] -- 0:00:58
64000 -- (-589.782) (-589.649) [-590.271] (-589.026) * (-589.322) (-590.112) (-592.175) [-588.002] -- 0:00:58
64500 -- (-592.784) (-589.461) (-590.379) [-588.571] * [-589.348] (-591.972) (-593.056) (-589.057) -- 0:00:58
65000 -- (-589.712) (-590.689) (-590.457) [-589.417] * (-590.140) (-592.968) [-589.316] (-589.957) -- 0:00:57
Average standard deviation of split frequencies: 0.021803
65500 -- [-589.518] (-596.893) (-592.682) (-590.525) * [-588.949] (-594.941) (-591.255) (-590.305) -- 0:00:57
66000 -- (-588.286) [-592.061] (-591.431) (-589.667) * (-589.010) (-591.142) (-588.063) [-590.869] -- 0:00:56
66500 -- [-592.802] (-592.204) (-588.459) (-588.533) * (-590.094) (-590.338) [-587.754] (-588.822) -- 0:00:56
67000 -- (-593.309) [-589.137] (-591.265) (-589.942) * (-588.252) (-591.511) [-588.059] (-591.366) -- 0:00:55
67500 -- [-590.700] (-590.032) (-590.562) (-590.530) * (-588.491) (-592.757) [-591.937] (-589.080) -- 0:00:55
68000 -- (-588.387) (-592.433) (-591.374) [-589.063] * [-590.407] (-593.322) (-592.528) (-592.017) -- 0:00:54
68500 -- (-588.987) [-593.018] (-592.950) (-587.764) * (-588.396) (-591.099) (-588.806) [-589.638] -- 0:00:54
69000 -- [-594.354] (-589.440) (-588.306) (-589.004) * (-588.461) (-590.159) (-588.232) [-589.178] -- 0:00:53
69500 -- (-590.598) (-590.787) [-588.930] (-590.847) * (-588.050) [-588.544] (-589.565) (-588.298) -- 0:00:53
70000 -- (-589.019) (-591.864) [-588.121] (-588.711) * (-588.806) (-588.711) (-589.965) [-588.487] -- 0:00:53
Average standard deviation of split frequencies: 0.022014
70500 -- [-589.586] (-589.560) (-591.952) (-588.838) * (-588.445) (-588.446) (-588.385) [-587.973] -- 0:00:52
71000 -- (-590.103) (-592.412) (-592.075) [-591.075] * (-592.979) [-590.498] (-588.201) (-590.786) -- 0:00:52
71500 -- (-587.784) (-589.874) (-591.624) [-589.006] * (-588.556) (-591.192) (-590.677) [-591.202] -- 0:00:51
72000 -- (-589.427) (-589.675) [-591.262] (-589.628) * (-588.262) [-589.733] (-587.932) (-592.661) -- 0:00:51
72500 -- [-593.326] (-592.056) (-588.933) (-588.433) * (-590.537) (-590.862) [-590.868] (-593.698) -- 0:00:51
73000 -- [-590.314] (-589.399) (-589.194) (-587.909) * [-590.768] (-589.874) (-588.292) (-601.193) -- 0:00:50
73500 -- (-589.396) (-588.229) [-592.445] (-591.035) * (-592.131) [-589.917] (-588.955) (-588.447) -- 0:00:50
74000 -- (-589.202) (-589.968) (-595.467) [-587.355] * (-593.941) (-588.720) [-589.298] (-589.860) -- 0:00:50
74500 -- [-590.098] (-588.235) (-589.943) (-587.672) * (-590.726) (-589.591) (-589.767) [-588.323] -- 0:00:49
75000 -- (-593.458) (-588.635) (-588.448) [-589.327] * (-590.077) (-587.567) (-591.890) [-590.474] -- 0:00:49
Average standard deviation of split frequencies: 0.021857
75500 -- (-592.477) (-589.110) (-588.776) [-590.131] * [-592.244] (-589.046) (-591.671) (-589.229) -- 0:01:01
76000 -- [-588.872] (-591.582) (-591.260) (-588.809) * [-588.509] (-591.514) (-589.020) (-590.374) -- 0:01:00
76500 -- (-589.115) (-591.385) (-590.898) [-589.778] * [-588.594] (-591.069) (-588.602) (-590.367) -- 0:01:00
77000 -- [-587.464] (-588.203) (-592.110) (-588.612) * (-589.736) (-588.995) [-588.651] (-590.750) -- 0:00:59
77500 -- (-589.498) (-589.533) [-590.348] (-593.097) * [-588.611] (-588.441) (-590.737) (-588.047) -- 0:00:59
78000 -- [-588.505] (-588.392) (-592.834) (-590.460) * (-590.802) [-589.444] (-588.923) (-589.843) -- 0:00:59
78500 -- (-594.953) (-588.334) [-591.249] (-590.832) * (-588.257) [-588.862] (-588.948) (-589.436) -- 0:00:58
79000 -- (-593.718) (-588.063) [-590.018] (-595.186) * (-587.890) (-589.045) [-588.430] (-588.459) -- 0:00:58
79500 -- (-591.286) (-591.034) [-590.828] (-590.340) * (-589.631) (-587.742) (-591.086) [-588.226] -- 0:00:57
80000 -- [-589.672] (-587.923) (-590.661) (-589.727) * (-590.391) (-590.972) (-590.397) [-589.807] -- 0:00:57
Average standard deviation of split frequencies: 0.025323
80500 -- (-589.332) [-587.930] (-588.443) (-591.469) * [-593.576] (-591.360) (-592.417) (-587.925) -- 0:00:57
81000 -- (-589.512) [-587.906] (-587.718) (-592.559) * (-590.173) (-590.355) (-593.358) [-587.916] -- 0:00:56
81500 -- (-589.386) (-591.567) (-588.614) [-588.199] * (-592.097) [-587.542] (-590.157) (-588.422) -- 0:00:56
82000 -- (-588.800) (-588.470) (-588.545) [-590.184] * (-590.069) (-590.058) (-587.847) [-589.854] -- 0:00:55
82500 -- (-588.410) (-592.541) [-587.711] (-590.575) * [-590.096] (-588.301) (-587.372) (-589.202) -- 0:00:55
83000 -- (-588.460) (-591.416) (-587.870) [-588.859] * [-588.621] (-588.772) (-587.977) (-590.145) -- 0:00:55
83500 -- (-589.533) (-587.524) (-587.970) [-590.897] * (-587.294) (-595.890) [-589.421] (-588.559) -- 0:00:54
84000 -- (-588.581) [-589.323] (-591.429) (-589.826) * (-588.887) (-595.348) (-589.252) [-588.285] -- 0:00:54
84500 -- [-588.602] (-590.097) (-588.526) (-588.963) * (-589.397) (-590.962) (-589.851) [-587.692] -- 0:00:54
85000 -- (-592.194) (-590.132) (-589.037) [-590.409] * (-590.433) (-588.431) (-594.552) [-588.144] -- 0:00:53
Average standard deviation of split frequencies: 0.022474
85500 -- (-597.499) (-589.501) (-589.533) [-591.645] * (-590.727) [-591.207] (-591.014) (-590.895) -- 0:00:53
86000 -- [-590.398] (-590.181) (-591.952) (-594.816) * [-589.236] (-588.109) (-591.482) (-589.720) -- 0:00:53
86500 -- (-590.931) (-591.961) [-588.133] (-589.733) * (-589.262) (-588.128) [-587.537] (-593.367) -- 0:00:52
87000 -- [-588.181] (-591.695) (-588.465) (-588.821) * (-590.003) (-590.330) (-587.383) [-589.020] -- 0:00:52
87500 -- [-587.940] (-590.510) (-588.781) (-588.528) * (-589.363) [-590.025] (-589.641) (-589.414) -- 0:00:52
88000 -- (-590.971) (-595.332) [-588.834] (-589.794) * (-591.365) [-589.095] (-592.084) (-589.671) -- 0:00:51
88500 -- (-589.154) (-593.365) (-589.073) [-589.442] * (-589.246) (-587.931) [-587.834] (-588.455) -- 0:00:51
89000 -- (-590.152) (-589.890) (-588.744) [-591.660] * (-589.903) [-589.234] (-590.365) (-587.843) -- 0:00:51
89500 -- (-590.943) (-592.312) [-589.823] (-588.415) * (-591.278) [-589.322] (-590.178) (-588.158) -- 0:00:50
90000 -- (-591.808) (-592.401) [-590.536] (-587.872) * (-589.778) (-590.093) [-589.700] (-590.346) -- 0:00:50
Average standard deviation of split frequencies: 0.019353
90500 -- (-589.062) (-591.863) (-588.669) [-588.557] * [-589.399] (-590.058) (-592.405) (-594.258) -- 0:00:50
91000 -- [-587.549] (-593.460) (-591.744) (-589.931) * (-588.814) [-590.584] (-589.170) (-589.661) -- 0:00:49
91500 -- (-589.469) (-592.426) [-588.095] (-589.737) * (-588.929) (-589.679) (-590.007) [-590.870] -- 0:00:49
92000 -- (-588.946) (-588.388) (-589.432) [-589.183] * (-590.495) [-589.840] (-590.269) (-590.069) -- 0:00:49
92500 -- [-591.654] (-590.783) (-588.813) (-588.707) * [-587.404] (-589.280) (-591.770) (-588.594) -- 0:00:58
93000 -- (-589.595) (-588.623) [-588.115] (-590.891) * (-587.998) (-589.031) [-588.135] (-588.911) -- 0:00:58
93500 -- (-593.719) (-589.003) [-589.519] (-588.485) * (-589.351) (-595.011) (-588.437) [-587.867] -- 0:00:58
94000 -- (-591.550) (-589.044) [-591.495] (-591.022) * [-592.015] (-592.372) (-591.831) (-588.040) -- 0:00:57
94500 -- (-590.414) (-589.675) [-591.308] (-587.728) * (-591.118) (-589.192) (-593.622) [-587.635] -- 0:00:57
95000 -- [-588.742] (-593.650) (-591.108) (-588.708) * (-588.632) (-588.781) [-591.777] (-591.505) -- 0:00:57
Average standard deviation of split frequencies: 0.020460
95500 -- (-589.109) [-590.478] (-590.922) (-588.778) * [-587.750] (-588.677) (-590.506) (-588.439) -- 0:00:56
96000 -- [-589.906] (-590.896) (-588.043) (-588.456) * (-590.074) (-589.770) (-594.933) [-588.222] -- 0:00:56
96500 -- (-593.344) (-592.207) [-590.711] (-590.334) * [-590.414] (-591.806) (-591.227) (-590.211) -- 0:00:56
97000 -- (-591.119) [-593.013] (-588.709) (-591.115) * [-591.129] (-588.841) (-589.833) (-590.994) -- 0:00:55
97500 -- (-589.299) [-590.732] (-588.764) (-587.759) * [-589.335] (-589.864) (-591.991) (-594.140) -- 0:00:55
98000 -- [-588.744] (-590.929) (-588.295) (-590.731) * (-592.710) (-589.350) (-590.191) [-593.063] -- 0:00:55
98500 -- (-588.944) (-588.924) (-589.379) [-589.902] * (-588.582) (-593.172) (-589.217) [-587.395] -- 0:00:54
99000 -- [-592.049] (-597.143) (-590.702) (-590.139) * [-588.326] (-589.408) (-590.526) (-587.957) -- 0:00:54
99500 -- [-592.442] (-591.467) (-587.451) (-591.293) * (-589.743) (-592.615) (-589.612) [-588.162] -- 0:00:54
100000 -- (-588.965) (-593.342) (-587.298) [-588.582] * (-588.476) (-587.569) [-588.696] (-588.223) -- 0:00:54
Average standard deviation of split frequencies: 0.019512
100500 -- [-590.708] (-593.951) (-587.724) (-588.601) * (-589.698) (-588.631) [-591.247] (-591.006) -- 0:00:53
101000 -- (-587.664) (-589.295) [-590.859] (-588.714) * (-587.946) (-591.750) [-589.017] (-590.473) -- 0:00:53
101500 -- (-590.348) (-591.545) [-590.931] (-591.944) * (-588.754) (-589.568) [-588.918] (-588.745) -- 0:00:53
102000 -- (-589.850) (-594.018) (-592.651) [-595.941] * (-590.999) [-589.252] (-589.594) (-589.256) -- 0:00:52
102500 -- (-588.701) (-589.572) [-589.362] (-589.138) * (-588.915) (-587.747) [-591.712] (-587.777) -- 0:00:52
103000 -- (-588.628) (-590.742) (-589.451) [-590.449] * (-590.036) (-588.659) (-592.628) [-588.980] -- 0:00:52
103500 -- [-590.534] (-590.690) (-588.212) (-591.026) * (-593.199) (-589.380) (-592.231) [-590.680] -- 0:00:51
104000 -- [-588.462] (-588.554) (-590.991) (-588.204) * [-589.549] (-595.042) (-589.193) (-590.265) -- 0:00:51
104500 -- (-589.179) (-590.271) [-589.005] (-590.561) * (-588.538) (-587.795) (-587.732) [-590.691] -- 0:00:51
105000 -- [-588.124] (-588.823) (-590.602) (-590.768) * (-591.638) (-589.708) [-589.799] (-588.856) -- 0:00:51
Average standard deviation of split frequencies: 0.020507
105500 -- (-591.383) (-590.604) (-597.093) [-590.219] * (-590.328) (-590.400) (-591.417) [-588.725] -- 0:00:50
106000 -- (-593.590) (-587.898) (-597.104) [-588.212] * (-589.647) (-592.909) (-589.559) [-588.106] -- 0:00:50
106500 -- (-589.032) (-588.743) (-592.431) [-590.082] * (-588.526) (-590.390) (-589.261) [-587.229] -- 0:00:50
107000 -- [-591.364] (-588.935) (-589.302) (-592.594) * (-591.483) (-589.808) (-590.849) [-588.427] -- 0:00:50
107500 -- (-590.788) (-590.297) (-591.291) [-594.056] * [-590.562] (-589.857) (-590.819) (-590.000) -- 0:00:49
108000 -- (-589.900) (-590.064) [-588.760] (-590.323) * (-593.417) (-590.181) (-589.311) [-587.869] -- 0:00:49
108500 -- [-589.252] (-588.833) (-587.291) (-589.475) * (-593.235) (-592.399) (-592.932) [-588.461] -- 0:00:49
109000 -- (-590.282) (-588.053) (-588.791) [-589.610] * (-589.589) [-588.879] (-591.996) (-589.115) -- 0:00:57
109500 -- (-590.293) (-589.205) (-587.954) [-591.013] * [-590.789] (-588.228) (-595.421) (-588.498) -- 0:00:56
110000 -- (-590.280) (-589.203) [-588.276] (-590.532) * [-588.020] (-589.072) (-591.502) (-592.084) -- 0:00:56
Average standard deviation of split frequencies: 0.018459
110500 -- (-594.226) (-593.144) [-588.999] (-588.153) * [-588.832] (-589.479) (-589.373) (-590.890) -- 0:00:56
111000 -- (-588.550) [-590.986] (-587.753) (-588.991) * (-589.585) [-594.051] (-591.650) (-590.166) -- 0:00:56
111500 -- [-592.030] (-590.107) (-588.723) (-588.855) * (-588.581) (-589.446) (-589.534) [-588.225] -- 0:00:55
112000 -- [-589.075] (-589.485) (-593.458) (-589.297) * (-589.140) [-591.480] (-588.402) (-588.561) -- 0:00:55
112500 -- (-590.448) (-589.693) [-588.405] (-592.530) * (-593.908) (-591.541) (-588.753) [-587.887] -- 0:00:55
113000 -- (-590.962) (-590.849) (-588.348) [-588.833] * (-589.089) [-591.830] (-588.790) (-592.514) -- 0:00:54
113500 -- (-590.887) (-593.843) (-589.278) [-587.449] * (-588.446) (-589.778) (-591.439) [-592.128] -- 0:00:54
114000 -- (-590.649) (-591.144) [-588.145] (-587.819) * [-588.466] (-589.456) (-591.067) (-589.863) -- 0:00:54
114500 -- (-592.973) (-588.875) [-589.994] (-592.485) * [-592.743] (-593.422) (-590.084) (-589.535) -- 0:00:54
115000 -- [-587.817] (-591.050) (-589.052) (-589.724) * (-588.618) (-594.752) (-587.929) [-589.106] -- 0:00:53
Average standard deviation of split frequencies: 0.017158
115500 -- [-589.725] (-591.382) (-589.668) (-588.372) * (-588.705) (-588.538) (-590.795) [-591.005] -- 0:00:53
116000 -- [-588.603] (-590.451) (-593.983) (-588.090) * [-589.870] (-589.258) (-588.286) (-592.912) -- 0:00:53
116500 -- (-588.652) [-593.296] (-588.881) (-588.316) * (-588.263) [-588.655] (-590.364) (-590.842) -- 0:00:53
117000 -- [-589.783] (-588.533) (-587.634) (-588.283) * (-588.416) [-589.732] (-591.264) (-588.519) -- 0:00:52
117500 -- [-588.767] (-587.586) (-587.472) (-587.907) * (-588.091) (-592.699) (-589.769) [-589.314] -- 0:00:52
118000 -- [-589.538] (-590.797) (-590.159) (-588.227) * (-589.482) (-590.508) (-589.027) [-588.102] -- 0:00:52
118500 -- (-587.977) (-592.712) (-591.391) [-588.747] * (-589.926) (-590.219) (-592.834) [-589.210] -- 0:00:52
119000 -- (-588.234) (-588.862) [-589.457] (-590.492) * [-588.161] (-588.234) (-589.818) (-589.445) -- 0:00:51
119500 -- [-588.462] (-592.718) (-588.998) (-595.466) * (-587.554) [-588.319] (-589.373) (-587.299) -- 0:00:51
120000 -- (-588.839) (-587.942) (-588.789) [-592.049] * (-587.443) [-589.852] (-593.125) (-590.888) -- 0:00:51
Average standard deviation of split frequencies: 0.019074
120500 -- (-590.309) [-588.335] (-588.351) (-591.267) * (-588.172) (-590.504) (-591.429) [-587.537] -- 0:00:51
121000 -- (-594.714) (-588.576) (-588.890) [-589.060] * (-588.737) [-590.424] (-589.997) (-588.311) -- 0:00:50
121500 -- [-587.552] (-590.748) (-591.737) (-588.683) * [-589.497] (-588.154) (-589.245) (-589.533) -- 0:00:50
122000 -- (-589.639) (-589.584) [-589.129] (-590.216) * (-590.026) (-588.832) (-588.837) [-588.839] -- 0:00:50
122500 -- (-595.517) [-588.121] (-592.308) (-589.454) * (-588.661) [-591.087] (-589.963) (-589.604) -- 0:00:50
123000 -- (-593.026) [-589.646] (-589.505) (-589.373) * (-590.770) (-589.623) (-588.487) [-591.880] -- 0:00:49
123500 -- [-591.467] (-588.500) (-588.433) (-589.274) * (-589.274) (-589.086) [-588.807] (-589.814) -- 0:00:49
124000 -- (-594.601) (-591.400) [-588.344] (-588.809) * (-591.192) (-590.816) (-588.358) [-588.008] -- 0:00:49
124500 -- (-588.440) [-588.992] (-588.511) (-589.881) * (-591.691) (-589.788) (-587.926) [-587.773] -- 0:00:49
125000 -- (-592.315) [-590.198] (-589.473) (-587.728) * [-590.584] (-589.721) (-589.044) (-588.664) -- 0:00:49
Average standard deviation of split frequencies: 0.016628
125500 -- (-588.341) (-589.605) (-595.954) [-587.865] * [-588.817] (-588.530) (-591.621) (-590.641) -- 0:00:55
126000 -- [-588.139] (-588.614) (-596.358) (-589.232) * (-588.671) [-588.919] (-588.781) (-588.708) -- 0:00:55
126500 -- (-587.950) (-588.654) (-594.929) [-590.117] * (-589.331) (-588.608) (-589.778) [-587.596] -- 0:00:55
127000 -- (-589.575) (-588.704) [-593.555] (-589.347) * [-588.698] (-588.513) (-593.849) (-587.735) -- 0:00:54
127500 -- (-588.225) (-589.134) [-589.931] (-589.227) * (-588.982) (-590.022) (-592.159) [-587.658] -- 0:00:54
128000 -- (-590.243) [-588.277] (-589.570) (-592.368) * (-591.593) (-590.400) [-587.691] (-589.448) -- 0:00:54
128500 -- [-592.366] (-588.899) (-590.403) (-589.564) * [-591.199] (-587.351) (-590.162) (-590.361) -- 0:00:54
129000 -- (-589.484) (-588.665) (-590.793) [-589.872] * [-589.146] (-590.297) (-597.076) (-589.051) -- 0:00:54
129500 -- [-588.105] (-588.922) (-589.755) (-589.519) * [-593.348] (-590.824) (-589.646) (-591.958) -- 0:00:53
130000 -- (-588.268) (-591.504) (-588.760) [-589.224] * (-591.081) (-588.176) [-588.636] (-591.515) -- 0:00:53
Average standard deviation of split frequencies: 0.014431
130500 -- (-590.481) (-590.545) [-587.463] (-587.745) * [-589.331] (-588.742) (-589.235) (-590.017) -- 0:00:53
131000 -- (-590.443) [-591.721] (-588.042) (-592.300) * (-587.777) [-588.920] (-590.477) (-594.069) -- 0:00:53
131500 -- (-592.374) (-592.811) (-589.142) [-593.111] * [-589.425] (-587.867) (-590.837) (-593.629) -- 0:00:52
132000 -- (-591.763) (-595.781) (-589.858) [-589.468] * [-588.541] (-588.118) (-588.311) (-591.627) -- 0:00:52
132500 -- (-590.625) [-591.657] (-589.978) (-588.127) * (-590.064) (-587.868) (-588.643) [-591.049] -- 0:00:52
133000 -- (-593.147) (-588.516) (-589.796) [-587.772] * (-591.898) [-590.684] (-589.367) (-590.339) -- 0:00:52
133500 -- (-592.564) (-594.725) [-590.882] (-590.234) * (-591.577) (-592.603) (-589.964) [-589.582] -- 0:00:51
134000 -- (-589.941) (-593.378) (-590.822) [-589.795] * (-589.391) (-590.563) [-590.121] (-591.535) -- 0:00:51
134500 -- (-589.475) (-589.342) (-589.811) [-588.055] * (-588.415) (-588.666) (-595.866) [-590.992] -- 0:00:51
135000 -- [-590.233] (-589.979) (-589.109) (-589.032) * (-589.539) (-588.162) [-589.636] (-592.695) -- 0:00:51
Average standard deviation of split frequencies: 0.011939
135500 -- (-588.982) [-587.451] (-594.293) (-588.132) * (-589.452) (-588.353) [-589.146] (-590.230) -- 0:00:51
136000 -- (-589.972) [-589.870] (-592.517) (-590.868) * (-587.596) (-587.938) [-588.821] (-587.659) -- 0:00:50
136500 -- [-587.683] (-594.402) (-590.997) (-591.680) * (-590.435) (-588.306) [-587.527] (-593.524) -- 0:00:50
137000 -- (-589.368) (-588.529) [-590.007] (-593.231) * [-588.399] (-588.051) (-587.898) (-591.144) -- 0:00:50
137500 -- (-593.878) (-589.931) (-588.121) [-590.714] * (-587.336) (-588.429) (-587.752) [-593.720] -- 0:00:50
138000 -- (-589.805) (-588.487) (-587.899) [-589.625] * [-590.307] (-590.366) (-589.264) (-591.637) -- 0:00:49
138500 -- (-589.246) (-588.938) (-590.639) [-588.671] * [-589.345] (-589.672) (-591.848) (-590.117) -- 0:00:49
139000 -- (-589.846) (-589.848) [-589.203] (-591.056) * (-587.414) (-590.646) (-589.883) [-593.008] -- 0:00:49
139500 -- (-590.655) [-589.337] (-589.583) (-590.435) * (-588.894) [-591.338] (-589.575) (-589.811) -- 0:00:49
140000 -- (-589.934) (-588.970) (-591.084) [-588.888] * (-588.551) (-593.118) (-588.342) [-587.585] -- 0:00:49
Average standard deviation of split frequencies: 0.012846
140500 -- [-590.283] (-589.198) (-590.355) (-590.279) * (-588.310) (-592.341) [-590.325] (-590.576) -- 0:00:48
141000 -- (-591.041) [-588.003] (-591.984) (-590.711) * (-590.703) [-588.433] (-589.299) (-588.152) -- 0:00:48
141500 -- [-587.814] (-590.763) (-588.344) (-588.892) * (-589.737) [-587.667] (-589.170) (-588.315) -- 0:00:48
142000 -- (-589.660) (-589.310) (-588.590) [-587.934] * (-587.396) (-589.116) (-592.742) [-590.267] -- 0:00:48
142500 -- (-589.888) (-590.903) [-589.028] (-591.228) * [-587.305] (-589.368) (-591.444) (-589.605) -- 0:00:54
143000 -- (-588.758) (-589.841) (-589.865) [-588.386] * (-590.244) [-589.952] (-590.756) (-591.182) -- 0:00:53
143500 -- (-588.425) [-588.164] (-591.466) (-594.280) * (-591.252) [-587.927] (-590.370) (-587.773) -- 0:00:53
144000 -- [-590.178] (-591.401) (-590.141) (-593.826) * (-593.044) (-590.414) (-592.169) [-588.237] -- 0:00:53
144500 -- (-590.082) (-594.312) (-595.701) [-588.672] * (-588.756) (-592.411) [-587.713] (-596.375) -- 0:00:53
145000 -- [-589.718] (-590.960) (-593.097) (-588.035) * (-588.054) [-588.736] (-587.992) (-590.566) -- 0:00:53
Average standard deviation of split frequencies: 0.013295
145500 -- (-587.699) [-591.490] (-592.457) (-587.667) * (-590.635) (-589.528) [-590.175] (-592.140) -- 0:00:52
146000 -- [-592.961] (-588.430) (-590.225) (-587.856) * (-589.567) (-588.556) (-590.998) [-588.813] -- 0:00:52
146500 -- (-590.733) (-592.650) (-590.353) [-589.068] * (-590.947) (-590.024) (-591.957) [-588.696] -- 0:00:52
147000 -- [-590.061] (-590.473) (-588.831) (-589.382) * (-589.654) [-588.520] (-592.458) (-588.954) -- 0:00:52
147500 -- [-589.442] (-589.704) (-590.830) (-590.641) * (-588.408) (-587.625) (-588.369) [-589.034] -- 0:00:52
148000 -- (-591.441) (-591.008) [-594.571] (-588.451) * (-589.064) (-591.735) (-590.334) [-590.081] -- 0:00:51
148500 -- [-590.642] (-597.173) (-588.521) (-587.861) * (-591.047) [-591.665] (-590.443) (-588.592) -- 0:00:51
149000 -- (-590.074) (-589.889) (-588.735) [-589.759] * (-588.355) (-594.362) [-588.582] (-588.336) -- 0:00:51
149500 -- (-588.786) [-594.324] (-590.007) (-588.992) * [-591.324] (-597.143) (-588.885) (-593.336) -- 0:00:51
150000 -- [-588.826] (-589.442) (-591.660) (-589.628) * [-589.848] (-596.196) (-589.560) (-589.208) -- 0:00:51
Average standard deviation of split frequencies: 0.014471
150500 -- (-588.148) (-589.951) (-591.481) [-592.197] * [-589.287] (-589.676) (-590.347) (-594.173) -- 0:00:50
151000 -- (-588.171) [-588.808] (-590.876) (-590.749) * (-587.395) (-589.217) (-588.409) [-590.336] -- 0:00:50
151500 -- [-590.094] (-591.541) (-590.509) (-589.259) * (-588.301) (-589.222) (-588.790) [-590.177] -- 0:00:50
152000 -- (-588.270) (-594.660) [-593.739] (-587.975) * (-592.461) [-590.000] (-594.561) (-589.670) -- 0:00:50
152500 -- (-588.726) [-595.178] (-591.006) (-591.924) * (-589.380) (-588.781) (-589.234) [-592.454] -- 0:00:50
153000 -- (-592.191) (-589.788) [-588.955] (-594.109) * [-592.573] (-589.187) (-587.797) (-592.730) -- 0:00:49
153500 -- [-592.371] (-588.784) (-588.355) (-592.016) * (-587.737) [-587.757] (-587.463) (-588.771) -- 0:00:49
154000 -- (-590.528) [-591.695] (-590.794) (-592.096) * (-588.549) (-587.849) [-590.433] (-588.225) -- 0:00:49
154500 -- (-592.044) [-590.905] (-588.525) (-589.192) * (-589.703) (-587.615) [-588.682] (-588.740) -- 0:00:49
155000 -- (-591.915) (-588.918) [-588.404] (-588.061) * [-588.849] (-588.799) (-588.707) (-588.644) -- 0:00:49
Average standard deviation of split frequencies: 0.014706
155500 -- [-590.642] (-596.388) (-589.541) (-591.043) * (-592.358) [-589.946] (-589.473) (-590.833) -- 0:00:48
156000 -- [-588.447] (-589.727) (-590.646) (-591.567) * [-589.414] (-591.473) (-592.053) (-589.515) -- 0:00:48
156500 -- (-590.087) (-593.600) (-590.971) [-589.066] * [-588.257] (-588.460) (-589.361) (-589.886) -- 0:00:48
157000 -- (-591.162) (-593.407) (-594.577) [-590.888] * (-587.801) [-589.108] (-589.523) (-589.973) -- 0:00:48
157500 -- (-588.302) [-588.849] (-588.403) (-593.697) * (-589.212) [-591.303] (-590.520) (-593.320) -- 0:00:48
158000 -- (-592.022) [-591.989] (-590.439) (-588.993) * [-590.914] (-587.807) (-588.879) (-589.132) -- 0:00:47
158500 -- (-588.852) (-589.262) [-589.530] (-591.566) * (-589.024) (-589.640) [-590.145] (-587.180) -- 0:00:47
159000 -- (-593.557) [-593.342] (-591.642) (-589.833) * [-590.499] (-588.814) (-589.120) (-587.197) -- 0:00:52
159500 -- [-589.173] (-588.470) (-595.458) (-590.733) * [-589.727] (-589.690) (-589.780) (-588.408) -- 0:00:52
160000 -- (-592.411) (-589.931) (-589.646) [-588.224] * (-590.274) [-588.591] (-587.880) (-589.093) -- 0:00:52
Average standard deviation of split frequencies: 0.015648
160500 -- [-591.502] (-587.802) (-588.363) (-588.145) * (-591.458) (-588.977) [-589.347] (-589.147) -- 0:00:52
161000 -- [-588.325] (-589.411) (-591.411) (-589.941) * (-590.345) (-589.833) [-589.284] (-589.285) -- 0:00:52
161500 -- (-590.586) (-589.341) [-589.041] (-589.480) * (-591.174) [-598.063] (-588.970) (-590.036) -- 0:00:51
162000 -- (-592.737) [-589.570] (-589.432) (-594.190) * (-592.397) [-589.768] (-590.685) (-588.016) -- 0:00:51
162500 -- (-595.012) (-589.863) [-589.839] (-593.662) * (-588.747) (-588.718) [-589.573] (-590.605) -- 0:00:51
163000 -- (-589.907) [-590.573] (-592.506) (-591.435) * [-587.876] (-588.314) (-589.222) (-590.402) -- 0:00:51
163500 -- (-589.038) [-590.815] (-592.014) (-590.725) * [-593.395] (-589.278) (-590.736) (-589.343) -- 0:00:51
164000 -- [-590.186] (-591.596) (-589.293) (-588.617) * (-589.745) (-587.809) (-588.555) [-587.801] -- 0:00:50
164500 -- (-589.971) (-588.692) (-589.293) [-588.664] * (-589.845) (-587.746) [-588.603] (-590.293) -- 0:00:50
165000 -- [-590.150] (-589.763) (-589.034) (-592.023) * (-593.505) (-588.280) [-588.834] (-588.985) -- 0:00:50
Average standard deviation of split frequencies: 0.013197
165500 -- (-588.451) (-590.967) [-592.792] (-591.000) * (-591.490) (-588.267) [-587.586] (-593.270) -- 0:00:50
166000 -- (-588.116) [-589.243] (-591.943) (-588.372) * [-590.136] (-589.770) (-587.993) (-589.333) -- 0:00:50
166500 -- (-589.160) (-590.245) [-591.730] (-588.489) * (-591.810) [-589.214] (-588.656) (-589.094) -- 0:00:50
167000 -- (-590.572) [-587.695] (-591.061) (-589.025) * (-590.765) (-588.039) (-588.432) [-593.516] -- 0:00:49
167500 -- [-589.293] (-589.395) (-587.842) (-590.528) * [-592.483] (-588.277) (-589.538) (-588.191) -- 0:00:49
168000 -- (-590.351) (-587.453) [-593.018] (-593.890) * (-588.965) (-588.543) [-592.955] (-590.471) -- 0:00:49
168500 -- (-588.031) [-589.677] (-591.564) (-600.517) * [-589.214] (-589.826) (-591.469) (-591.219) -- 0:00:49
169000 -- [-588.092] (-590.851) (-593.002) (-587.821) * [-590.786] (-592.438) (-587.710) (-595.593) -- 0:00:49
169500 -- (-592.091) (-589.388) [-589.420] (-590.524) * (-592.057) (-590.772) (-589.466) [-590.285] -- 0:00:48
170000 -- (-588.968) (-589.438) [-589.883] (-590.098) * [-590.746] (-592.010) (-588.352) (-594.902) -- 0:00:48
Average standard deviation of split frequencies: 0.015019
170500 -- (-591.401) [-591.212] (-590.452) (-590.287) * [-588.458] (-589.175) (-590.102) (-591.273) -- 0:00:48
171000 -- (-588.964) (-591.268) [-589.844] (-588.154) * (-588.073) [-588.097] (-589.195) (-589.069) -- 0:00:48
171500 -- (-587.933) (-588.420) [-591.570] (-590.866) * (-588.220) (-593.951) (-591.703) [-590.369] -- 0:00:48
172000 -- (-592.085) (-588.808) (-591.071) [-589.296] * (-589.546) (-590.366) [-596.083] (-590.896) -- 0:00:48
172500 -- (-595.203) (-588.659) (-591.193) [-588.554] * (-587.916) (-589.850) [-591.615] (-588.144) -- 0:00:47
173000 -- [-588.063] (-589.175) (-590.216) (-588.664) * [-587.885] (-590.303) (-589.858) (-591.116) -- 0:00:47
173500 -- (-588.531) (-588.932) (-589.533) [-590.931] * (-588.764) [-590.507] (-590.725) (-588.957) -- 0:00:47
174000 -- (-593.690) (-590.246) [-588.382] (-590.771) * (-591.966) (-588.184) [-592.456] (-589.486) -- 0:00:47
174500 -- (-590.209) [-588.517] (-590.172) (-587.815) * (-588.978) (-588.667) (-593.813) [-591.278] -- 0:00:47
175000 -- (-588.946) (-589.474) [-588.220] (-589.745) * (-589.604) [-589.254] (-595.574) (-589.431) -- 0:00:47
Average standard deviation of split frequencies: 0.015713
175500 -- (-591.450) [-589.371] (-591.316) (-590.279) * [-591.278] (-589.653) (-589.451) (-591.382) -- 0:00:51
176000 -- (-590.803) (-588.552) [-590.044] (-591.932) * (-592.175) (-592.436) [-591.531] (-590.691) -- 0:00:51
176500 -- (-594.455) [-589.130] (-593.842) (-591.715) * [-590.489] (-592.901) (-591.189) (-590.477) -- 0:00:51
177000 -- (-589.299) (-588.443) [-591.191] (-589.144) * [-587.608] (-592.747) (-593.169) (-592.053) -- 0:00:51
177500 -- [-588.880] (-591.525) (-588.163) (-588.175) * [-589.880] (-588.143) (-589.292) (-590.405) -- 0:00:50
178000 -- (-588.990) (-589.593) [-589.815] (-590.405) * (-591.456) [-589.709] (-587.958) (-587.961) -- 0:00:50
178500 -- (-591.714) [-592.650] (-589.270) (-588.843) * (-589.236) (-590.607) (-589.432) [-591.506] -- 0:00:50
179000 -- (-589.271) [-588.865] (-589.533) (-591.631) * (-591.689) [-588.944] (-589.215) (-588.038) -- 0:00:50
179500 -- (-589.291) [-589.177] (-589.960) (-592.935) * [-592.710] (-590.257) (-589.705) (-589.158) -- 0:00:50
180000 -- (-590.032) (-589.597) [-588.381] (-588.267) * (-590.678) (-588.702) (-589.883) [-591.356] -- 0:00:50
Average standard deviation of split frequencies: 0.015482
180500 -- (-589.715) (-589.841) [-588.684] (-589.659) * (-589.082) [-589.358] (-590.571) (-588.751) -- 0:00:49
181000 -- (-588.597) [-588.678] (-588.215) (-591.010) * [-590.125] (-587.847) (-588.770) (-589.025) -- 0:00:49
181500 -- (-587.954) (-587.988) (-587.497) [-588.636] * [-591.010] (-588.353) (-590.265) (-588.818) -- 0:00:49
182000 -- (-588.991) [-588.093] (-587.727) (-589.550) * [-589.484] (-590.128) (-591.590) (-590.349) -- 0:00:49
182500 -- (-590.743) [-589.116] (-590.269) (-590.588) * (-588.764) (-588.158) [-594.508] (-589.533) -- 0:00:49
183000 -- [-591.335] (-590.318) (-591.614) (-587.813) * (-591.013) (-594.485) [-588.012] (-590.276) -- 0:00:49
183500 -- (-592.725) (-592.711) (-588.092) [-589.503] * (-594.121) [-588.481] (-590.204) (-589.630) -- 0:00:48
184000 -- (-591.920) (-588.155) [-588.306] (-592.167) * (-589.702) [-589.783] (-588.589) (-591.256) -- 0:00:48
184500 -- [-591.687] (-589.743) (-589.848) (-593.292) * (-587.671) (-590.216) [-588.462] (-589.334) -- 0:00:48
185000 -- (-592.707) (-589.442) (-589.983) [-589.580] * (-587.983) [-590.895] (-589.564) (-589.374) -- 0:00:48
Average standard deviation of split frequencies: 0.015682
185500 -- (-590.549) [-590.026] (-589.166) (-590.406) * [-588.362] (-589.131) (-588.330) (-591.253) -- 0:00:48
186000 -- [-592.539] (-589.043) (-587.781) (-588.687) * (-588.546) (-587.880) [-590.174] (-590.398) -- 0:00:48
186500 -- [-590.663] (-590.179) (-588.287) (-587.697) * (-589.768) [-588.076] (-589.649) (-592.406) -- 0:00:47
187000 -- (-591.387) (-588.195) (-591.749) [-588.868] * (-593.186) (-592.675) [-588.762] (-593.220) -- 0:00:47
187500 -- (-589.956) [-589.509] (-591.008) (-587.860) * (-593.130) (-590.697) (-590.394) [-590.229] -- 0:00:47
188000 -- (-588.714) (-589.850) (-592.684) [-588.257] * [-594.353] (-588.437) (-587.833) (-590.462) -- 0:00:47
188500 -- (-588.474) (-589.385) [-588.317] (-590.275) * (-588.289) (-587.823) [-590.039] (-593.278) -- 0:00:47
189000 -- [-588.471] (-590.934) (-590.413) (-589.430) * [-589.211] (-588.677) (-589.430) (-589.477) -- 0:00:47
189500 -- (-588.608) (-592.665) (-589.024) [-591.707] * (-590.488) (-588.182) [-590.596] (-590.363) -- 0:00:47
190000 -- (-590.173) (-592.982) (-589.403) [-590.533] * (-588.225) (-587.623) [-590.737] (-588.980) -- 0:00:46
Average standard deviation of split frequencies: 0.014989
190500 -- [-592.784] (-589.599) (-592.968) (-590.132) * (-589.200) [-590.043] (-590.592) (-587.852) -- 0:00:46
191000 -- (-592.295) [-587.901] (-591.118) (-588.706) * [-588.038] (-589.820) (-587.827) (-588.476) -- 0:00:46
191500 -- (-590.841) (-588.291) [-591.982] (-590.501) * (-588.280) (-588.568) [-590.972] (-590.258) -- 0:00:46
192000 -- (-588.296) [-589.350] (-590.982) (-597.487) * (-591.206) (-592.686) (-590.024) [-589.666] -- 0:00:50
192500 -- (-588.747) (-590.560) (-592.852) [-590.203] * [-591.361] (-589.599) (-591.335) (-588.501) -- 0:00:50
193000 -- (-591.209) (-589.538) (-589.517) [-589.639] * [-588.189] (-591.007) (-594.067) (-589.012) -- 0:00:50
193500 -- (-594.267) (-588.981) (-589.398) [-588.000] * (-588.948) (-588.184) [-594.539] (-588.912) -- 0:00:50
194000 -- (-589.685) (-591.262) [-591.974] (-588.212) * (-588.319) (-588.377) (-588.156) [-593.962] -- 0:00:49
194500 -- (-589.720) [-596.312] (-595.275) (-588.612) * [-588.969] (-590.798) (-588.611) (-592.287) -- 0:00:49
195000 -- (-591.226) (-590.053) (-591.778) [-587.379] * (-596.238) (-590.023) [-588.543] (-595.730) -- 0:00:49
Average standard deviation of split frequencies: 0.013228
195500 -- (-591.975) (-589.795) (-588.475) [-589.163] * (-590.777) [-588.396] (-590.344) (-591.008) -- 0:00:49
196000 -- [-592.443] (-587.781) (-592.262) (-590.266) * (-589.329) [-587.968] (-588.981) (-591.135) -- 0:00:49
196500 -- (-590.215) (-588.674) (-592.777) [-590.606] * (-589.083) [-588.449] (-587.770) (-591.547) -- 0:00:49
197000 -- (-592.435) [-590.108] (-591.525) (-589.888) * (-590.408) (-589.548) [-588.382] (-592.001) -- 0:00:48
197500 -- [-590.545] (-588.766) (-592.207) (-587.970) * [-590.929] (-590.253) (-595.424) (-589.230) -- 0:00:48
198000 -- (-589.552) [-589.105] (-587.604) (-589.591) * (-587.897) [-588.360] (-590.460) (-588.745) -- 0:00:48
198500 -- (-590.499) [-591.635] (-592.162) (-588.054) * (-588.406) [-593.260] (-591.910) (-588.051) -- 0:00:48
199000 -- (-587.828) (-591.141) (-590.594) [-587.898] * (-588.062) (-588.809) (-591.681) [-588.809] -- 0:00:48
199500 -- (-590.135) [-592.951] (-589.442) (-589.406) * (-588.300) (-591.472) (-590.924) [-589.077] -- 0:00:48
200000 -- (-587.544) (-590.194) [-587.502] (-587.666) * (-588.994) (-592.033) [-588.665] (-587.962) -- 0:00:48
Average standard deviation of split frequencies: 0.013655
200500 -- (-587.929) (-589.831) [-590.014] (-588.271) * (-589.795) (-588.625) (-588.505) [-587.693] -- 0:00:47
201000 -- [-588.843] (-588.709) (-588.330) (-588.998) * (-597.418) (-590.905) (-590.507) [-588.487] -- 0:00:47
201500 -- (-591.859) (-589.334) [-588.984] (-594.359) * (-593.781) (-589.602) [-590.496] (-589.450) -- 0:00:47
202000 -- (-592.273) (-589.619) [-589.442] (-590.827) * (-588.795) [-591.324] (-589.536) (-588.482) -- 0:00:47
202500 -- (-591.922) (-588.266) (-588.096) [-590.181] * (-591.770) (-591.864) [-592.368] (-588.579) -- 0:00:47
203000 -- (-590.867) [-596.944] (-589.147) (-588.263) * (-589.013) [-590.142] (-592.357) (-588.795) -- 0:00:47
203500 -- (-589.280) [-592.775] (-589.628) (-589.440) * [-589.658] (-590.227) (-590.494) (-592.573) -- 0:00:46
204000 -- [-590.181] (-589.248) (-589.158) (-589.089) * (-591.809) (-589.032) (-588.536) [-589.989] -- 0:00:46
204500 -- (-589.128) [-589.090] (-591.803) (-589.809) * (-589.433) [-590.216] (-590.023) (-596.190) -- 0:00:46
205000 -- (-589.522) (-589.805) [-589.898] (-590.464) * (-591.438) [-591.326] (-593.818) (-592.864) -- 0:00:46
Average standard deviation of split frequencies: 0.014874
205500 -- (-588.800) (-591.784) (-590.651) [-588.931] * (-589.352) [-589.891] (-590.029) (-589.472) -- 0:00:46
206000 -- (-592.205) (-589.560) [-590.408] (-589.460) * (-592.441) (-590.600) (-589.170) [-589.921] -- 0:00:46
206500 -- [-593.462] (-589.631) (-589.168) (-590.553) * (-590.702) [-589.257] (-587.671) (-588.347) -- 0:00:46
207000 -- (-591.180) [-592.354] (-591.136) (-595.393) * (-592.676) (-588.242) (-590.293) [-590.407] -- 0:00:45
207500 -- (-590.237) [-588.446] (-595.388) (-588.602) * (-590.708) (-591.504) (-589.105) [-592.473] -- 0:00:49
208000 -- (-588.033) (-589.880) [-588.826] (-588.639) * (-589.279) [-591.346] (-591.250) (-588.060) -- 0:00:49
208500 -- (-589.384) (-587.795) [-587.958] (-590.499) * (-590.403) [-592.196] (-595.737) (-588.643) -- 0:00:49
209000 -- (-589.420) (-588.021) (-590.040) [-588.518] * (-587.381) [-590.072] (-589.540) (-588.322) -- 0:00:49
209500 -- (-588.012) (-589.819) (-588.193) [-587.791] * [-588.607] (-593.501) (-591.982) (-589.622) -- 0:00:49
210000 -- (-590.074) (-589.028) (-587.725) [-590.462] * [-588.649] (-589.973) (-592.022) (-592.092) -- 0:00:48
Average standard deviation of split frequencies: 0.013163
210500 -- (-594.383) [-591.160] (-591.412) (-588.916) * (-588.711) (-589.284) (-591.141) [-589.699] -- 0:00:48
211000 -- (-587.695) (-587.825) [-589.481] (-587.537) * [-589.258] (-589.542) (-588.894) (-590.315) -- 0:00:48
211500 -- (-591.818) (-587.793) (-588.900) [-588.393] * (-590.423) (-593.934) [-588.152] (-587.674) -- 0:00:48
212000 -- (-589.873) (-592.514) (-590.701) [-588.107] * (-590.570) [-592.949] (-588.060) (-589.114) -- 0:00:48
212500 -- (-593.623) (-591.580) (-591.420) [-587.831] * (-591.403) [-590.608] (-588.201) (-588.228) -- 0:00:48
213000 -- (-588.213) (-591.956) [-589.458] (-588.583) * (-589.758) (-588.675) [-588.753] (-587.702) -- 0:00:48
213500 -- [-589.309] (-589.588) (-588.968) (-591.575) * [-589.084] (-589.996) (-588.683) (-588.565) -- 0:00:47
214000 -- (-590.281) (-587.772) (-589.227) [-594.999] * (-589.090) (-593.900) (-588.729) [-587.650] -- 0:00:47
214500 -- (-589.273) (-593.545) (-590.604) [-591.162] * (-591.392) (-593.185) (-592.436) [-590.434] -- 0:00:47
215000 -- [-595.313] (-591.773) (-590.918) (-592.267) * [-590.148] (-589.809) (-588.248) (-588.665) -- 0:00:47
Average standard deviation of split frequencies: 0.013351
215500 -- [-589.569] (-588.916) (-593.616) (-589.542) * [-589.060] (-588.512) (-590.622) (-594.787) -- 0:00:47
216000 -- (-587.790) [-588.281] (-593.493) (-587.872) * (-591.054) (-589.829) (-587.308) [-590.141] -- 0:00:47
216500 -- (-589.620) [-589.282] (-593.113) (-587.560) * [-590.128] (-588.939) (-588.759) (-588.694) -- 0:00:47
217000 -- (-591.052) [-588.461] (-587.425) (-588.289) * (-589.035) [-587.605] (-589.808) (-589.783) -- 0:00:46
217500 -- [-588.347] (-587.497) (-590.055) (-588.869) * (-591.238) (-587.756) [-587.698] (-590.813) -- 0:00:46
218000 -- (-592.082) (-588.579) [-587.599] (-591.997) * (-588.897) (-587.950) [-589.211] (-588.369) -- 0:00:46
218500 -- [-595.479] (-589.973) (-588.497) (-588.954) * (-589.265) (-589.479) (-588.361) [-588.225] -- 0:00:46
219000 -- (-591.588) (-590.153) [-587.428] (-591.108) * (-587.902) (-588.618) (-589.882) [-589.829] -- 0:00:46
219500 -- (-590.451) (-589.182) (-587.177) [-591.823] * (-588.892) (-590.710) (-590.026) [-592.721] -- 0:00:46
220000 -- (-592.629) (-591.092) [-587.199] (-588.381) * (-589.544) (-590.808) [-589.263] (-588.754) -- 0:00:46
Average standard deviation of split frequencies: 0.012064
220500 -- (-590.572) (-595.400) (-588.942) [-588.314] * (-593.635) (-591.139) [-590.965] (-590.842) -- 0:00:45
221000 -- (-590.511) (-589.727) [-589.410] (-588.656) * [-590.570] (-588.082) (-589.578) (-590.707) -- 0:00:45
221500 -- (-588.009) [-588.726] (-589.794) (-588.587) * (-591.417) (-589.410) (-589.791) [-588.864] -- 0:00:45
222000 -- (-591.168) (-589.504) [-593.313] (-594.547) * (-593.508) [-592.130] (-594.499) (-590.092) -- 0:00:45
222500 -- (-588.283) (-588.794) (-590.173) [-587.670] * (-592.893) (-592.205) [-591.261] (-590.269) -- 0:00:48
223000 -- (-587.569) (-589.590) [-588.643] (-587.853) * (-590.624) [-589.299] (-595.389) (-589.081) -- 0:00:48
223500 -- [-588.503] (-589.046) (-588.903) (-589.398) * (-592.305) (-589.101) [-590.822] (-589.798) -- 0:00:48
224000 -- (-591.899) [-589.009] (-588.710) (-587.911) * (-590.256) (-591.415) [-590.430] (-589.582) -- 0:00:48
224500 -- [-589.793] (-590.978) (-592.762) (-587.874) * [-594.146] (-589.716) (-594.548) (-589.679) -- 0:00:48
225000 -- [-588.884] (-592.021) (-592.356) (-588.439) * (-591.085) (-591.888) (-596.114) [-588.578] -- 0:00:48
Average standard deviation of split frequencies: 0.012515
225500 -- (-595.515) [-589.306] (-591.537) (-588.870) * [-588.202] (-589.994) (-590.054) (-591.559) -- 0:00:48
226000 -- (-596.035) (-589.561) [-588.574] (-589.400) * (-588.914) [-589.776] (-589.994) (-589.397) -- 0:00:47
226500 -- (-591.465) [-590.673] (-588.891) (-589.387) * (-589.437) (-590.783) [-591.212] (-589.041) -- 0:00:47
227000 -- (-588.778) (-590.407) (-588.083) [-589.228] * [-587.757] (-588.810) (-588.485) (-588.289) -- 0:00:47
227500 -- (-589.613) [-592.194] (-587.999) (-588.625) * (-589.627) (-588.400) (-587.914) [-589.387] -- 0:00:47
228000 -- (-590.956) [-598.116] (-587.334) (-590.523) * (-593.144) (-587.168) (-599.703) [-588.670] -- 0:00:47
228500 -- (-587.519) (-593.418) (-591.257) [-588.040] * (-592.108) (-589.894) [-588.277] (-593.461) -- 0:00:47
229000 -- (-587.463) (-588.418) [-590.739] (-588.300) * (-589.029) (-589.405) [-591.594] (-588.627) -- 0:00:47
229500 -- [-589.017] (-588.623) (-589.375) (-589.540) * [-590.086] (-588.379) (-589.371) (-589.248) -- 0:00:47
230000 -- (-591.178) [-589.569] (-588.560) (-593.822) * (-589.220) [-589.474] (-590.197) (-591.489) -- 0:00:46
Average standard deviation of split frequencies: 0.011661
230500 -- (-590.268) (-592.851) (-587.561) [-589.633] * [-589.591] (-590.241) (-589.230) (-589.458) -- 0:00:46
231000 -- (-587.829) (-590.374) [-588.949] (-588.580) * (-590.463) (-589.280) (-588.438) [-591.465] -- 0:00:46
231500 -- (-589.794) (-588.168) [-588.720] (-591.934) * [-589.538] (-592.479) (-588.444) (-589.668) -- 0:00:46
232000 -- (-589.329) (-587.862) (-587.648) [-591.447] * [-588.818] (-588.958) (-591.156) (-589.327) -- 0:00:46
232500 -- (-588.821) (-588.119) [-588.433] (-591.506) * [-589.815] (-592.966) (-587.846) (-588.645) -- 0:00:46
233000 -- (-588.804) (-593.433) (-587.922) [-589.217] * (-587.714) [-588.808] (-588.087) (-588.820) -- 0:00:46
233500 -- (-587.700) (-593.192) (-594.631) [-587.445] * (-590.508) (-592.560) [-589.608] (-588.287) -- 0:00:45
234000 -- [-587.994] (-591.796) (-592.130) (-588.988) * [-591.598] (-589.853) (-588.882) (-590.142) -- 0:00:45
234500 -- (-588.670) (-588.384) (-590.716) [-588.339] * (-590.202) (-591.263) [-589.911] (-590.323) -- 0:00:45
235000 -- (-588.193) (-591.203) (-589.481) [-587.752] * (-591.317) [-590.369] (-590.645) (-589.530) -- 0:00:45
Average standard deviation of split frequencies: 0.011750
235500 -- (-590.377) (-588.731) (-591.996) [-587.564] * (-592.121) (-589.075) [-589.055] (-589.997) -- 0:00:45
236000 -- (-588.750) [-587.771] (-593.788) (-589.598) * (-590.644) (-590.902) (-588.003) [-590.143] -- 0:00:45
236500 -- [-587.911] (-589.974) (-591.640) (-590.277) * [-587.933] (-588.697) (-590.665) (-588.977) -- 0:00:45
237000 -- (-587.695) [-588.066] (-592.216) (-595.210) * (-588.029) (-588.945) [-587.764] (-590.262) -- 0:00:45
237500 -- (-589.192) (-588.446) [-587.890] (-591.034) * (-590.873) (-590.038) (-587.816) [-590.431] -- 0:00:44
238000 -- (-589.194) [-588.429] (-588.762) (-592.034) * (-588.019) (-592.073) [-589.953] (-588.459) -- 0:00:48
238500 -- [-589.403] (-589.934) (-594.849) (-589.433) * (-588.122) (-589.787) (-589.651) [-588.406] -- 0:00:47
239000 -- (-588.997) (-591.367) [-590.000] (-591.357) * (-589.259) [-589.875] (-590.810) (-590.377) -- 0:00:47
239500 -- (-588.019) (-590.028) [-588.577] (-592.969) * [-590.797] (-588.481) (-591.409) (-590.228) -- 0:00:47
240000 -- (-588.939) (-594.310) [-589.785] (-589.740) * (-588.396) (-593.084) [-588.883] (-592.722) -- 0:00:47
Average standard deviation of split frequencies: 0.013494
240500 -- (-588.000) (-588.394) (-590.180) [-593.915] * (-592.897) [-591.278] (-590.419) (-592.278) -- 0:00:47
241000 -- (-589.242) (-588.232) [-589.443] (-587.439) * (-590.809) (-587.663) (-588.554) [-588.684] -- 0:00:47
241500 -- (-589.113) (-588.625) (-588.681) [-591.214] * (-589.658) [-587.645] (-589.153) (-587.940) -- 0:00:47
242000 -- (-589.202) [-587.832] (-587.986) (-590.653) * (-591.260) (-590.932) [-588.031] (-588.160) -- 0:00:46
242500 -- [-588.446] (-589.574) (-588.101) (-589.506) * (-591.810) (-594.574) [-588.045] (-588.041) -- 0:00:46
243000 -- (-590.394) (-595.165) [-587.864] (-588.574) * (-590.365) (-589.181) [-589.127] (-591.987) -- 0:00:46
243500 -- (-588.473) [-589.111] (-587.722) (-588.345) * [-589.146] (-591.298) (-590.221) (-590.321) -- 0:00:46
244000 -- (-589.121) (-591.624) (-587.569) [-589.587] * (-594.012) (-590.791) [-589.821] (-588.869) -- 0:00:46
244500 -- [-590.028] (-595.711) (-589.276) (-589.694) * (-591.623) (-588.964) (-588.674) [-588.615] -- 0:00:46
245000 -- (-589.741) (-592.187) (-587.894) [-587.938] * (-588.126) (-592.572) [-588.017] (-588.379) -- 0:00:46
Average standard deviation of split frequencies: 0.013212
245500 -- (-589.088) (-588.969) (-593.389) [-588.755] * (-588.420) [-594.222] (-590.409) (-587.807) -- 0:00:46
246000 -- (-588.215) (-588.483) [-592.369] (-589.282) * [-590.185] (-591.749) (-589.148) (-588.050) -- 0:00:45
246500 -- (-588.919) [-590.573] (-590.368) (-592.306) * [-590.665] (-588.120) (-591.697) (-587.450) -- 0:00:45
247000 -- [-588.208] (-592.582) (-590.788) (-593.068) * [-589.745] (-590.577) (-594.975) (-590.717) -- 0:00:45
247500 -- [-588.384] (-588.250) (-590.901) (-592.035) * [-590.299] (-588.295) (-591.768) (-589.972) -- 0:00:45
248000 -- (-591.832) (-590.308) [-589.604] (-590.111) * [-588.213] (-587.977) (-589.225) (-589.938) -- 0:00:45
248500 -- (-593.393) (-587.773) (-588.343) [-588.070] * (-589.120) [-587.584] (-588.348) (-592.137) -- 0:00:45
249000 -- (-593.684) (-589.189) [-587.643] (-590.194) * [-590.601] (-588.665) (-588.969) (-589.952) -- 0:00:45
249500 -- (-593.279) (-592.508) (-587.997) [-589.081] * (-591.645) (-588.681) [-588.876] (-587.923) -- 0:00:45
250000 -- (-591.365) (-589.763) [-589.758] (-587.803) * (-587.715) (-587.946) (-588.916) [-590.332] -- 0:00:45
Average standard deviation of split frequencies: 0.012669
250500 -- [-589.514] (-591.573) (-592.654) (-591.347) * (-595.767) (-588.978) [-588.971] (-588.842) -- 0:00:44
251000 -- (-588.310) [-591.789] (-596.979) (-589.470) * (-596.871) [-589.282] (-587.662) (-588.220) -- 0:00:44
251500 -- [-593.460] (-590.904) (-589.255) (-590.830) * (-590.616) (-588.273) [-587.608] (-587.567) -- 0:00:44
252000 -- (-593.926) (-592.656) [-590.272] (-589.620) * [-589.437] (-588.738) (-587.904) (-587.412) -- 0:00:44
252500 -- (-590.138) (-593.728) [-588.746] (-589.774) * [-591.823] (-590.518) (-587.581) (-589.431) -- 0:00:47
253000 -- [-590.120] (-590.280) (-589.661) (-587.879) * (-589.128) (-591.365) [-587.685] (-591.690) -- 0:00:47
253500 -- [-588.846] (-591.309) (-591.256) (-587.841) * [-590.150] (-590.191) (-588.960) (-589.622) -- 0:00:47
254000 -- (-587.905) [-587.920] (-592.265) (-589.472) * [-589.769] (-591.313) (-592.292) (-589.013) -- 0:00:46
254500 -- (-590.038) [-591.413] (-591.687) (-588.961) * (-589.048) (-589.769) [-589.174] (-590.536) -- 0:00:46
255000 -- (-596.526) (-589.986) (-594.177) [-588.331] * [-588.016] (-588.223) (-589.293) (-588.678) -- 0:00:46
Average standard deviation of split frequencies: 0.011765
255500 -- (-592.566) (-590.512) (-593.728) [-589.086] * (-590.394) (-588.107) [-589.709] (-588.856) -- 0:00:46
256000 -- (-588.931) (-588.532) [-588.099] (-588.730) * (-588.091) [-591.557] (-595.705) (-588.657) -- 0:00:46
256500 -- (-588.454) (-589.136) [-588.000] (-589.900) * (-591.861) [-589.200] (-591.378) (-594.073) -- 0:00:46
257000 -- (-588.815) [-589.567] (-592.407) (-588.478) * (-588.308) (-588.757) (-588.980) [-589.423] -- 0:00:46
257500 -- (-594.518) [-589.886] (-590.890) (-590.659) * (-588.199) [-588.196] (-591.549) (-588.503) -- 0:00:46
258000 -- [-587.471] (-590.322) (-588.616) (-589.381) * (-591.270) (-589.958) (-588.100) [-588.175] -- 0:00:46
258500 -- [-587.650] (-587.978) (-591.005) (-590.506) * [-592.139] (-588.926) (-590.694) (-593.346) -- 0:00:45
259000 -- (-589.615) (-592.752) (-589.355) [-588.138] * (-598.804) [-588.167] (-589.341) (-590.428) -- 0:00:45
259500 -- (-590.160) (-591.979) (-590.162) [-588.135] * (-589.535) (-587.737) [-589.806] (-591.109) -- 0:00:45
260000 -- [-592.625] (-588.764) (-589.098) (-590.685) * [-591.112] (-590.261) (-593.362) (-592.080) -- 0:00:45
Average standard deviation of split frequencies: 0.011808
260500 -- (-594.245) (-588.442) (-587.570) [-588.772] * [-591.944] (-588.043) (-588.967) (-592.838) -- 0:00:45
261000 -- [-592.274] (-589.580) (-589.172) (-589.369) * (-589.999) (-588.977) [-589.755] (-590.318) -- 0:00:45
261500 -- (-590.799) [-588.952] (-591.961) (-590.390) * (-589.266) (-588.377) (-589.858) [-588.420] -- 0:00:45
262000 -- [-590.068] (-590.119) (-590.598) (-590.537) * (-588.671) (-593.889) [-589.105] (-589.495) -- 0:00:45
262500 -- (-590.378) [-591.948] (-589.863) (-595.072) * (-590.490) (-598.728) [-588.580] (-587.937) -- 0:00:44
263000 -- (-593.573) [-589.520] (-593.830) (-590.922) * [-594.794] (-593.011) (-593.865) (-590.151) -- 0:00:44
263500 -- (-594.557) (-590.400) (-588.667) [-589.295] * [-587.954] (-589.269) (-589.743) (-594.436) -- 0:00:44
264000 -- (-590.456) (-588.136) [-589.226] (-590.433) * (-589.756) (-589.255) (-590.868) [-591.678] -- 0:00:44
264500 -- (-589.628) [-588.296] (-590.572) (-590.127) * [-588.743] (-588.392) (-597.012) (-595.343) -- 0:00:44
265000 -- (-591.981) [-587.882] (-591.701) (-589.613) * (-589.329) (-589.383) [-589.659] (-590.261) -- 0:00:44
Average standard deviation of split frequencies: 0.011913
265500 -- (-590.096) [-588.712] (-589.338) (-598.524) * [-588.943] (-594.252) (-589.777) (-587.836) -- 0:00:44
266000 -- (-589.700) (-589.217) [-588.140] (-596.732) * (-591.335) (-589.762) (-591.603) [-589.653] -- 0:00:44
266500 -- [-590.873] (-589.146) (-588.971) (-591.572) * [-590.458] (-591.335) (-591.687) (-591.022) -- 0:00:46
267000 -- (-591.277) (-593.441) (-587.876) [-591.242] * (-590.532) (-588.947) (-588.504) [-590.523] -- 0:00:46
267500 -- (-590.039) [-592.360] (-590.177) (-588.811) * (-590.032) (-589.293) [-587.942] (-589.204) -- 0:00:46
268000 -- (-591.800) (-588.644) (-588.964) [-588.354] * (-593.526) (-591.746) (-588.583) [-589.704] -- 0:00:46
268500 -- [-588.630] (-588.271) (-590.298) (-588.273) * (-589.543) (-589.482) (-589.407) [-587.640] -- 0:00:46
269000 -- (-590.500) [-591.444] (-593.746) (-588.555) * (-591.339) (-588.503) (-589.245) [-588.165] -- 0:00:46
269500 -- (-590.635) [-589.365] (-595.350) (-590.751) * (-592.276) [-588.209] (-589.848) (-587.658) -- 0:00:46
270000 -- (-592.917) [-587.782] (-589.292) (-589.063) * (-589.065) [-589.273] (-589.219) (-591.125) -- 0:00:45
Average standard deviation of split frequencies: 0.011127
270500 -- (-590.484) [-587.279] (-590.050) (-589.222) * [-589.452] (-590.054) (-589.541) (-594.649) -- 0:00:45
271000 -- [-590.369] (-588.827) (-589.338) (-588.798) * (-590.825) (-592.603) (-589.361) [-588.853] -- 0:00:45
271500 -- [-589.955] (-589.582) (-589.764) (-589.834) * (-588.535) (-589.653) (-589.518) [-587.875] -- 0:00:45
272000 -- (-589.373) (-588.741) (-588.120) [-592.191] * (-591.680) (-590.002) (-588.012) [-589.165] -- 0:00:45
272500 -- (-590.569) (-590.053) (-591.342) [-590.353] * (-590.152) [-591.084] (-591.430) (-588.636) -- 0:00:45
273000 -- (-590.143) (-588.312) [-589.781] (-592.013) * [-589.662] (-589.670) (-590.868) (-589.013) -- 0:00:45
273500 -- (-592.838) [-588.335] (-590.982) (-595.312) * [-588.576] (-593.056) (-589.440) (-589.605) -- 0:00:45
274000 -- (-589.221) (-588.822) [-589.552] (-589.437) * [-588.216] (-589.350) (-589.226) (-588.837) -- 0:00:45
274500 -- (-592.394) (-589.349) [-590.286] (-590.107) * (-588.938) (-590.249) [-591.279] (-588.268) -- 0:00:44
275000 -- (-590.514) (-587.695) (-588.238) [-588.419] * (-589.317) [-589.433] (-589.389) (-587.916) -- 0:00:44
Average standard deviation of split frequencies: 0.011102
275500 -- [-591.837] (-588.882) (-589.032) (-591.549) * (-592.406) (-590.784) [-588.020] (-588.289) -- 0:00:44
276000 -- (-591.225) (-590.317) [-588.022] (-589.813) * (-590.643) [-592.179] (-588.119) (-589.772) -- 0:00:44
276500 -- [-588.956] (-590.793) (-591.375) (-588.259) * (-591.102) [-593.266] (-593.110) (-589.240) -- 0:00:44
277000 -- (-587.456) (-589.972) (-590.177) [-587.931] * (-590.427) (-588.771) (-592.867) [-591.495] -- 0:00:44
277500 -- (-590.027) (-589.380) (-588.961) [-589.691] * [-589.418] (-590.120) (-589.003) (-590.610) -- 0:00:44
278000 -- (-587.708) (-590.710) [-594.704] (-593.102) * [-593.025] (-590.153) (-588.216) (-591.740) -- 0:00:44
278500 -- (-589.469) (-590.327) [-590.079] (-588.518) * [-588.025] (-588.662) (-590.257) (-588.019) -- 0:00:44
279000 -- (-589.251) (-590.228) [-588.130] (-588.857) * (-588.561) [-589.839] (-593.621) (-590.260) -- 0:00:43
279500 -- (-588.461) [-590.380] (-590.682) (-587.536) * (-589.925) [-589.382] (-588.725) (-594.335) -- 0:00:43
280000 -- (-588.446) (-588.398) [-589.873] (-588.507) * [-589.401] (-591.081) (-588.261) (-593.839) -- 0:00:43
Average standard deviation of split frequencies: 0.011850
280500 -- [-590.612] (-591.792) (-592.563) (-589.827) * (-591.922) (-591.932) [-589.967] (-589.598) -- 0:00:46
281000 -- (-593.515) (-589.172) (-594.090) [-588.854] * (-590.116) (-592.287) (-588.759) [-589.588] -- 0:00:46
281500 -- [-589.233] (-591.273) (-587.669) (-589.500) * (-592.484) (-590.659) [-588.859] (-591.058) -- 0:00:45
282000 -- (-594.176) (-590.052) [-591.742] (-592.644) * [-591.786] (-591.090) (-591.367) (-589.483) -- 0:00:45
282500 -- [-589.070] (-590.406) (-590.754) (-587.835) * (-588.770) (-589.614) [-588.080] (-588.577) -- 0:00:45
283000 -- (-588.720) [-589.308] (-590.488) (-587.563) * [-589.999] (-588.538) (-588.213) (-588.547) -- 0:00:45
283500 -- (-588.338) (-593.245) (-588.956) [-588.736] * (-594.227) [-588.397] (-588.811) (-588.611) -- 0:00:45
284000 -- (-591.069) (-590.378) [-588.930] (-591.105) * (-589.392) [-589.289] (-591.054) (-589.766) -- 0:00:45
284500 -- (-588.552) (-588.661) (-587.861) [-587.779] * [-589.927] (-591.157) (-589.488) (-587.511) -- 0:00:45
285000 -- [-589.037] (-590.314) (-592.152) (-588.340) * (-589.901) [-591.260] (-591.672) (-589.143) -- 0:00:45
Average standard deviation of split frequencies: 0.012728
285500 -- (-588.331) [-590.699] (-591.500) (-590.875) * (-589.119) (-589.525) [-590.969] (-590.732) -- 0:00:45
286000 -- (-587.632) [-588.823] (-588.838) (-589.094) * [-590.078] (-589.875) (-591.010) (-587.607) -- 0:00:44
286500 -- (-588.897) (-590.905) [-588.131] (-588.444) * (-589.182) [-597.067] (-592.099) (-592.247) -- 0:00:44
287000 -- (-595.923) (-593.596) (-590.024) [-590.314] * [-587.929] (-592.224) (-595.755) (-588.712) -- 0:00:44
287500 -- [-589.366] (-589.242) (-590.706) (-589.105) * (-588.658) (-596.307) [-588.216] (-588.456) -- 0:00:44
288000 -- [-588.638] (-590.860) (-591.282) (-588.920) * (-589.276) (-591.919) [-590.057] (-588.282) -- 0:00:44
288500 -- [-587.559] (-588.578) (-589.771) (-589.902) * (-588.687) (-589.985) [-588.824] (-589.135) -- 0:00:44
289000 -- (-587.358) (-590.447) [-590.843] (-590.736) * (-588.037) (-590.353) [-589.347] (-596.693) -- 0:00:44
289500 -- (-589.106) (-591.453) [-587.501] (-589.249) * (-587.497) [-591.905] (-590.247) (-588.678) -- 0:00:44
290000 -- (-592.184) [-589.113] (-590.521) (-590.883) * (-599.211) (-588.926) (-588.147) [-588.850] -- 0:00:44
Average standard deviation of split frequencies: 0.012020
290500 -- [-589.065] (-587.696) (-590.664) (-590.723) * [-590.729] (-590.817) (-590.689) (-589.284) -- 0:00:43
291000 -- [-589.027] (-588.572) (-588.270) (-590.214) * [-588.843] (-592.261) (-591.896) (-587.995) -- 0:00:43
291500 -- (-591.282) [-588.847] (-588.964) (-592.092) * (-591.235) (-588.633) (-590.471) [-587.587] -- 0:00:43
292000 -- (-587.455) (-589.515) [-589.802] (-591.573) * (-588.495) (-590.764) [-589.520] (-590.375) -- 0:00:43
292500 -- (-588.753) [-588.240] (-590.157) (-592.442) * [-590.396] (-589.729) (-589.683) (-588.642) -- 0:00:43
293000 -- (-589.264) (-588.977) [-591.817] (-588.406) * [-589.729] (-589.918) (-588.536) (-591.778) -- 0:00:43
293500 -- (-588.847) (-588.361) [-592.705] (-588.514) * (-588.681) (-590.354) (-593.696) [-589.806] -- 0:00:43
294000 -- (-589.438) [-588.614] (-592.269) (-589.154) * [-588.476] (-590.199) (-589.691) (-590.060) -- 0:00:43
294500 -- [-590.680] (-592.708) (-593.186) (-589.952) * (-588.954) [-589.461] (-592.023) (-591.533) -- 0:00:43
295000 -- [-590.480] (-592.823) (-591.625) (-590.049) * (-589.360) (-589.673) (-588.633) [-590.336] -- 0:00:43
Average standard deviation of split frequencies: 0.011944
295500 -- (-589.359) (-590.776) [-588.609] (-590.954) * (-590.224) (-590.520) [-588.185] (-590.878) -- 0:00:42
296000 -- [-587.653] (-591.503) (-591.354) (-588.508) * (-588.425) [-589.134] (-592.046) (-587.544) -- 0:00:42
296500 -- (-588.053) (-589.071) (-588.198) [-588.097] * (-588.077) (-589.085) [-588.512] (-588.349) -- 0:00:45
297000 -- (-588.077) (-591.417) [-588.437] (-587.785) * [-590.067] (-588.182) (-592.846) (-587.705) -- 0:00:44
297500 -- [-588.133] (-590.523) (-590.787) (-587.541) * (-589.629) [-591.623] (-593.186) (-589.663) -- 0:00:44
298000 -- [-588.463] (-588.030) (-589.850) (-589.706) * (-588.273) (-590.624) (-589.461) [-590.211] -- 0:00:44
298500 -- (-589.000) (-590.970) [-589.732] (-589.830) * (-590.690) (-589.496) [-588.093] (-592.041) -- 0:00:44
299000 -- (-592.580) (-593.618) (-589.068) [-589.189] * [-588.811] (-591.210) (-589.006) (-590.500) -- 0:00:44
299500 -- (-592.258) (-588.472) [-591.626] (-589.394) * (-591.318) [-592.731] (-590.744) (-588.174) -- 0:00:44
300000 -- (-593.733) (-591.858) [-591.496] (-589.689) * (-592.673) [-588.420] (-589.567) (-588.214) -- 0:00:44
Average standard deviation of split frequencies: 0.011269
300500 -- (-594.583) (-593.087) [-588.721] (-590.449) * (-588.835) (-589.675) [-589.091] (-587.887) -- 0:00:44
301000 -- [-590.052] (-587.667) (-589.542) (-589.128) * (-593.247) (-589.543) (-589.056) [-588.185] -- 0:00:44
301500 -- (-590.931) [-589.608] (-589.469) (-590.618) * (-591.088) (-591.069) [-589.418] (-588.530) -- 0:00:44
302000 -- (-590.404) [-587.734] (-588.073) (-588.866) * (-588.515) (-591.063) [-591.231] (-592.228) -- 0:00:43
302500 -- (-591.364) [-590.511] (-589.366) (-589.937) * (-589.109) (-592.494) [-588.016] (-590.098) -- 0:00:43
303000 -- (-591.408) [-589.576] (-593.830) (-591.731) * (-588.936) (-587.258) (-587.528) [-589.927] -- 0:00:43
303500 -- (-589.608) (-591.257) [-588.317] (-597.125) * (-591.461) (-592.995) [-589.099] (-591.325) -- 0:00:43
304000 -- (-590.416) (-590.235) (-589.372) [-589.782] * (-592.579) (-590.451) (-588.060) [-589.886] -- 0:00:43
304500 -- [-592.076] (-589.117) (-590.270) (-589.184) * (-589.247) [-591.073] (-590.706) (-589.574) -- 0:00:43
305000 -- [-588.768] (-591.345) (-588.508) (-590.717) * (-589.796) (-589.101) [-590.849] (-589.719) -- 0:00:43
Average standard deviation of split frequencies: 0.010976
305500 -- (-588.976) (-588.665) [-588.255] (-589.420) * (-592.873) [-588.992] (-588.633) (-593.606) -- 0:00:43
306000 -- (-589.181) [-588.053] (-590.874) (-590.864) * (-590.437) (-590.778) [-588.614] (-591.728) -- 0:00:43
306500 -- (-590.347) (-587.318) (-589.831) [-589.067] * (-589.230) [-588.545] (-587.841) (-590.740) -- 0:00:42
307000 -- (-588.294) (-589.259) (-589.599) [-587.792] * (-588.582) [-588.985] (-588.209) (-589.613) -- 0:00:42
307500 -- (-589.940) [-587.906] (-590.725) (-591.437) * (-590.572) (-589.575) (-589.186) [-596.236] -- 0:00:42
308000 -- [-588.724] (-589.419) (-594.851) (-589.980) * [-590.226] (-588.736) (-589.536) (-590.946) -- 0:00:42
308500 -- (-589.916) (-588.849) (-593.023) [-590.288] * (-588.967) (-589.911) [-589.800] (-587.687) -- 0:00:42
309000 -- (-590.647) (-588.951) (-591.064) [-587.964] * (-588.007) (-593.710) [-589.973] (-588.905) -- 0:00:42
309500 -- (-589.353) (-589.716) (-592.127) [-587.973] * [-587.806] (-591.350) (-588.338) (-588.448) -- 0:00:44
310000 -- (-591.168) (-589.840) [-587.561] (-588.946) * (-589.746) (-589.053) [-588.004] (-589.831) -- 0:00:44
Average standard deviation of split frequencies: 0.009104
310500 -- (-593.598) (-597.103) (-588.365) [-587.941] * (-589.597) (-588.404) (-588.974) [-589.578] -- 0:00:44
311000 -- (-589.798) (-592.569) [-589.173] (-589.624) * (-587.854) (-588.337) (-592.783) [-588.174] -- 0:00:44
311500 -- (-589.077) [-591.220] (-592.466) (-590.109) * (-594.914) [-589.309] (-589.500) (-592.054) -- 0:00:44
312000 -- (-589.964) [-588.687] (-589.068) (-588.298) * (-588.591) [-588.566] (-592.184) (-588.097) -- 0:00:44
312500 -- (-588.218) (-589.683) (-591.528) [-588.100] * (-590.194) (-589.804) [-587.535] (-590.472) -- 0:00:44
313000 -- [-591.378] (-590.080) (-589.328) (-588.632) * (-589.481) (-591.989) [-589.785] (-595.672) -- 0:00:43
313500 -- (-590.159) (-589.576) (-588.524) [-590.021] * [-589.465] (-589.298) (-589.005) (-592.422) -- 0:00:43
314000 -- (-589.540) (-587.877) [-588.750] (-589.255) * (-592.781) (-589.165) (-590.545) [-589.880] -- 0:00:43
314500 -- (-588.014) (-587.859) [-590.871] (-588.388) * (-594.794) [-590.783] (-588.747) (-591.280) -- 0:00:43
315000 -- (-587.522) (-588.730) [-589.308] (-589.901) * [-587.581] (-592.482) (-588.994) (-590.682) -- 0:00:43
Average standard deviation of split frequencies: 0.009779
315500 -- (-587.838) (-592.515) [-588.245] (-590.862) * (-589.171) (-593.716) (-588.469) [-590.702] -- 0:00:43
316000 -- (-588.591) (-590.666) (-589.030) [-588.307] * [-587.691] (-589.344) (-588.551) (-591.828) -- 0:00:43
316500 -- (-587.863) (-590.286) (-589.828) [-591.321] * (-588.274) [-588.909] (-589.468) (-592.325) -- 0:00:43
317000 -- [-593.607] (-589.723) (-589.002) (-588.406) * (-589.089) (-589.167) [-591.719] (-590.179) -- 0:00:43
317500 -- (-592.735) (-591.931) (-588.990) [-589.118] * (-594.866) (-589.273) (-589.685) [-590.395] -- 0:00:42
318000 -- (-588.827) (-588.325) [-590.697] (-589.631) * (-591.363) (-588.527) [-590.460] (-591.069) -- 0:00:42
318500 -- [-591.509] (-589.705) (-588.816) (-593.951) * (-589.379) (-590.035) [-589.367] (-589.524) -- 0:00:42
319000 -- [-589.335] (-588.906) (-591.456) (-592.423) * [-588.000] (-590.678) (-589.062) (-588.556) -- 0:00:42
319500 -- (-588.712) (-590.358) (-589.251) [-588.904] * (-588.529) (-591.857) [-590.638] (-588.674) -- 0:00:42
320000 -- (-589.796) (-587.839) [-589.164] (-595.152) * [-589.849] (-591.065) (-590.485) (-587.425) -- 0:00:42
Average standard deviation of split frequencies: 0.009464
320500 -- (-592.683) [-589.621] (-589.556) (-592.507) * (-589.449) (-594.281) (-589.070) [-589.419] -- 0:00:42
321000 -- [-587.478] (-589.185) (-589.611) (-589.906) * [-590.741] (-593.859) (-590.376) (-589.967) -- 0:00:42
321500 -- (-588.864) (-589.967) [-589.829] (-588.155) * (-587.997) [-593.298] (-590.330) (-589.729) -- 0:00:42
322000 -- (-590.351) (-590.376) [-593.730] (-594.377) * (-589.678) [-591.114] (-591.647) (-591.641) -- 0:00:42
322500 -- (-588.507) (-591.722) (-589.066) [-589.100] * (-589.277) (-588.791) [-590.657] (-590.140) -- 0:00:42
323000 -- [-589.510] (-589.082) (-593.942) (-592.877) * (-591.180) (-590.090) [-594.448] (-591.114) -- 0:00:41
323500 -- (-588.152) (-591.262) (-591.690) [-588.036] * (-589.061) (-587.315) [-590.396] (-591.945) -- 0:00:41
324000 -- (-592.905) (-591.584) [-592.299] (-587.774) * (-589.240) [-589.773] (-595.528) (-588.834) -- 0:00:41
324500 -- (-595.335) [-589.943] (-591.302) (-590.314) * (-593.050) (-588.701) [-588.744] (-590.547) -- 0:00:41
325000 -- (-593.417) (-596.031) [-593.395] (-588.997) * (-593.251) (-591.562) (-588.999) [-591.260] -- 0:00:43
Average standard deviation of split frequencies: 0.008997
325500 -- [-589.609] (-591.694) (-593.003) (-587.700) * [-591.520] (-591.510) (-588.544) (-588.431) -- 0:00:43
326000 -- (-589.624) (-595.537) (-587.856) [-593.308] * (-589.488) (-590.468) (-589.918) [-590.895] -- 0:00:43
326500 -- (-592.088) (-590.754) (-593.811) [-588.843] * [-589.621] (-589.190) (-594.139) (-590.824) -- 0:00:43
327000 -- (-589.718) (-591.995) [-589.297] (-587.565) * [-595.557] (-590.558) (-592.635) (-590.187) -- 0:00:43
327500 -- [-589.587] (-590.119) (-592.007) (-589.227) * (-591.201) [-587.730] (-591.836) (-593.228) -- 0:00:43
328000 -- (-597.318) (-588.381) (-590.455) [-590.448] * (-587.605) [-589.108] (-589.357) (-592.680) -- 0:00:43
328500 -- (-593.487) (-589.084) (-588.756) [-587.782] * [-596.664] (-589.561) (-594.892) (-588.703) -- 0:00:42
329000 -- (-594.099) (-588.562) [-587.789] (-593.676) * [-591.499] (-587.510) (-600.719) (-590.091) -- 0:00:42
329500 -- (-590.482) [-589.894] (-588.573) (-589.819) * (-591.146) (-587.938) [-589.584] (-593.649) -- 0:00:42
330000 -- [-589.299] (-595.912) (-591.055) (-591.917) * [-588.496] (-589.346) (-589.703) (-589.597) -- 0:00:42
Average standard deviation of split frequencies: 0.009267
330500 -- (-590.359) (-588.830) (-590.927) [-589.578] * (-595.190) [-590.467] (-590.684) (-589.515) -- 0:00:42
331000 -- (-590.725) [-588.075] (-590.337) (-593.608) * (-589.118) [-590.467] (-589.217) (-588.488) -- 0:00:42
331500 -- [-593.707] (-590.064) (-589.723) (-594.148) * (-587.630) [-588.311] (-590.586) (-588.625) -- 0:00:42
332000 -- [-590.150] (-591.212) (-588.288) (-593.386) * (-590.117) (-589.795) (-587.335) [-589.395] -- 0:00:42
332500 -- (-591.075) [-591.264] (-589.535) (-591.252) * (-592.271) (-589.837) [-592.045] (-589.362) -- 0:00:42
333000 -- (-589.125) [-590.507] (-589.974) (-590.355) * [-588.587] (-590.321) (-590.359) (-591.230) -- 0:00:42
333500 -- (-588.749) [-588.006] (-590.432) (-589.074) * (-588.624) (-590.585) [-594.239] (-590.639) -- 0:00:41
334000 -- (-588.656) (-589.383) (-588.795) [-589.314] * [-589.439] (-595.055) (-590.761) (-589.285) -- 0:00:41
334500 -- (-589.818) (-590.294) [-589.319] (-587.804) * (-591.024) [-594.469] (-594.952) (-589.431) -- 0:00:41
335000 -- (-589.747) (-589.072) (-597.019) [-589.328] * (-591.353) [-590.850] (-588.146) (-588.672) -- 0:00:41
Average standard deviation of split frequencies: 0.009382
335500 -- [-589.612] (-588.935) (-591.072) (-588.100) * (-591.857) (-589.200) (-588.387) [-589.809] -- 0:00:41
336000 -- (-587.809) (-589.816) (-591.980) [-591.095] * (-588.660) (-588.652) [-593.482] (-591.756) -- 0:00:41
336500 -- (-589.729) (-589.156) [-589.584] (-593.671) * (-588.007) (-590.005) [-590.021] (-590.764) -- 0:00:41
337000 -- [-589.660] (-587.908) (-591.504) (-589.570) * (-589.600) [-590.572] (-592.171) (-590.014) -- 0:00:41
337500 -- (-588.403) (-587.964) [-587.996] (-590.216) * (-589.563) (-588.311) (-590.570) [-588.795] -- 0:00:41
338000 -- (-589.705) (-588.745) [-592.042] (-591.620) * (-589.556) (-589.114) [-592.054] (-588.109) -- 0:00:41
338500 -- [-588.337] (-589.762) (-590.162) (-590.338) * (-590.095) (-588.937) (-593.001) [-588.696] -- 0:00:41
339000 -- (-594.610) (-588.534) [-592.381] (-590.283) * (-589.231) (-592.138) [-593.625] (-590.128) -- 0:00:40
339500 -- (-587.531) (-593.939) (-591.970) [-591.079] * (-590.205) [-589.936] (-590.887) (-589.637) -- 0:00:42
340000 -- [-587.496] (-597.466) (-589.820) (-588.647) * (-590.878) [-592.018] (-588.687) (-588.615) -- 0:00:42
Average standard deviation of split frequencies: 0.009946
340500 -- (-588.728) [-589.734] (-593.587) (-588.807) * (-588.771) (-588.762) (-590.425) [-589.447] -- 0:00:42
341000 -- (-593.545) (-589.428) (-591.791) [-589.759] * (-587.595) (-588.977) (-591.622) [-591.567] -- 0:00:42
341500 -- [-588.153] (-590.767) (-593.174) (-592.163) * (-587.533) (-590.000) (-590.960) [-592.502] -- 0:00:42
342000 -- (-590.026) (-589.625) (-591.660) [-593.547] * (-587.480) (-591.621) [-591.414] (-590.272) -- 0:00:42
342500 -- (-588.233) [-588.423] (-590.274) (-590.627) * [-590.084] (-589.138) (-591.077) (-587.950) -- 0:00:42
343000 -- (-590.697) (-587.465) [-588.996] (-589.314) * (-590.810) (-588.115) (-589.313) [-589.207] -- 0:00:42
343500 -- [-587.759] (-588.172) (-589.419) (-592.392) * (-590.010) (-590.702) [-587.584] (-587.722) -- 0:00:42
344000 -- (-588.570) [-589.714] (-587.318) (-588.556) * (-593.883) (-592.499) [-588.144] (-590.198) -- 0:00:41
344500 -- (-591.235) (-588.971) (-588.361) [-588.392] * (-591.198) (-588.709) [-591.403] (-590.529) -- 0:00:41
345000 -- [-588.534] (-587.954) (-589.876) (-587.961) * (-589.764) (-592.892) (-587.843) [-590.367] -- 0:00:41
Average standard deviation of split frequencies: 0.009537
345500 -- (-590.276) (-587.871) (-587.787) [-588.317] * (-592.079) [-590.743] (-588.571) (-587.977) -- 0:00:41
346000 -- (-587.424) (-590.230) [-589.216] (-588.355) * (-590.209) [-591.078] (-594.337) (-589.239) -- 0:00:41
346500 -- (-588.480) (-591.820) [-592.160] (-588.967) * (-588.596) (-592.826) [-589.964] (-588.001) -- 0:00:41
347000 -- (-593.056) (-592.829) [-592.233] (-587.921) * (-588.015) (-592.266) [-589.034] (-587.718) -- 0:00:41
347500 -- (-588.988) [-589.229] (-591.200) (-587.350) * [-592.891] (-587.593) (-589.951) (-594.438) -- 0:00:41
348000 -- (-587.898) [-588.440] (-591.014) (-588.643) * [-592.888] (-590.334) (-589.312) (-589.779) -- 0:00:41
348500 -- (-590.954) (-589.229) (-589.484) [-588.583] * (-593.442) [-592.564] (-591.731) (-588.825) -- 0:00:41
349000 -- (-590.014) (-589.879) [-589.662] (-590.817) * (-588.609) (-590.379) (-590.326) [-589.447] -- 0:00:41
349500 -- (-590.967) [-588.240] (-592.588) (-588.378) * [-593.692] (-589.148) (-589.206) (-589.817) -- 0:00:40
350000 -- (-588.024) (-590.304) (-590.193) [-588.301] * [-590.826] (-589.236) (-589.341) (-592.378) -- 0:00:40
Average standard deviation of split frequencies: 0.009914
350500 -- (-588.849) (-591.913) [-589.464] (-588.871) * (-602.301) (-588.881) (-590.192) [-589.234] -- 0:00:40
351000 -- (-589.254) [-588.911] (-588.633) (-589.603) * (-593.097) [-587.311] (-587.526) (-589.848) -- 0:00:40
351500 -- (-589.080) (-589.339) [-590.512] (-589.716) * (-588.832) [-591.147] (-589.989) (-589.385) -- 0:00:40
352000 -- [-588.536] (-587.903) (-591.829) (-591.256) * (-591.768) [-593.026] (-587.838) (-589.403) -- 0:00:40
352500 -- (-588.594) (-589.633) [-588.312] (-589.570) * (-591.668) [-587.966] (-588.101) (-591.143) -- 0:00:40
353000 -- (-589.508) [-589.518] (-589.034) (-587.913) * [-588.075] (-588.292) (-587.623) (-590.028) -- 0:00:40
353500 -- (-592.647) (-591.424) (-590.584) [-590.239] * [-587.900] (-589.267) (-587.650) (-589.507) -- 0:00:40
354000 -- [-596.960] (-592.028) (-593.475) (-591.852) * (-587.760) (-588.881) (-587.775) [-591.591] -- 0:00:40
354500 -- (-589.905) (-591.618) [-588.285] (-592.988) * (-592.226) [-592.091] (-594.486) (-590.112) -- 0:00:41
355000 -- (-595.233) (-589.081) (-587.516) [-589.042] * (-588.365) (-593.877) [-590.218] (-594.358) -- 0:00:41
Average standard deviation of split frequencies: 0.009004
355500 -- [-592.041] (-588.338) (-587.360) (-588.774) * (-590.755) (-592.502) [-593.338] (-593.632) -- 0:00:41
356000 -- (-590.259) (-588.577) [-590.119] (-593.627) * (-589.032) (-590.287) [-590.351] (-593.192) -- 0:00:41
356500 -- (-595.348) [-589.298] (-592.681) (-591.172) * [-588.743] (-588.263) (-592.367) (-590.424) -- 0:00:41
357000 -- (-589.732) [-589.301] (-591.079) (-590.891) * (-590.396) (-591.196) [-590.842] (-588.861) -- 0:00:41
357500 -- (-588.423) [-587.821] (-591.648) (-589.652) * (-590.263) (-592.421) (-589.067) [-588.120] -- 0:00:41
358000 -- (-590.330) (-591.058) (-588.254) [-590.067] * (-590.066) [-588.135] (-590.089) (-587.390) -- 0:00:41
358500 -- (-590.346) (-590.890) [-588.632] (-592.684) * (-589.738) (-588.125) (-592.596) [-592.670] -- 0:00:41
359000 -- [-591.447] (-588.436) (-588.527) (-594.527) * (-589.428) (-589.705) (-592.649) [-590.563] -- 0:00:41
359500 -- [-588.781] (-597.046) (-591.131) (-591.656) * (-588.623) [-590.730] (-591.408) (-589.054) -- 0:00:40
360000 -- [-589.514] (-592.996) (-589.026) (-589.794) * (-590.325) (-589.491) (-590.008) [-590.190] -- 0:00:40
Average standard deviation of split frequencies: 0.009411
360500 -- (-590.183) (-588.665) (-589.651) [-589.694] * [-588.429] (-591.714) (-589.125) (-589.579) -- 0:00:40
361000 -- (-589.213) (-590.686) (-591.604) [-589.250] * (-588.401) (-595.120) [-590.235] (-588.231) -- 0:00:40
361500 -- [-593.850] (-588.600) (-590.373) (-589.954) * [-588.026] (-588.066) (-590.727) (-589.232) -- 0:00:40
362000 -- (-591.442) (-590.031) [-588.349] (-589.286) * (-587.925) (-588.321) (-588.524) [-592.226] -- 0:00:40
362500 -- [-588.805] (-588.680) (-588.279) (-588.981) * (-590.115) (-589.821) (-589.048) [-588.739] -- 0:00:40
363000 -- (-590.515) (-592.131) [-591.128] (-590.351) * [-589.379] (-587.761) (-587.817) (-589.778) -- 0:00:40
363500 -- [-587.703] (-588.461) (-589.297) (-590.759) * (-589.112) (-589.940) [-589.457] (-591.079) -- 0:00:40
364000 -- [-588.463] (-592.330) (-587.896) (-589.441) * (-590.571) (-588.237) (-590.477) [-588.385] -- 0:00:40
364500 -- (-589.005) (-592.057) (-588.678) [-590.016] * (-588.950) (-591.490) [-588.422] (-588.492) -- 0:00:40
365000 -- [-591.280] (-593.938) (-589.768) (-588.141) * [-588.017] (-589.075) (-589.110) (-591.296) -- 0:00:40
Average standard deviation of split frequencies: 0.009274
365500 -- (-591.523) (-590.937) (-595.379) [-588.400] * (-589.628) (-588.488) (-588.134) [-589.243] -- 0:00:39
366000 -- (-594.694) (-595.832) (-590.181) [-587.987] * (-589.022) (-590.635) [-588.099] (-590.791) -- 0:00:39
366500 -- (-594.499) (-591.622) (-588.605) [-589.837] * [-590.509] (-594.902) (-589.751) (-587.844) -- 0:00:39
367000 -- (-590.983) (-588.489) (-592.227) [-589.931] * (-590.881) (-590.077) [-589.350] (-589.032) -- 0:00:39
367500 -- (-593.265) (-589.150) (-587.934) [-589.844] * [-588.218] (-589.748) (-590.344) (-590.739) -- 0:00:39
368000 -- (-589.335) (-589.888) (-589.808) [-590.180] * (-590.521) [-591.370] (-590.092) (-588.646) -- 0:00:39
368500 -- (-588.480) (-593.973) [-591.648] (-590.760) * [-589.688] (-589.999) (-591.312) (-588.537) -- 0:00:39
369000 -- (-591.895) (-591.205) [-589.250] (-587.642) * (-590.551) (-589.090) [-588.770] (-592.315) -- 0:00:39
369500 -- (-591.493) [-588.830] (-588.462) (-589.609) * [-591.562] (-588.588) (-590.732) (-587.765) -- 0:00:39
370000 -- (-588.291) (-588.345) (-589.319) [-587.709] * [-591.291] (-590.477) (-587.687) (-588.291) -- 0:00:40
Average standard deviation of split frequencies: 0.008563
370500 -- [-587.570] (-589.735) (-590.457) (-587.566) * [-589.039] (-589.647) (-589.027) (-588.651) -- 0:00:40
371000 -- (-592.910) [-588.278] (-590.295) (-588.450) * (-589.988) [-590.354] (-587.384) (-589.406) -- 0:00:40
371500 -- (-588.424) (-588.324) (-587.769) [-588.416] * (-589.182) (-589.114) [-588.105] (-588.718) -- 0:00:40
372000 -- [-590.704] (-589.293) (-591.412) (-591.119) * (-592.098) (-590.195) (-593.967) [-588.875] -- 0:00:40
372500 -- (-589.096) (-588.312) [-588.146] (-595.054) * (-587.935) [-588.855] (-593.421) (-590.841) -- 0:00:40
373000 -- (-587.926) (-588.519) (-592.558) [-592.521] * [-588.500] (-589.508) (-589.662) (-589.710) -- 0:00:40
373500 -- (-588.213) [-587.347] (-588.755) (-592.313) * [-591.386] (-588.844) (-592.402) (-592.572) -- 0:00:40
374000 -- [-588.421] (-588.067) (-589.598) (-588.113) * (-589.883) [-588.116] (-589.981) (-588.210) -- 0:00:40
374500 -- (-590.644) (-588.432) [-589.302] (-589.698) * (-592.980) (-588.676) (-589.615) [-589.911] -- 0:00:40
375000 -- [-591.094] (-587.706) (-589.580) (-590.014) * [-589.510] (-594.762) (-589.756) (-589.949) -- 0:00:40
Average standard deviation of split frequencies: 0.008609
375500 -- (-590.812) (-588.857) [-588.713] (-590.606) * (-590.662) (-588.234) (-591.466) [-588.379] -- 0:00:39
376000 -- (-589.311) (-587.486) [-589.152] (-591.035) * [-589.801] (-589.300) (-588.879) (-589.024) -- 0:00:39
376500 -- (-588.168) (-588.377) [-588.838] (-591.383) * (-592.764) [-590.231] (-588.719) (-588.369) -- 0:00:39
377000 -- (-588.607) (-589.365) [-593.053] (-591.679) * (-588.750) (-590.449) [-587.432] (-596.221) -- 0:00:39
377500 -- (-593.035) (-589.736) [-591.434] (-591.770) * (-588.326) (-587.412) (-587.719) [-590.344] -- 0:00:39
378000 -- (-591.751) (-591.503) [-589.283] (-591.563) * (-588.122) (-588.067) (-592.109) [-589.647] -- 0:00:39
378500 -- (-591.870) (-591.800) (-589.591) [-592.255] * [-588.949] (-588.494) (-588.728) (-589.408) -- 0:00:39
379000 -- (-593.503) (-589.595) (-587.571) [-588.987] * [-587.667] (-590.457) (-590.515) (-589.237) -- 0:00:39
379500 -- (-589.197) (-590.009) [-589.382] (-589.858) * [-587.840] (-591.354) (-590.965) (-592.080) -- 0:00:39
380000 -- [-592.660] (-590.091) (-588.056) (-589.029) * (-587.768) (-590.214) [-589.741] (-591.335) -- 0:00:39
Average standard deviation of split frequencies: 0.008173
380500 -- [-592.309] (-588.084) (-591.302) (-588.730) * (-590.562) (-589.189) [-589.975] (-590.546) -- 0:00:39
381000 -- [-589.175] (-592.221) (-594.501) (-589.831) * (-589.909) (-589.432) (-588.218) [-592.519] -- 0:00:38
381500 -- (-591.359) [-589.337] (-589.717) (-590.227) * (-589.857) (-587.961) [-591.391] (-592.613) -- 0:00:38
382000 -- (-590.911) (-588.826) [-589.612] (-588.961) * (-590.792) (-588.945) [-588.825] (-590.452) -- 0:00:38
382500 -- (-598.561) (-589.457) (-588.435) [-589.470] * (-588.002) [-589.971] (-591.333) (-590.774) -- 0:00:38
383000 -- [-590.279] (-591.990) (-590.986) (-589.077) * (-590.682) [-588.435] (-591.781) (-588.953) -- 0:00:38
383500 -- [-589.941] (-589.654) (-590.295) (-591.151) * [-591.172] (-589.836) (-593.825) (-595.058) -- 0:00:38
384000 -- (-588.400) [-589.245] (-595.933) (-588.194) * (-588.695) [-589.787] (-589.350) (-590.273) -- 0:00:38
384500 -- [-588.213] (-589.510) (-591.725) (-588.560) * (-588.018) (-591.096) (-590.725) [-589.414] -- 0:00:38
385000 -- (-587.788) [-588.650] (-595.133) (-590.494) * (-591.592) (-588.309) [-588.654] (-589.450) -- 0:00:39
Average standard deviation of split frequencies: 0.009083
385500 -- (-588.738) (-587.845) [-590.461] (-588.206) * (-591.633) (-588.498) (-589.489) [-591.150] -- 0:00:39
386000 -- (-588.994) (-587.822) (-593.438) [-588.129] * (-596.409) (-588.426) [-589.654] (-587.795) -- 0:00:39
386500 -- (-591.028) [-587.785] (-589.041) (-589.967) * (-591.814) (-594.270) [-588.060] (-592.598) -- 0:00:39
387000 -- (-589.482) [-587.961] (-589.427) (-590.075) * (-589.104) (-589.320) (-590.527) [-590.639] -- 0:00:39
387500 -- (-587.761) (-589.287) [-587.672] (-593.027) * (-589.654) [-589.966] (-589.204) (-588.785) -- 0:00:39
388000 -- (-589.209) (-589.228) (-588.803) [-592.591] * (-588.226) (-587.940) [-589.064] (-589.091) -- 0:00:39
388500 -- (-593.685) [-590.169] (-590.525) (-590.462) * [-589.072] (-590.336) (-588.891) (-588.445) -- 0:00:39
389000 -- [-591.670] (-592.208) (-589.300) (-589.400) * (-589.976) [-588.404] (-590.705) (-589.353) -- 0:00:39
389500 -- (-590.351) (-590.136) [-591.365] (-594.346) * [-588.750] (-589.922) (-587.970) (-588.647) -- 0:00:39
390000 -- (-587.878) (-589.622) [-589.146] (-588.355) * [-592.165] (-589.242) (-589.657) (-589.735) -- 0:00:39
Average standard deviation of split frequencies: 0.008673
390500 -- (-592.690) (-588.686) (-588.492) [-589.000] * [-587.842] (-588.729) (-588.818) (-590.429) -- 0:00:39
391000 -- [-588.895] (-589.267) (-592.763) (-593.821) * [-587.900] (-590.540) (-590.181) (-591.285) -- 0:00:38
391500 -- [-590.344] (-589.801) (-592.447) (-590.927) * (-589.692) (-590.010) [-588.710] (-588.502) -- 0:00:38
392000 -- [-588.638] (-591.097) (-591.833) (-591.300) * (-590.183) (-590.244) (-590.985) [-590.213] -- 0:00:38
392500 -- (-589.565) [-591.020] (-589.817) (-589.096) * (-589.325) (-590.417) [-587.975] (-590.211) -- 0:00:38
393000 -- (-588.664) (-590.379) (-588.372) [-589.577] * (-589.236) [-589.375] (-591.389) (-589.420) -- 0:00:38
393500 -- (-591.156) [-588.521] (-589.410) (-587.936) * [-587.827] (-589.149) (-589.498) (-590.997) -- 0:00:38
394000 -- [-589.770] (-588.255) (-590.594) (-592.147) * (-593.865) (-588.643) [-589.977] (-591.692) -- 0:00:38
394500 -- (-589.271) (-588.879) [-588.154] (-592.782) * [-591.234] (-589.158) (-588.539) (-587.763) -- 0:00:38
395000 -- [-589.348] (-592.809) (-589.681) (-591.646) * (-591.663) (-589.010) (-588.310) [-587.442] -- 0:00:38
Average standard deviation of split frequencies: 0.008705
395500 -- (-592.491) [-590.405] (-588.606) (-591.291) * (-591.003) (-589.698) (-588.840) [-587.334] -- 0:00:38
396000 -- (-587.848) (-590.852) (-590.886) [-591.717] * [-588.860] (-588.959) (-590.118) (-590.792) -- 0:00:38
396500 -- (-594.162) (-589.181) [-588.521] (-593.233) * (-588.724) [-589.351] (-588.358) (-588.877) -- 0:00:38
397000 -- (-592.278) (-589.715) [-589.712] (-590.960) * (-587.786) (-587.934) [-589.209] (-589.182) -- 0:00:37
397500 -- (-589.699) (-587.912) (-593.555) [-588.286] * [-590.561] (-588.694) (-590.174) (-590.209) -- 0:00:37
398000 -- [-590.794] (-589.807) (-589.744) (-590.954) * (-588.183) (-594.139) (-591.030) [-588.923] -- 0:00:37
398500 -- (-595.182) (-591.441) (-591.269) [-589.469] * (-590.789) (-589.608) (-589.588) [-588.087] -- 0:00:37
399000 -- [-590.505] (-589.179) (-588.066) (-587.413) * (-588.183) (-590.661) [-588.532] (-590.115) -- 0:00:37
399500 -- [-593.389] (-589.515) (-591.085) (-588.570) * (-593.034) (-589.380) [-589.123] (-593.060) -- 0:00:37
400000 -- (-593.739) (-590.531) [-590.190] (-590.000) * (-590.103) (-591.706) (-591.040) [-591.664] -- 0:00:37
Average standard deviation of split frequencies: 0.009559
400500 -- (-590.436) (-588.317) [-588.018] (-587.893) * (-588.888) (-593.336) (-590.802) [-590.515] -- 0:00:37
401000 -- (-587.344) (-587.776) [-588.067] (-589.567) * (-589.178) [-588.466] (-590.608) (-589.567) -- 0:00:37
401500 -- (-588.124) (-590.528) [-588.318] (-589.426) * (-587.933) (-591.056) (-587.674) [-588.291] -- 0:00:38
402000 -- (-589.631) (-589.345) [-588.143] (-590.771) * (-588.453) (-593.576) (-589.302) [-593.041] -- 0:00:38
402500 -- (-596.113) (-591.248) (-590.287) [-589.234] * (-588.582) [-589.112] (-590.259) (-589.073) -- 0:00:38
403000 -- (-594.996) (-588.495) (-587.399) [-589.298] * (-596.661) [-589.436] (-590.212) (-591.389) -- 0:00:38
403500 -- (-589.357) [-588.783] (-588.255) (-594.186) * (-590.262) (-589.377) [-588.303] (-591.987) -- 0:00:38
404000 -- (-589.369) (-587.625) [-588.156] (-595.855) * (-592.643) (-591.647) (-588.766) [-588.415] -- 0:00:38
404500 -- (-588.886) (-590.496) (-587.652) [-589.675] * [-592.143] (-591.899) (-588.215) (-589.660) -- 0:00:38
405000 -- (-588.303) (-590.893) [-588.753] (-590.566) * (-588.455) (-589.923) [-589.911] (-587.735) -- 0:00:38
Average standard deviation of split frequencies: 0.010087
405500 -- (-595.819) (-589.625) (-588.600) [-588.323] * [-588.564] (-588.261) (-593.089) (-588.491) -- 0:00:38
406000 -- (-590.316) (-592.444) (-589.517) [-590.365] * (-588.259) (-591.688) (-589.987) [-588.661] -- 0:00:38
406500 -- (-590.209) [-589.026] (-591.507) (-589.633) * [-589.317] (-588.276) (-590.070) (-590.755) -- 0:00:37
407000 -- (-590.399) (-589.054) (-587.649) [-591.403] * (-589.501) [-588.953] (-589.069) (-590.048) -- 0:00:37
407500 -- (-589.684) (-588.606) (-589.601) [-596.363] * (-587.813) (-592.523) (-588.529) [-587.945] -- 0:00:37
408000 -- (-590.142) (-589.679) [-591.709] (-593.243) * (-591.980) (-590.602) (-590.165) [-593.451] -- 0:00:37
408500 -- (-587.675) (-591.107) (-587.991) [-591.700] * (-588.961) (-588.021) [-589.017] (-587.784) -- 0:00:37
409000 -- [-589.109] (-589.749) (-588.478) (-589.614) * (-594.281) (-590.370) (-589.343) [-591.005] -- 0:00:37
409500 -- (-589.306) (-590.048) (-589.887) [-588.104] * (-589.457) (-588.976) [-587.941] (-591.826) -- 0:00:37
410000 -- [-589.893] (-589.946) (-588.849) (-588.702) * (-589.300) (-592.504) (-588.012) [-591.437] -- 0:00:37
Average standard deviation of split frequencies: 0.010690
410500 -- (-591.042) (-588.845) [-588.922] (-591.093) * (-588.229) (-589.653) (-594.700) [-590.730] -- 0:00:37
411000 -- (-591.770) [-587.956] (-588.842) (-591.444) * [-588.486] (-588.692) (-591.921) (-588.508) -- 0:00:37
411500 -- [-588.329] (-589.365) (-588.474) (-589.631) * (-589.554) [-592.027] (-589.617) (-589.978) -- 0:00:37
412000 -- (-588.647) (-593.990) [-589.902] (-587.893) * (-588.656) (-588.156) [-589.503] (-591.913) -- 0:00:37
412500 -- (-591.088) (-588.620) (-590.199) [-588.357] * (-588.267) (-588.499) (-589.498) [-594.121] -- 0:00:37
413000 -- [-589.231] (-592.238) (-590.784) (-587.910) * (-587.832) (-588.379) (-593.319) [-589.178] -- 0:00:36
413500 -- (-587.819) (-588.791) [-591.627] (-593.821) * (-589.378) (-588.182) [-588.765] (-589.158) -- 0:00:36
414000 -- (-590.559) [-588.172] (-590.083) (-591.445) * [-589.117] (-588.509) (-588.672) (-588.201) -- 0:00:36
414500 -- (-589.659) (-589.566) [-589.219] (-590.112) * [-588.679] (-593.127) (-590.343) (-587.864) -- 0:00:36
415000 -- (-591.167) [-589.463] (-590.431) (-589.786) * (-592.306) (-590.560) (-591.633) [-588.050] -- 0:00:36
Average standard deviation of split frequencies: 0.010553
415500 -- (-589.124) [-591.641] (-590.739) (-590.282) * (-587.709) (-589.147) (-590.086) [-590.736] -- 0:00:36
416000 -- [-588.406] (-588.426) (-590.342) (-591.255) * [-587.777] (-589.255) (-590.500) (-590.899) -- 0:00:36
416500 -- (-588.624) (-591.851) (-590.005) [-589.000] * (-588.375) (-588.447) (-588.793) [-593.337] -- 0:00:37
417000 -- [-588.173] (-588.041) (-592.273) (-589.481) * [-589.499] (-590.364) (-590.611) (-590.272) -- 0:00:37
417500 -- (-588.554) (-591.562) [-589.740] (-589.499) * (-587.565) [-589.050] (-589.843) (-590.132) -- 0:00:37
418000 -- (-594.313) [-592.016] (-590.683) (-591.388) * [-588.608] (-592.251) (-590.959) (-588.100) -- 0:00:37
418500 -- (-591.321) (-592.374) (-593.415) [-593.948] * (-588.544) (-596.691) [-591.468] (-589.240) -- 0:00:37
419000 -- (-594.336) [-592.819] (-588.898) (-591.589) * (-590.110) [-590.436] (-589.006) (-588.228) -- 0:00:37
419500 -- (-589.357) [-593.085] (-593.970) (-590.646) * (-588.475) [-592.785] (-590.402) (-590.332) -- 0:00:37
420000 -- [-588.385] (-591.369) (-590.933) (-590.243) * (-591.323) [-588.827] (-588.540) (-589.283) -- 0:00:37
Average standard deviation of split frequencies: 0.010226
420500 -- (-590.699) [-589.995] (-590.169) (-592.801) * (-593.868) (-591.259) [-588.714] (-591.616) -- 0:00:37
421000 -- (-588.638) (-587.787) [-593.503] (-592.647) * (-589.266) (-593.121) [-587.483] (-589.004) -- 0:00:37
421500 -- (-589.712) (-588.968) [-591.219] (-593.670) * (-588.659) [-587.878] (-590.339) (-590.118) -- 0:00:37
422000 -- (-588.911) (-590.623) (-590.303) [-593.065] * (-588.454) [-588.773] (-590.183) (-588.983) -- 0:00:36
422500 -- (-589.874) [-589.263] (-588.369) (-591.262) * (-591.037) (-595.035) [-589.071] (-593.094) -- 0:00:36
423000 -- [-587.716] (-588.891) (-588.563) (-589.061) * (-593.399) [-588.126] (-591.922) (-590.665) -- 0:00:36
423500 -- (-588.875) (-591.070) (-590.816) [-589.517] * (-588.631) [-588.236] (-588.017) (-589.973) -- 0:00:36
424000 -- (-587.783) (-588.452) [-589.651] (-588.417) * [-592.605] (-587.365) (-588.373) (-594.585) -- 0:00:36
424500 -- (-588.457) (-588.442) (-590.146) [-590.469] * (-590.070) (-592.071) (-590.224) [-591.264] -- 0:00:36
425000 -- (-588.885) [-590.425] (-592.277) (-589.446) * (-593.075) (-590.142) (-590.205) [-589.241] -- 0:00:36
Average standard deviation of split frequencies: 0.010098
425500 -- [-588.729] (-589.780) (-591.527) (-588.900) * [-589.111] (-590.639) (-591.703) (-589.711) -- 0:00:36
426000 -- (-588.396) (-588.631) (-587.227) [-589.309] * (-589.961) (-589.294) (-587.833) [-587.938] -- 0:00:36
426500 -- (-590.154) (-588.754) [-590.747] (-589.772) * (-587.923) (-590.461) (-588.255) [-589.081] -- 0:00:36
427000 -- (-589.555) (-594.290) [-591.668] (-588.946) * (-587.472) (-588.893) (-592.628) [-590.838] -- 0:00:36
427500 -- (-589.160) (-589.390) [-591.332] (-593.057) * (-587.993) (-590.055) [-593.360] (-591.641) -- 0:00:36
428000 -- (-590.615) (-589.459) (-588.946) [-589.423] * (-588.141) (-589.847) [-589.762] (-591.759) -- 0:00:36
428500 -- (-588.770) (-595.643) [-588.954] (-590.403) * (-588.100) (-588.597) (-591.515) [-589.420] -- 0:00:36
429000 -- [-590.227] (-589.696) (-588.473) (-589.247) * (-589.802) [-591.122] (-593.797) (-589.420) -- 0:00:35
429500 -- [-588.149] (-589.073) (-591.452) (-591.532) * (-593.065) (-588.663) [-588.706] (-588.205) -- 0:00:35
430000 -- (-589.123) [-590.202] (-590.577) (-594.889) * [-589.773] (-588.353) (-588.867) (-589.620) -- 0:00:35
Average standard deviation of split frequencies: 0.010330
430500 -- (-587.815) (-589.378) (-590.414) [-593.317] * (-592.758) (-590.265) (-589.454) [-589.569] -- 0:00:35
431000 -- (-589.981) [-589.677] (-593.554) (-592.538) * (-589.826) (-589.567) (-588.339) [-591.874] -- 0:00:35
431500 -- [-588.481] (-595.015) (-588.243) (-588.150) * (-591.157) (-591.944) (-588.728) [-589.600] -- 0:00:35
432000 -- (-592.306) (-588.544) [-588.733] (-587.194) * (-588.617) (-590.620) [-591.463] (-588.595) -- 0:00:35
432500 -- (-589.361) (-587.430) [-588.899] (-587.526) * (-589.650) (-592.815) (-588.684) [-592.003] -- 0:00:35
433000 -- [-588.322] (-589.886) (-591.212) (-590.555) * [-591.506] (-588.035) (-587.970) (-592.512) -- 0:00:36
433500 -- (-588.891) (-588.733) (-597.522) [-589.196] * (-588.149) (-592.485) [-589.514] (-591.839) -- 0:00:36
434000 -- (-588.117) [-588.077] (-592.061) (-588.306) * [-590.314] (-589.837) (-588.540) (-592.679) -- 0:00:36
434500 -- [-587.932] (-588.210) (-589.103) (-588.903) * (-588.535) (-590.672) [-588.357] (-588.089) -- 0:00:36
435000 -- (-589.844) (-589.354) [-588.415] (-589.243) * (-587.795) (-589.852) (-590.268) [-587.762] -- 0:00:36
Average standard deviation of split frequencies: 0.010474
435500 -- [-588.128] (-587.882) (-589.812) (-593.067) * (-587.504) (-591.632) (-589.513) [-588.324] -- 0:00:36
436000 -- (-589.504) (-589.655) [-591.635] (-590.454) * [-589.139] (-591.328) (-590.017) (-589.042) -- 0:00:36
436500 -- (-588.254) (-588.126) (-588.043) [-590.270] * (-587.791) (-592.117) [-587.308] (-588.994) -- 0:00:36
437000 -- (-591.190) [-587.900] (-588.976) (-589.196) * (-591.674) (-592.296) (-589.648) [-592.089] -- 0:00:36
437500 -- (-589.547) (-588.381) [-589.844] (-589.021) * [-591.427] (-589.834) (-592.970) (-588.530) -- 0:00:36
438000 -- (-588.663) (-588.167) [-587.700] (-587.679) * (-589.430) (-590.405) (-591.677) [-591.250] -- 0:00:35
438500 -- [-590.004] (-589.994) (-587.864) (-591.270) * (-587.358) [-590.033] (-588.902) (-592.907) -- 0:00:35
439000 -- (-590.156) (-592.255) [-589.880] (-590.776) * [-590.706] (-588.168) (-590.100) (-588.158) -- 0:00:35
439500 -- [-589.724] (-588.577) (-588.279) (-590.320) * [-590.840] (-588.199) (-590.061) (-589.644) -- 0:00:35
440000 -- [-588.861] (-590.506) (-587.969) (-589.736) * (-589.121) (-589.220) (-588.471) [-590.342] -- 0:00:35
Average standard deviation of split frequencies: 0.010363
440500 -- (-588.344) (-590.127) [-589.973] (-591.527) * (-587.769) (-589.924) (-588.383) [-588.385] -- 0:00:35
441000 -- (-588.701) (-592.280) [-589.302] (-591.386) * (-587.774) (-588.806) [-589.981] (-590.133) -- 0:00:35
441500 -- [-589.257] (-589.525) (-591.374) (-588.870) * (-589.376) (-590.785) [-587.789] (-594.052) -- 0:00:35
442000 -- (-590.181) [-590.810] (-588.178) (-589.487) * (-591.284) [-589.939] (-588.440) (-591.353) -- 0:00:35
442500 -- (-594.736) (-590.815) [-589.670] (-589.567) * [-589.175] (-589.980) (-588.936) (-588.169) -- 0:00:35
443000 -- (-592.279) (-597.787) (-589.167) [-591.777] * [-590.012] (-592.623) (-587.397) (-588.249) -- 0:00:35
443500 -- [-588.655] (-591.167) (-590.626) (-591.074) * (-592.067) (-592.034) (-588.221) [-588.789] -- 0:00:35
444000 -- [-589.138] (-588.935) (-590.182) (-590.644) * (-587.699) [-590.187] (-587.759) (-587.783) -- 0:00:35
444500 -- [-588.987] (-589.187) (-588.432) (-592.142) * (-591.769) (-588.596) (-590.057) [-589.203] -- 0:00:34
445000 -- (-592.190) [-588.305] (-590.318) (-593.703) * (-589.226) [-588.333] (-595.420) (-589.118) -- 0:00:34
Average standard deviation of split frequencies: 0.010900
445500 -- (-591.006) (-590.812) [-590.493] (-593.079) * [-591.577] (-589.751) (-591.831) (-590.341) -- 0:00:34
446000 -- (-590.705) [-589.896] (-588.257) (-588.250) * [-588.640] (-588.426) (-587.737) (-590.610) -- 0:00:34
446500 -- [-590.595] (-588.889) (-589.374) (-590.770) * (-588.986) (-589.442) [-589.960] (-589.977) -- 0:00:34
447000 -- (-590.457) (-589.739) [-590.991] (-593.066) * [-589.407] (-588.038) (-587.924) (-592.486) -- 0:00:34
447500 -- (-589.224) (-589.098) (-589.997) [-590.390] * (-589.608) (-591.974) [-587.638] (-588.688) -- 0:00:34
448000 -- [-588.630] (-591.992) (-588.323) (-592.762) * (-591.685) [-588.341] (-589.515) (-589.233) -- 0:00:34
448500 -- (-590.049) (-598.328) [-588.150] (-587.880) * [-592.927] (-587.639) (-591.299) (-588.368) -- 0:00:34
449000 -- (-590.463) (-589.475) (-591.325) [-588.952] * (-589.281) (-588.074) [-587.845] (-589.218) -- 0:00:34
449500 -- (-588.585) [-589.175] (-592.807) (-589.774) * (-590.272) (-588.357) (-589.901) [-589.901] -- 0:00:34
450000 -- (-591.536) (-587.777) [-590.426] (-590.423) * (-591.178) (-588.018) (-587.729) [-588.511] -- 0:00:35
Average standard deviation of split frequencies: 0.010918
450500 -- (-592.538) [-589.245] (-589.899) (-591.562) * (-590.902) (-588.411) [-589.521] (-590.537) -- 0:00:35
451000 -- [-589.099] (-590.005) (-589.000) (-587.840) * (-588.357) (-587.857) (-590.193) [-588.720] -- 0:00:35
451500 -- (-590.796) [-590.548] (-588.471) (-588.726) * (-592.142) (-588.553) (-589.247) [-588.169] -- 0:00:35
452000 -- (-591.235) (-589.879) (-587.480) [-588.702] * (-590.041) (-588.991) [-587.399] (-589.243) -- 0:00:35
452500 -- (-591.936) (-590.674) (-587.635) [-590.518] * (-591.437) (-588.335) [-593.515] (-588.889) -- 0:00:35
453000 -- (-589.476) [-588.654] (-587.476) (-588.674) * (-589.216) (-591.882) [-589.315] (-589.111) -- 0:00:35
453500 -- (-588.850) (-588.728) [-588.836] (-589.897) * (-589.772) (-595.055) [-590.082] (-591.062) -- 0:00:34
454000 -- (-588.931) (-591.346) [-590.656] (-591.614) * (-593.974) (-592.020) [-588.617] (-590.933) -- 0:00:34
454500 -- (-589.231) (-593.002) [-589.399] (-592.190) * (-592.787) (-593.164) [-588.144] (-587.819) -- 0:00:34
455000 -- (-589.476) [-590.289] (-588.612) (-589.286) * (-588.096) (-589.379) [-589.699] (-593.730) -- 0:00:34
Average standard deviation of split frequencies: 0.010919
455500 -- (-595.053) [-592.185] (-594.687) (-592.734) * (-588.377) (-590.332) (-591.046) [-595.209] -- 0:00:34
456000 -- [-594.320] (-588.771) (-591.917) (-588.955) * (-591.309) (-589.903) [-590.770] (-590.023) -- 0:00:34
456500 -- (-589.129) [-589.079] (-595.743) (-589.994) * (-589.291) (-594.051) (-588.180) [-589.125] -- 0:00:34
457000 -- (-588.667) (-591.040) (-591.310) [-588.296] * (-588.191) (-589.566) (-588.023) [-589.535] -- 0:00:34
457500 -- (-588.871) [-587.760] (-591.121) (-587.743) * (-588.368) (-589.987) [-591.575] (-590.157) -- 0:00:34
458000 -- (-590.881) (-590.428) (-590.723) [-588.059] * (-588.916) (-588.426) (-590.342) [-588.333] -- 0:00:34
458500 -- (-590.219) (-589.684) (-590.987) [-589.760] * (-589.658) (-591.142) [-590.994] (-588.161) -- 0:00:34
459000 -- (-591.523) (-588.372) [-591.755] (-589.335) * (-590.400) (-590.809) (-591.458) [-589.058] -- 0:00:34
459500 -- (-589.214) [-588.071] (-590.917) (-588.992) * [-587.732] (-589.906) (-587.868) (-589.113) -- 0:00:34
460000 -- [-589.635] (-587.920) (-591.749) (-587.710) * (-594.694) (-596.426) (-591.188) [-587.691] -- 0:00:34
Average standard deviation of split frequencies: 0.010553
460500 -- (-590.131) [-590.149] (-593.210) (-588.445) * (-588.158) (-595.512) (-590.257) [-592.456] -- 0:00:33
461000 -- (-588.820) [-588.852] (-589.289) (-587.871) * (-589.046) (-592.645) [-594.012] (-589.611) -- 0:00:33
461500 -- (-588.167) (-592.369) [-592.154] (-588.050) * [-588.241] (-591.005) (-588.775) (-589.211) -- 0:00:33
462000 -- [-591.342] (-590.454) (-589.840) (-588.305) * (-588.144) [-588.379] (-589.225) (-589.433) -- 0:00:33
462500 -- (-588.955) (-588.141) [-588.102] (-588.346) * [-588.732] (-587.869) (-587.965) (-591.075) -- 0:00:33
463000 -- (-589.365) [-587.671] (-591.487) (-589.842) * (-590.029) [-588.809] (-590.596) (-588.643) -- 0:00:33
463500 -- (-591.974) (-587.410) (-591.386) [-589.622] * [-589.864] (-588.285) (-589.283) (-591.911) -- 0:00:33
464000 -- [-587.759] (-593.103) (-591.290) (-590.188) * (-588.508) (-589.000) (-588.977) [-591.315] -- 0:00:33
464500 -- (-589.311) (-588.938) [-590.377] (-588.995) * (-588.068) [-590.204] (-589.871) (-590.038) -- 0:00:34
465000 -- (-596.094) (-591.889) [-590.881] (-593.294) * (-591.903) [-590.205] (-589.662) (-590.296) -- 0:00:34
Average standard deviation of split frequencies: 0.010748
465500 -- (-591.485) [-588.193] (-595.052) (-588.112) * (-591.142) (-588.662) [-592.624] (-591.621) -- 0:00:34
466000 -- (-593.877) [-589.045] (-592.024) (-590.934) * [-592.201] (-591.199) (-591.506) (-588.960) -- 0:00:34
466500 -- (-589.476) (-590.229) [-592.063] (-593.077) * (-589.188) (-592.360) (-588.739) [-588.182] -- 0:00:34
467000 -- [-590.454] (-587.648) (-588.164) (-594.816) * (-587.437) (-589.691) (-588.849) [-588.334] -- 0:00:34
467500 -- (-588.839) [-590.178] (-589.399) (-592.164) * (-591.058) [-588.975] (-588.720) (-588.584) -- 0:00:34
468000 -- (-588.434) (-589.119) [-589.704] (-588.987) * (-593.132) (-589.943) (-590.219) [-590.081] -- 0:00:34
468500 -- (-590.581) (-589.566) (-588.792) [-588.198] * (-589.135) (-588.234) (-592.419) [-588.499] -- 0:00:34
469000 -- (-588.694) [-587.596] (-589.767) (-589.804) * (-587.733) (-589.487) (-588.961) [-587.941] -- 0:00:33
469500 -- (-587.899) [-588.710] (-587.781) (-590.285) * (-588.190) [-588.322] (-589.529) (-588.641) -- 0:00:33
470000 -- (-590.066) (-588.194) [-587.293] (-588.843) * [-588.690] (-588.073) (-592.693) (-590.428) -- 0:00:33
Average standard deviation of split frequencies: 0.010516
470500 -- (-588.599) [-589.704] (-591.425) (-589.582) * [-589.876] (-588.178) (-590.676) (-590.337) -- 0:00:33
471000 -- [-590.740] (-591.159) (-590.660) (-588.972) * (-587.689) [-588.088] (-592.532) (-588.557) -- 0:00:33
471500 -- [-590.349] (-590.328) (-588.191) (-591.329) * [-590.480] (-588.660) (-588.700) (-588.948) -- 0:00:33
472000 -- (-591.714) (-590.780) (-590.246) [-588.192] * [-588.847] (-592.441) (-591.915) (-589.732) -- 0:00:33
472500 -- (-592.090) (-588.799) (-588.406) [-590.525] * [-588.207] (-590.552) (-588.955) (-590.325) -- 0:00:33
473000 -- (-588.870) (-587.780) (-589.846) [-588.220] * (-589.142) (-595.979) [-588.594] (-592.585) -- 0:00:33
473500 -- (-591.000) (-591.395) (-589.421) [-590.385] * (-588.599) (-589.021) [-587.832] (-589.715) -- 0:00:33
474000 -- (-591.912) [-591.195] (-590.762) (-588.419) * (-591.661) (-588.627) [-588.896] (-595.092) -- 0:00:33
474500 -- [-590.129] (-588.686) (-588.567) (-590.662) * (-592.231) (-590.841) [-588.451] (-590.578) -- 0:00:33
475000 -- [-589.052] (-588.995) (-589.970) (-589.650) * [-590.971] (-590.935) (-588.274) (-590.262) -- 0:00:33
Average standard deviation of split frequencies: 0.010461
475500 -- (-591.553) [-590.323] (-588.151) (-588.479) * (-589.234) (-590.033) (-590.057) [-588.096] -- 0:00:33
476000 -- (-588.868) (-587.617) (-589.162) [-588.770] * (-588.497) [-587.940] (-591.452) (-588.487) -- 0:00:33
476500 -- (-587.549) [-587.690] (-589.728) (-589.460) * (-588.908) [-591.804] (-590.755) (-588.171) -- 0:00:32
477000 -- (-589.967) (-594.186) (-589.384) [-589.253] * (-590.654) (-596.601) (-589.119) [-589.485] -- 0:00:32
477500 -- (-589.254) (-591.636) (-591.009) [-588.934] * (-588.751) (-590.772) [-588.851] (-590.712) -- 0:00:32
478000 -- (-588.124) (-588.679) (-592.337) [-588.346] * (-588.360) [-588.737] (-590.146) (-589.604) -- 0:00:32
478500 -- (-588.312) (-588.490) [-588.663] (-588.282) * [-588.625] (-588.344) (-589.818) (-588.452) -- 0:00:32
479000 -- (-596.004) [-587.527] (-589.815) (-588.567) * (-588.330) (-591.568) [-590.717] (-587.495) -- 0:00:32
479500 -- (-593.576) (-590.557) (-587.884) [-590.608] * (-589.739) [-589.805] (-593.359) (-589.092) -- 0:00:32
480000 -- [-588.143] (-589.686) (-588.892) (-590.596) * (-588.045) (-589.479) [-589.158] (-590.640) -- 0:00:32
Average standard deviation of split frequencies: 0.010482
480500 -- [-588.769] (-589.769) (-593.361) (-589.094) * (-589.992) [-588.934] (-588.770) (-589.170) -- 0:00:32
481000 -- [-590.008] (-595.274) (-591.078) (-589.024) * (-588.747) [-590.633] (-588.434) (-593.412) -- 0:00:33
481500 -- (-589.176) (-588.937) (-593.244) [-588.028] * (-596.774) (-589.057) (-590.147) [-591.340] -- 0:00:33
482000 -- (-589.018) [-592.271] (-591.796) (-590.073) * (-591.459) (-595.966) [-592.171] (-592.278) -- 0:00:33
482500 -- (-588.674) (-593.914) (-593.250) [-588.059] * (-589.242) [-588.262] (-588.923) (-590.237) -- 0:00:33
483000 -- [-592.982] (-589.541) (-589.130) (-588.996) * [-589.141] (-594.581) (-589.428) (-589.573) -- 0:00:33
483500 -- (-590.365) (-590.315) (-588.941) [-589.907] * [-591.284] (-594.380) (-590.196) (-587.302) -- 0:00:33
484000 -- [-589.133] (-592.052) (-589.127) (-590.927) * [-588.398] (-592.607) (-588.736) (-588.640) -- 0:00:33
484500 -- (-589.716) (-589.007) [-589.039] (-587.908) * (-592.468) (-588.694) (-588.980) [-588.141] -- 0:00:32
485000 -- (-590.244) [-589.971] (-591.546) (-590.190) * (-589.812) (-589.733) (-589.840) [-588.505] -- 0:00:32
Average standard deviation of split frequencies: 0.011276
485500 -- (-592.121) [-588.718] (-591.245) (-589.550) * (-590.552) (-590.441) [-588.728] (-587.629) -- 0:00:32
486000 -- (-589.288) (-594.350) (-589.603) [-590.733] * (-590.313) (-591.583) (-591.730) [-587.654] -- 0:00:32
486500 -- (-591.169) (-588.482) (-588.899) [-591.492] * (-590.588) (-588.724) (-590.067) [-588.599] -- 0:00:32
487000 -- (-591.326) [-591.296] (-588.510) (-589.764) * [-591.544] (-587.513) (-589.928) (-587.399) -- 0:00:32
487500 -- (-591.257) [-587.444] (-589.983) (-587.870) * (-589.142) (-591.448) [-592.056] (-587.657) -- 0:00:32
488000 -- (-588.467) (-590.286) [-589.861] (-590.124) * (-589.709) (-589.592) [-589.886] (-587.871) -- 0:00:32
488500 -- (-588.538) (-587.956) [-589.177] (-589.109) * [-590.810] (-592.279) (-592.369) (-592.159) -- 0:00:32
489000 -- (-589.169) [-587.577] (-591.818) (-591.821) * (-591.689) (-591.545) [-589.737] (-587.734) -- 0:00:32
489500 -- (-588.319) [-587.897] (-590.719) (-587.891) * (-590.421) [-588.472] (-588.440) (-588.311) -- 0:00:32
490000 -- (-588.125) [-589.915] (-594.926) (-588.051) * (-587.963) [-588.907] (-591.102) (-591.463) -- 0:00:32
Average standard deviation of split frequencies: 0.011589
490500 -- [-588.063] (-589.895) (-589.020) (-588.522) * (-587.651) [-590.277] (-589.446) (-591.890) -- 0:00:32
491000 -- (-590.692) (-589.937) (-588.340) [-591.434] * (-589.247) [-590.812] (-591.328) (-588.169) -- 0:00:32
491500 -- (-588.525) [-590.306] (-590.634) (-588.592) * (-591.353) [-588.954] (-592.770) (-589.823) -- 0:00:32
492000 -- (-589.426) (-589.030) [-593.445] (-592.742) * (-589.229) (-591.537) (-590.087) [-591.876] -- 0:00:32
492500 -- (-587.819) (-590.772) [-590.443] (-592.779) * [-595.972] (-590.046) (-589.003) (-590.765) -- 0:00:31
493000 -- [-588.986] (-589.351) (-589.754) (-588.135) * [-589.265] (-589.840) (-591.676) (-590.123) -- 0:00:31
493500 -- (-588.630) (-589.392) (-589.477) [-594.158] * (-588.527) (-589.608) [-590.686] (-595.316) -- 0:00:31
494000 -- [-589.788] (-589.700) (-593.526) (-590.111) * [-588.732] (-590.813) (-588.485) (-589.015) -- 0:00:31
494500 -- (-592.114) (-589.772) (-589.765) [-590.297] * (-591.882) (-592.850) (-589.272) [-590.589] -- 0:00:31
495000 -- (-589.602) [-591.718] (-589.660) (-590.709) * (-590.188) [-589.449] (-590.060) (-589.141) -- 0:00:31
Average standard deviation of split frequencies: 0.011583
495500 -- (-593.909) [-588.265] (-591.244) (-587.794) * [-589.575] (-589.187) (-594.766) (-589.498) -- 0:00:31
496000 -- (-592.586) (-589.100) (-588.728) [-587.744] * [-589.730] (-588.175) (-591.540) (-588.444) -- 0:00:31
496500 -- (-589.330) (-589.927) (-590.471) [-590.119] * (-587.458) [-588.967] (-587.384) (-590.642) -- 0:00:31
497000 -- [-589.239] (-592.488) (-587.964) (-589.934) * (-590.536) [-588.259] (-591.813) (-589.765) -- 0:00:31
497500 -- (-587.523) (-591.965) (-591.594) [-590.077] * (-587.806) (-589.840) (-589.781) [-593.495] -- 0:00:31
498000 -- (-588.023) (-593.193) [-587.899] (-594.941) * (-588.705) [-593.158] (-591.077) (-592.481) -- 0:00:32
498500 -- (-590.024) (-589.593) (-588.974) [-590.262] * [-588.811] (-592.716) (-592.438) (-590.348) -- 0:00:32
499000 -- (-591.546) (-589.495) [-590.539] (-589.267) * (-590.530) [-590.137] (-594.239) (-588.305) -- 0:00:32
499500 -- (-591.038) [-589.589] (-589.758) (-591.704) * (-593.644) (-589.303) [-589.126] (-592.113) -- 0:00:32
500000 -- (-590.574) (-588.898) (-593.109) [-588.494] * (-589.298) (-591.181) [-589.427] (-591.169) -- 0:00:32
Average standard deviation of split frequencies: 0.011652
500500 -- [-590.095] (-587.877) (-590.379) (-590.668) * (-592.286) (-592.973) (-590.204) [-593.905] -- 0:00:31
501000 -- (-588.367) [-590.839] (-595.643) (-589.748) * (-591.101) (-590.175) (-593.338) [-588.468] -- 0:00:31
501500 -- (-588.472) [-589.387] (-595.455) (-592.946) * (-589.312) (-588.813) (-587.948) [-588.645] -- 0:00:31
502000 -- (-588.799) (-593.048) [-588.373] (-590.752) * (-589.022) (-592.160) (-590.915) [-590.120] -- 0:00:31
502500 -- (-588.392) (-587.594) [-588.804] (-591.757) * (-589.479) (-593.087) (-588.205) [-589.623] -- 0:00:31
503000 -- (-588.569) (-591.761) [-588.696] (-591.990) * [-593.160] (-588.217) (-588.437) (-587.559) -- 0:00:31
503500 -- (-590.330) (-590.918) [-593.210] (-589.053) * (-588.171) (-589.612) [-589.226] (-589.497) -- 0:00:31
504000 -- (-589.249) [-591.976] (-588.335) (-589.568) * [-589.388] (-588.899) (-589.014) (-591.730) -- 0:00:31
504500 -- (-592.493) (-589.975) (-589.383) [-588.293] * [-590.153] (-588.992) (-589.223) (-589.228) -- 0:00:31
505000 -- (-589.027) [-591.292] (-590.991) (-589.632) * (-589.737) (-590.120) [-591.572] (-588.991) -- 0:00:31
Average standard deviation of split frequencies: 0.011354
505500 -- (-588.271) (-590.378) (-590.643) [-589.315] * (-591.209) (-590.413) [-588.439] (-589.050) -- 0:00:31
506000 -- (-587.967) [-588.653] (-590.001) (-589.173) * (-589.871) [-588.046] (-588.324) (-588.321) -- 0:00:31
506500 -- (-588.338) (-588.783) [-587.727] (-588.559) * (-589.399) [-588.240] (-589.012) (-589.076) -- 0:00:31
507000 -- (-591.774) (-591.083) [-588.369] (-591.476) * (-589.396) (-590.403) (-590.209) [-591.033] -- 0:00:31
507500 -- [-589.373] (-589.502) (-589.780) (-589.020) * [-588.212] (-587.870) (-592.095) (-588.577) -- 0:00:31
508000 -- (-591.040) (-590.218) [-588.264] (-589.725) * (-588.691) [-588.533] (-588.925) (-589.934) -- 0:00:30
508500 -- (-589.893) (-593.458) [-588.813] (-587.705) * [-588.793] (-588.457) (-592.929) (-592.644) -- 0:00:30
509000 -- (-589.210) [-590.475] (-588.114) (-592.148) * [-590.202] (-587.735) (-590.006) (-591.230) -- 0:00:30
509500 -- (-589.118) (-590.029) (-591.703) [-589.315] * (-591.029) [-589.258] (-592.993) (-589.359) -- 0:00:30
510000 -- (-590.679) (-590.796) (-593.031) [-590.058] * (-590.974) (-588.827) (-591.849) [-587.814] -- 0:00:30
Average standard deviation of split frequencies: 0.011077
510500 -- [-589.073] (-589.911) (-589.591) (-593.727) * (-590.280) (-589.173) (-592.238) [-590.223] -- 0:00:30
511000 -- (-588.375) [-590.786] (-587.844) (-588.015) * (-592.146) (-589.631) (-588.867) [-590.850] -- 0:00:30
511500 -- (-587.903) [-587.640] (-587.998) (-589.231) * [-590.759] (-588.230) (-589.344) (-589.531) -- 0:00:30
512000 -- (-594.710) (-589.413) (-589.780) [-590.983] * (-590.130) (-587.868) (-591.334) [-588.817] -- 0:00:30
512500 -- (-588.720) (-589.375) [-592.569] (-593.026) * [-589.102] (-591.480) (-589.198) (-591.086) -- 0:00:30
513000 -- (-591.006) (-588.543) (-591.597) [-588.141] * (-588.545) (-588.523) (-598.129) [-591.107] -- 0:00:30
513500 -- (-588.517) (-589.682) (-589.960) [-592.384] * (-589.702) (-587.627) [-593.809] (-589.437) -- 0:00:30
514000 -- (-587.590) (-589.624) [-590.519] (-589.475) * [-590.016] (-592.712) (-588.029) (-589.612) -- 0:00:30
514500 -- (-588.095) (-591.691) [-588.204] (-589.580) * [-588.831] (-588.397) (-589.294) (-587.962) -- 0:00:30
515000 -- [-588.424] (-592.604) (-589.039) (-587.888) * (-591.337) (-589.208) (-588.467) [-589.761] -- 0:00:31
Average standard deviation of split frequencies: 0.010735
515500 -- (-590.598) (-591.311) [-589.571] (-592.206) * [-588.998] (-588.735) (-587.919) (-591.026) -- 0:00:31
516000 -- (-590.992) [-588.950] (-590.434) (-592.795) * [-589.013] (-587.840) (-590.922) (-588.682) -- 0:00:30
516500 -- (-589.118) (-590.139) (-591.482) [-590.884] * (-588.981) (-589.643) [-589.230] (-591.190) -- 0:00:30
517000 -- (-592.965) (-592.804) (-589.454) [-587.939] * (-589.541) (-590.179) (-589.455) [-588.273] -- 0:00:30
517500 -- (-592.575) (-589.537) (-589.780) [-588.086] * (-589.651) [-595.096] (-589.132) (-589.070) -- 0:00:30
518000 -- (-590.853) (-588.866) [-596.730] (-590.955) * (-588.285) (-598.163) [-590.489] (-589.655) -- 0:00:30
518500 -- (-590.341) (-588.266) (-591.900) [-590.177] * [-588.211] (-595.587) (-589.930) (-589.042) -- 0:00:30
519000 -- [-594.165] (-589.657) (-591.096) (-589.856) * (-590.445) (-592.285) [-588.352] (-589.593) -- 0:00:30
519500 -- (-590.068) (-588.188) [-588.353] (-590.037) * [-590.708] (-590.763) (-589.786) (-587.867) -- 0:00:30
520000 -- (-589.918) [-587.824] (-588.310) (-589.631) * [-589.676] (-589.857) (-590.408) (-589.129) -- 0:00:30
Average standard deviation of split frequencies: 0.010525
520500 -- [-595.732] (-589.429) (-588.923) (-589.564) * (-590.163) (-587.612) [-589.115] (-590.192) -- 0:00:30
521000 -- [-589.522] (-588.279) (-588.208) (-588.014) * (-589.838) (-589.547) (-590.598) [-588.659] -- 0:00:30
521500 -- (-589.878) (-588.519) [-591.697] (-587.865) * (-589.654) (-591.447) [-587.581] (-590.653) -- 0:00:30
522000 -- (-590.001) (-587.588) [-589.523] (-589.709) * [-589.872] (-592.517) (-589.389) (-591.953) -- 0:00:30
522500 -- (-587.866) [-588.201] (-590.068) (-591.767) * [-588.176] (-588.573) (-591.628) (-594.525) -- 0:00:30
523000 -- (-588.570) [-587.870] (-589.558) (-591.276) * (-590.781) [-590.016] (-594.115) (-588.441) -- 0:00:30
523500 -- (-589.442) [-588.342] (-590.723) (-589.647) * (-589.248) (-588.585) (-588.826) [-589.353] -- 0:00:30
524000 -- [-593.163] (-588.647) (-588.737) (-592.744) * [-593.090] (-591.917) (-588.359) (-589.300) -- 0:00:29
524500 -- (-589.927) (-590.560) (-589.013) [-590.381] * [-587.823] (-592.322) (-589.549) (-589.268) -- 0:00:29
525000 -- (-593.980) (-591.092) (-589.521) [-587.690] * [-592.169] (-588.814) (-588.427) (-590.066) -- 0:00:29
Average standard deviation of split frequencies: 0.010250
525500 -- (-593.007) [-590.963] (-591.144) (-588.192) * (-588.323) [-588.839] (-589.164) (-587.557) -- 0:00:29
526000 -- (-589.367) [-589.543] (-588.339) (-589.119) * (-589.844) [-592.230] (-589.232) (-592.079) -- 0:00:29
526500 -- (-589.536) [-589.757] (-590.376) (-590.332) * (-589.470) (-591.471) [-588.843] (-591.634) -- 0:00:29
527000 -- [-590.143] (-588.655) (-590.497) (-588.568) * [-590.559] (-591.843) (-588.898) (-589.194) -- 0:00:29
527500 -- [-589.297] (-590.762) (-590.693) (-588.262) * (-593.458) (-588.193) (-590.426) [-588.771] -- 0:00:29
528000 -- [-588.662] (-588.563) (-591.305) (-590.382) * (-589.187) (-587.544) [-588.764] (-589.463) -- 0:00:29
528500 -- [-590.369] (-588.033) (-587.378) (-590.940) * (-588.603) (-589.791) [-588.636] (-591.501) -- 0:00:29
529000 -- [-587.916] (-587.369) (-589.535) (-588.949) * (-589.940) (-590.670) (-587.497) [-589.540] -- 0:00:29
529500 -- (-588.858) (-589.469) [-588.827] (-589.310) * (-588.648) (-594.315) (-587.968) [-587.674] -- 0:00:29
530000 -- [-589.791] (-590.890) (-590.012) (-592.501) * [-587.888] (-590.906) (-589.819) (-591.230) -- 0:00:29
Average standard deviation of split frequencies: 0.009994
530500 -- (-589.474) (-589.293) [-589.257] (-592.716) * (-589.146) (-590.187) [-588.573] (-592.153) -- 0:00:29
531000 -- (-590.074) [-587.851] (-588.808) (-589.548) * (-592.362) (-592.859) [-591.305] (-589.965) -- 0:00:29
531500 -- (-589.556) [-589.135] (-590.449) (-592.343) * [-590.758] (-590.440) (-591.232) (-588.143) -- 0:00:29
532000 -- (-588.053) (-591.294) (-589.360) [-589.454] * (-589.535) (-590.913) [-590.759] (-589.490) -- 0:00:29
532500 -- (-588.062) (-591.220) [-589.941] (-589.032) * (-588.895) [-590.709] (-589.874) (-590.296) -- 0:00:29
533000 -- [-587.917] (-590.068) (-587.426) (-588.008) * (-591.057) (-590.216) [-592.273] (-589.526) -- 0:00:29
533500 -- (-589.417) (-589.019) [-587.678] (-591.138) * (-588.260) (-588.546) [-590.261] (-591.716) -- 0:00:29
534000 -- [-590.712] (-588.936) (-588.543) (-588.709) * [-588.293] (-593.710) (-587.387) (-591.318) -- 0:00:29
534500 -- [-588.695] (-590.343) (-588.441) (-588.182) * (-591.337) (-588.101) (-592.497) [-588.939] -- 0:00:29
535000 -- (-589.543) [-591.302] (-589.855) (-591.612) * [-590.232] (-588.097) (-591.276) (-590.100) -- 0:00:29
Average standard deviation of split frequencies: 0.010499
535500 -- [-589.419] (-594.700) (-589.409) (-588.943) * (-590.598) [-589.986] (-591.380) (-588.631) -- 0:00:29
536000 -- (-591.262) (-589.095) (-588.779) [-587.475] * [-590.198] (-588.404) (-593.571) (-589.592) -- 0:00:29
536500 -- [-591.428] (-590.692) (-588.793) (-588.993) * (-588.160) (-588.883) (-590.342) [-589.537] -- 0:00:29
537000 -- (-588.008) (-587.983) (-589.451) [-591.605] * (-589.659) [-589.777] (-588.824) (-591.437) -- 0:00:29
537500 -- (-591.808) (-592.581) (-589.757) [-590.334] * [-588.822] (-587.992) (-591.443) (-594.304) -- 0:00:29
538000 -- [-588.445] (-593.491) (-588.022) (-590.146) * [-590.100] (-588.636) (-588.956) (-589.087) -- 0:00:29
538500 -- (-588.756) [-589.776] (-589.793) (-590.612) * (-588.069) (-588.408) [-587.462] (-588.303) -- 0:00:29
539000 -- (-590.287) (-591.057) (-590.134) [-587.694] * (-587.292) (-593.984) [-587.942] (-587.762) -- 0:00:29
539500 -- (-592.322) (-590.095) (-589.700) [-588.840] * (-589.485) (-598.783) (-589.040) [-590.332] -- 0:00:29
540000 -- (-588.664) (-589.971) (-589.326) [-592.068] * [-591.310] (-590.588) (-591.470) (-588.782) -- 0:00:28
Average standard deviation of split frequencies: 0.010354
540500 -- (-590.007) [-590.370] (-588.325) (-589.593) * (-588.804) (-591.082) (-592.501) [-589.317] -- 0:00:28
541000 -- (-589.648) (-589.350) (-589.835) [-593.791] * [-588.380] (-589.620) (-590.033) (-590.279) -- 0:00:28
541500 -- (-589.226) (-593.771) (-589.291) [-591.208] * [-587.340] (-589.642) (-588.361) (-589.329) -- 0:00:28
542000 -- (-589.791) (-590.469) (-589.114) [-595.248] * (-587.448) (-587.983) (-587.890) [-587.580] -- 0:00:28
542500 -- [-588.506] (-587.341) (-588.330) (-594.571) * (-589.082) (-589.965) (-588.985) [-587.845] -- 0:00:28
543000 -- (-593.097) [-587.430] (-588.179) (-590.746) * [-588.687] (-587.921) (-589.376) (-589.773) -- 0:00:28
543500 -- (-590.034) (-587.911) (-588.200) [-589.887] * (-588.459) [-588.495] (-594.196) (-590.592) -- 0:00:28
544000 -- (-590.749) [-589.788] (-589.927) (-590.044) * (-587.927) (-588.680) [-590.275] (-590.356) -- 0:00:28
544500 -- (-587.517) (-591.999) (-596.768) [-589.248] * (-588.803) (-592.802) [-589.448] (-589.139) -- 0:00:28
545000 -- [-588.539] (-590.794) (-590.944) (-592.662) * (-587.980) [-589.708] (-591.258) (-590.248) -- 0:00:28
Average standard deviation of split frequencies: 0.010415
545500 -- [-588.831] (-587.378) (-590.897) (-591.248) * (-589.087) (-590.413) (-589.756) [-588.463] -- 0:00:28
546000 -- (-588.145) (-589.730) [-589.088] (-587.632) * (-590.568) (-590.874) [-589.995] (-588.501) -- 0:00:28
546500 -- (-588.535) (-589.210) [-589.576] (-587.719) * (-590.824) [-589.262] (-588.902) (-590.062) -- 0:00:28
547000 -- (-590.696) [-588.240] (-589.805) (-589.442) * (-589.257) [-589.594] (-589.368) (-590.997) -- 0:00:28
547500 -- (-592.658) (-587.969) [-588.192] (-587.614) * (-590.102) (-588.223) [-589.746] (-589.539) -- 0:00:28
548000 -- (-588.629) (-591.145) [-588.896] (-589.066) * (-588.173) [-589.634] (-589.936) (-587.510) -- 0:00:28
548500 -- (-589.107) (-590.003) (-587.937) [-589.231] * (-589.132) (-591.182) [-591.775] (-589.239) -- 0:00:28
549000 -- (-592.113) [-589.250] (-589.455) (-587.894) * (-591.048) (-591.528) [-588.561] (-591.728) -- 0:00:28
549500 -- (-588.834) (-589.863) (-592.438) [-587.722] * (-588.889) (-590.330) [-587.925] (-589.567) -- 0:00:28
550000 -- (-589.930) (-591.389) [-588.999] (-590.604) * (-590.987) [-590.265] (-587.980) (-587.867) -- 0:00:28
Average standard deviation of split frequencies: 0.009524
550500 -- [-590.323] (-590.532) (-589.996) (-593.624) * (-593.408) (-590.258) (-588.305) [-587.884] -- 0:00:28
551000 -- (-591.654) (-588.504) [-590.397] (-587.187) * (-588.861) [-590.116] (-589.040) (-589.080) -- 0:00:28
551500 -- [-588.596] (-587.984) (-597.404) (-589.735) * (-588.990) (-589.007) [-588.142] (-589.731) -- 0:00:28
552000 -- (-590.612) (-588.083) [-589.906] (-589.509) * (-589.619) [-588.567] (-587.456) (-590.957) -- 0:00:28
552500 -- (-591.886) (-587.712) (-589.174) [-587.838] * (-590.301) (-593.742) (-587.446) [-590.039] -- 0:00:28
553000 -- (-591.333) (-590.540) (-595.392) [-589.417] * (-588.642) [-591.428] (-590.822) (-589.730) -- 0:00:28
553500 -- (-594.135) [-589.159] (-590.519) (-589.378) * (-590.410) (-590.777) (-592.112) [-589.216] -- 0:00:28
554000 -- (-590.734) [-588.806] (-588.857) (-588.166) * (-591.724) [-592.623] (-591.029) (-588.040) -- 0:00:28
554500 -- (-587.613) (-592.055) (-592.871) [-587.957] * (-589.420) (-594.997) [-592.706] (-587.990) -- 0:00:28
555000 -- (-590.215) [-590.541] (-589.790) (-590.147) * (-587.810) (-591.426) (-591.209) [-588.203] -- 0:00:28
Average standard deviation of split frequencies: 0.009220
555500 -- (-589.196) (-593.113) [-590.300] (-589.336) * (-592.960) (-588.943) [-590.716] (-588.218) -- 0:00:28
556000 -- (-589.024) (-591.291) (-589.656) [-588.620] * (-592.213) (-590.349) [-588.223] (-587.675) -- 0:00:27
556500 -- [-587.968] (-589.937) (-587.435) (-592.815) * (-589.069) [-590.827] (-587.692) (-587.390) -- 0:00:27
557000 -- (-591.997) (-589.844) [-588.079] (-595.062) * (-588.790) (-592.623) [-587.721] (-587.359) -- 0:00:27
557500 -- (-589.110) [-588.948] (-590.186) (-590.155) * (-587.886) (-589.332) [-587.924] (-588.831) -- 0:00:27
558000 -- (-592.779) [-587.733] (-593.081) (-592.727) * [-590.302] (-587.691) (-589.084) (-589.478) -- 0:00:27
558500 -- (-588.831) (-595.195) [-590.228] (-589.680) * (-588.902) [-587.855] (-592.052) (-590.029) -- 0:00:27
559000 -- (-588.670) (-590.895) (-588.044) [-588.815] * [-590.903] (-587.983) (-591.012) (-590.852) -- 0:00:27
559500 -- (-593.462) (-590.991) [-597.864] (-589.058) * (-589.341) [-590.334] (-595.386) (-591.298) -- 0:00:27
560000 -- (-591.794) (-590.959) [-593.963] (-589.062) * (-588.907) (-596.088) [-588.429] (-590.171) -- 0:00:27
Average standard deviation of split frequencies: 0.009196
560500 -- (-588.593) (-590.954) [-594.034] (-588.548) * (-592.817) (-587.922) [-588.680] (-591.365) -- 0:00:27
561000 -- (-589.053) [-588.509] (-591.675) (-591.180) * (-588.871) (-587.723) [-591.442] (-592.739) -- 0:00:27
561500 -- (-588.825) (-589.322) (-589.347) [-589.982] * (-588.073) (-589.275) (-589.283) [-589.408] -- 0:00:27
562000 -- (-591.495) (-589.231) (-592.174) [-589.526] * [-590.171] (-589.780) (-589.195) (-589.694) -- 0:00:27
562500 -- (-590.776) (-591.274) [-591.283] (-587.759) * [-588.652] (-589.819) (-589.476) (-589.437) -- 0:00:27
563000 -- (-591.155) (-589.558) [-589.849] (-592.308) * (-590.542) (-589.661) [-588.818] (-589.040) -- 0:00:27
563500 -- [-587.584] (-590.999) (-590.035) (-596.367) * (-590.049) (-588.630) (-589.408) [-589.110] -- 0:00:27
564000 -- (-588.703) (-589.869) [-593.048] (-589.473) * (-590.224) (-588.523) (-590.169) [-587.574] -- 0:00:27
564500 -- [-590.273] (-587.983) (-595.283) (-589.950) * (-591.934) (-589.054) [-592.134] (-590.759) -- 0:00:27
565000 -- (-589.279) (-591.212) [-589.550] (-590.827) * (-591.883) [-589.331] (-591.123) (-587.601) -- 0:00:27
Average standard deviation of split frequencies: 0.009266
565500 -- [-588.777] (-589.744) (-588.346) (-591.150) * (-590.655) (-588.338) (-591.925) [-589.787] -- 0:00:27
566000 -- [-588.207] (-587.856) (-589.702) (-590.916) * (-591.123) [-588.974] (-591.494) (-588.278) -- 0:00:27
566500 -- (-593.076) (-588.275) [-587.999] (-590.320) * (-589.498) (-590.748) [-589.851] (-588.233) -- 0:00:27
567000 -- (-590.531) (-592.833) (-587.964) [-589.947] * (-588.767) (-594.395) (-591.525) [-589.528] -- 0:00:27
567500 -- [-590.074] (-588.644) (-590.036) (-593.089) * [-588.403] (-589.439) (-590.261) (-588.406) -- 0:00:27
568000 -- (-591.904) (-589.201) [-592.036] (-591.519) * [-593.153] (-589.014) (-588.373) (-589.306) -- 0:00:27
568500 -- (-589.284) (-588.720) [-587.808] (-588.687) * [-590.767] (-589.641) (-595.115) (-590.303) -- 0:00:27
569000 -- (-592.795) [-590.199] (-592.474) (-590.184) * [-588.785] (-592.458) (-590.602) (-587.489) -- 0:00:27
569500 -- (-592.947) [-590.819] (-591.518) (-590.565) * (-591.042) [-593.919] (-589.675) (-591.656) -- 0:00:27
570000 -- (-596.815) (-590.632) (-590.461) [-590.330] * (-591.370) [-591.935] (-589.937) (-587.949) -- 0:00:27
Average standard deviation of split frequencies: 0.008932
570500 -- [-594.311] (-588.753) (-588.939) (-591.125) * [-590.453] (-591.601) (-588.872) (-589.498) -- 0:00:27
571000 -- (-587.964) [-590.696] (-589.913) (-590.159) * (-589.093) (-590.384) (-591.028) [-589.383] -- 0:00:27
571500 -- (-588.899) [-592.191] (-591.929) (-588.177) * (-591.185) (-592.341) (-591.233) [-590.199] -- 0:00:26
572000 -- [-588.336] (-588.778) (-589.445) (-588.368) * [-587.727] (-595.842) (-589.340) (-588.846) -- 0:00:26
572500 -- (-589.595) (-589.724) (-587.530) [-588.794] * (-589.265) (-596.837) (-591.098) [-587.470] -- 0:00:26
573000 -- [-589.322] (-590.217) (-589.895) (-587.955) * (-591.799) (-596.715) (-588.205) [-588.865] -- 0:00:26
573500 -- (-589.649) (-589.870) [-590.186] (-591.156) * [-591.047] (-589.652) (-588.551) (-589.806) -- 0:00:26
574000 -- (-590.898) [-590.137] (-593.453) (-588.605) * [-589.598] (-588.497) (-588.406) (-589.044) -- 0:00:26
574500 -- (-594.288) [-587.965] (-589.969) (-589.443) * (-587.392) (-587.648) [-588.481] (-588.147) -- 0:00:26
575000 -- (-588.974) [-589.598] (-589.314) (-595.654) * (-588.085) (-589.963) (-590.522) [-587.570] -- 0:00:26
Average standard deviation of split frequencies: 0.009054
575500 -- (-590.527) (-590.957) [-589.801] (-587.710) * (-591.524) (-588.393) [-589.872] (-589.743) -- 0:00:26
576000 -- (-589.460) (-592.190) [-590.080] (-587.542) * [-588.171] (-588.673) (-589.274) (-588.646) -- 0:00:26
576500 -- [-588.277] (-596.314) (-590.490) (-589.181) * (-588.653) (-587.680) [-589.814] (-588.518) -- 0:00:26
577000 -- [-587.851] (-592.966) (-591.967) (-591.207) * [-591.639] (-590.001) (-589.950) (-587.859) -- 0:00:26
577500 -- (-590.009) (-592.137) [-591.797] (-591.816) * (-594.029) (-590.456) [-590.134] (-592.660) -- 0:00:26
578000 -- (-594.848) (-589.096) [-588.478] (-587.787) * (-594.036) (-593.794) [-592.431] (-587.585) -- 0:00:26
578500 -- (-594.521) (-589.606) (-595.251) [-592.390] * (-589.311) [-590.170] (-591.434) (-587.692) -- 0:00:26
579000 -- [-588.579] (-588.606) (-588.292) (-589.493) * (-594.877) [-589.094] (-594.578) (-588.827) -- 0:00:26
579500 -- (-587.924) (-588.107) [-598.603] (-591.283) * (-589.779) (-589.963) [-593.553] (-589.436) -- 0:00:26
580000 -- (-587.936) (-589.188) [-593.439] (-592.955) * (-588.762) [-589.872] (-589.352) (-587.859) -- 0:00:26
Average standard deviation of split frequencies: 0.009438
580500 -- (-588.771) (-590.710) (-596.005) [-589.677] * (-589.021) (-590.428) (-590.498) [-589.478] -- 0:00:26
581000 -- (-589.534) (-590.023) [-595.780] (-590.704) * (-588.555) (-589.442) [-588.020] (-589.966) -- 0:00:26
581500 -- (-592.885) [-589.939] (-589.433) (-590.678) * (-591.197) (-588.843) (-589.247) [-591.110] -- 0:00:26
582000 -- (-592.345) [-592.369] (-589.533) (-591.864) * (-588.321) (-588.209) (-589.946) [-589.675] -- 0:00:26
582500 -- (-589.137) (-588.653) (-587.597) [-590.323] * (-589.599) (-590.153) [-589.317] (-592.071) -- 0:00:26
583000 -- (-591.451) (-587.817) [-592.962] (-588.695) * (-588.154) [-588.365] (-588.622) (-590.350) -- 0:00:26
583500 -- (-588.758) (-591.896) (-588.729) [-588.713] * [-591.743] (-588.936) (-595.452) (-587.890) -- 0:00:26
584000 -- (-588.856) (-588.945) [-588.345] (-592.601) * (-590.667) [-589.798] (-588.783) (-589.830) -- 0:00:26
584500 -- [-590.793] (-592.367) (-596.479) (-588.335) * (-589.475) [-589.180] (-588.129) (-588.575) -- 0:00:26
585000 -- [-591.167] (-590.151) (-590.059) (-590.821) * (-588.585) (-588.473) (-588.710) [-589.846] -- 0:00:26
Average standard deviation of split frequencies: 0.008899
585500 -- (-589.019) [-590.356] (-591.205) (-591.480) * (-590.585) [-594.555] (-594.114) (-591.609) -- 0:00:26
586000 -- (-593.311) (-590.185) [-587.393] (-590.409) * [-591.182] (-592.049) (-590.026) (-591.844) -- 0:00:26
586500 -- (-588.723) (-591.552) [-588.255] (-592.229) * (-591.514) (-593.400) [-589.105] (-589.871) -- 0:00:26
587000 -- [-587.924] (-591.611) (-589.479) (-589.669) * [-588.614] (-594.004) (-590.757) (-589.591) -- 0:00:26
587500 -- (-590.028) [-588.221] (-589.857) (-598.020) * (-587.698) [-588.746] (-588.634) (-592.191) -- 0:00:25
588000 -- (-592.915) (-587.840) (-587.707) [-592.736] * (-589.111) [-587.561] (-588.262) (-590.502) -- 0:00:25
588500 -- (-591.524) (-588.519) [-590.680] (-591.487) * (-590.697) (-588.932) (-588.051) [-590.929] -- 0:00:25
589000 -- (-587.906) (-587.320) [-588.515] (-588.992) * [-588.778] (-588.916) (-589.798) (-588.290) -- 0:00:25
589500 -- (-588.018) (-591.084) [-588.886] (-589.778) * (-589.165) [-587.958] (-589.063) (-588.571) -- 0:00:25
590000 -- (-591.247) [-589.323] (-592.246) (-592.894) * [-587.801] (-590.559) (-589.313) (-589.996) -- 0:00:25
Average standard deviation of split frequencies: 0.008629
590500 -- (-591.759) (-593.856) (-591.200) [-588.180] * (-590.324) (-588.582) (-590.035) [-589.239] -- 0:00:25
591000 -- [-592.523] (-589.243) (-591.214) (-587.229) * (-588.202) (-591.381) [-591.027] (-588.825) -- 0:00:25
591500 -- (-590.363) (-590.661) [-589.131] (-589.330) * [-590.273] (-591.394) (-592.359) (-593.113) -- 0:00:25
592000 -- (-588.693) (-589.153) [-590.560] (-591.231) * (-590.545) [-587.598] (-587.750) (-588.871) -- 0:00:25
592500 -- (-588.994) [-587.920] (-589.497) (-588.490) * (-590.839) [-588.564] (-594.939) (-588.772) -- 0:00:25
593000 -- (-588.461) (-589.993) (-588.551) [-588.637] * (-591.143) (-589.178) [-592.314] (-590.669) -- 0:00:25
593500 -- [-593.626] (-589.768) (-590.295) (-591.386) * (-588.320) [-593.037] (-587.844) (-589.769) -- 0:00:25
594000 -- (-589.701) (-589.804) (-591.358) [-589.769] * (-593.812) (-593.927) [-587.506] (-593.787) -- 0:00:25
594500 -- [-588.395] (-592.979) (-590.105) (-588.499) * (-592.545) [-592.009] (-589.220) (-591.682) -- 0:00:25
595000 -- [-590.064] (-591.120) (-588.598) (-587.812) * (-590.312) [-590.043] (-588.266) (-592.205) -- 0:00:25
Average standard deviation of split frequencies: 0.008997
595500 -- [-588.882] (-588.858) (-599.129) (-588.854) * [-590.709] (-588.782) (-591.605) (-592.320) -- 0:00:25
596000 -- (-589.476) (-588.634) [-590.765] (-589.082) * (-588.676) [-588.801] (-592.734) (-589.563) -- 0:00:25
596500 -- (-590.396) [-588.304] (-594.653) (-587.900) * [-589.514] (-588.151) (-591.952) (-589.928) -- 0:00:25
597000 -- (-594.249) (-591.099) (-589.764) [-590.218] * (-592.278) [-590.047] (-589.021) (-587.967) -- 0:00:24
597500 -- (-590.474) (-588.831) [-588.770] (-589.923) * (-590.938) (-592.493) [-587.728] (-588.774) -- 0:00:24
598000 -- [-589.184] (-587.657) (-587.985) (-592.284) * (-587.794) (-589.020) [-590.569] (-589.101) -- 0:00:25
598500 -- (-589.675) (-587.437) (-587.765) [-592.575] * (-590.426) [-588.187] (-589.914) (-594.129) -- 0:00:25
599000 -- (-591.404) (-591.249) (-588.744) [-590.215] * (-588.588) (-591.209) (-590.131) [-589.763] -- 0:00:25
599500 -- [-587.406] (-587.631) (-588.354) (-592.757) * (-588.689) (-588.165) (-590.377) [-588.567] -- 0:00:25
600000 -- (-591.643) [-590.748] (-589.959) (-591.151) * (-588.652) (-588.738) (-589.297) [-588.411] -- 0:00:25
Average standard deviation of split frequencies: 0.008976
600500 -- (-589.538) [-588.816] (-590.537) (-589.512) * (-589.063) [-588.649] (-587.573) (-589.817) -- 0:00:25
601000 -- (-588.810) (-588.247) (-589.645) [-589.756] * (-588.545) (-590.316) (-588.297) [-592.508] -- 0:00:25
601500 -- (-591.193) (-588.250) (-592.532) [-589.885] * [-592.590] (-589.362) (-592.996) (-591.167) -- 0:00:25
602000 -- (-590.456) (-590.623) (-591.513) [-588.834] * (-589.872) [-589.326] (-591.077) (-590.532) -- 0:00:25
602500 -- (-590.416) (-594.043) [-589.310] (-593.363) * (-590.623) (-588.462) (-589.776) [-589.960] -- 0:00:25
603000 -- (-591.424) (-589.090) (-588.672) [-589.681] * (-589.101) (-589.649) [-590.370] (-589.432) -- 0:00:25
603500 -- (-588.565) (-591.852) (-589.219) [-589.123] * [-588.415] (-588.788) (-592.293) (-588.531) -- 0:00:24
604000 -- (-593.091) (-588.744) (-591.668) [-587.883] * (-588.582) [-589.767] (-587.974) (-588.812) -- 0:00:24
604500 -- (-589.483) (-587.885) (-594.759) [-588.970] * (-588.691) [-591.847] (-588.737) (-587.374) -- 0:00:24
605000 -- [-588.410] (-588.311) (-588.536) (-589.335) * (-588.892) (-592.951) [-590.116] (-588.877) -- 0:00:24
Average standard deviation of split frequencies: 0.008849
605500 -- [-591.347] (-588.259) (-593.291) (-595.072) * (-590.916) (-591.219) (-592.180) [-588.511] -- 0:00:24
606000 -- [-590.808] (-591.175) (-592.728) (-592.869) * (-591.044) [-589.131] (-590.164) (-602.992) -- 0:00:24
606500 -- [-589.638] (-590.281) (-589.574) (-595.603) * (-588.685) [-590.548] (-590.081) (-592.321) -- 0:00:24
607000 -- [-590.792] (-592.634) (-591.145) (-598.062) * (-593.247) [-588.486] (-591.829) (-590.906) -- 0:00:24
607500 -- (-588.600) [-588.877] (-591.041) (-593.596) * [-591.416] (-587.904) (-590.603) (-587.879) -- 0:00:24
608000 -- (-590.014) (-589.186) (-587.929) [-588.968] * (-587.469) (-587.895) (-591.078) [-590.914] -- 0:00:24
608500 -- (-591.298) (-589.017) (-587.725) [-589.294] * (-588.051) (-590.083) (-589.429) [-593.489] -- 0:00:24
609000 -- (-590.729) (-589.205) (-590.989) [-588.604] * (-594.404) [-588.135] (-593.903) (-594.992) -- 0:00:24
609500 -- (-587.812) (-590.614) [-588.250] (-589.565) * (-590.227) (-589.874) (-588.811) [-594.830] -- 0:00:24
610000 -- (-589.258) (-588.356) [-587.723] (-589.215) * (-590.033) (-587.457) [-588.583] (-594.207) -- 0:00:24
Average standard deviation of split frequencies: 0.008491
610500 -- (-588.929) (-588.350) [-587.903] (-588.330) * (-591.492) [-591.665] (-587.844) (-588.218) -- 0:00:24
611000 -- (-589.532) (-587.965) [-588.030] (-588.604) * (-590.473) (-591.149) [-588.881] (-589.054) -- 0:00:24
611500 -- (-589.430) (-588.544) (-589.558) [-589.434] * (-588.247) (-588.982) [-588.943] (-590.117) -- 0:00:24
612000 -- [-589.157] (-588.166) (-590.469) (-589.132) * (-589.643) (-589.696) [-589.609] (-589.652) -- 0:00:24
612500 -- (-590.621) (-588.457) (-587.892) [-588.155] * [-589.272] (-594.258) (-588.681) (-588.443) -- 0:00:24
613000 -- (-590.954) (-589.699) [-592.118] (-590.857) * [-590.521] (-597.722) (-591.360) (-587.896) -- 0:00:23
613500 -- (-590.245) [-588.963] (-588.239) (-591.475) * [-588.081] (-596.133) (-591.293) (-588.373) -- 0:00:23
614000 -- (-588.418) (-595.659) (-588.067) [-588.831] * (-588.390) (-589.777) [-590.183] (-589.616) -- 0:00:23
614500 -- (-591.407) (-588.763) [-590.761] (-589.382) * [-587.542] (-588.688) (-587.894) (-590.840) -- 0:00:24
615000 -- (-588.451) (-590.766) (-589.113) [-595.210] * [-590.148] (-590.461) (-590.343) (-588.888) -- 0:00:24
Average standard deviation of split frequencies: 0.008514
615500 -- (-590.036) (-589.878) [-589.356] (-590.496) * (-594.758) (-588.724) (-592.274) [-587.731] -- 0:00:24
616000 -- (-588.981) (-588.719) [-594.212] (-592.685) * [-589.915] (-592.393) (-588.275) (-588.545) -- 0:00:24
616500 -- (-589.314) (-588.230) (-595.391) [-590.522] * (-595.059) (-589.935) (-589.215) [-590.356] -- 0:00:24
617000 -- (-591.016) [-587.863] (-588.722) (-590.108) * (-592.567) [-591.716] (-590.203) (-591.820) -- 0:00:24
617500 -- (-588.294) (-590.162) [-588.145] (-589.484) * (-592.439) (-596.293) [-587.716] (-589.481) -- 0:00:24
618000 -- (-592.413) [-587.878] (-590.628) (-590.044) * (-592.483) [-589.397] (-587.541) (-591.648) -- 0:00:24
618500 -- (-589.645) (-592.877) [-590.975] (-589.846) * (-597.128) (-590.525) (-595.023) [-595.226] -- 0:00:24
619000 -- (-595.542) (-589.597) [-589.033] (-591.735) * (-588.529) (-591.512) [-589.999] (-595.515) -- 0:00:24
619500 -- (-591.389) (-588.766) (-592.646) [-587.738] * (-593.230) [-589.767] (-590.390) (-588.774) -- 0:00:23
620000 -- (-590.310) [-588.940] (-587.584) (-589.854) * (-595.285) (-587.436) (-589.012) [-588.346] -- 0:00:23
Average standard deviation of split frequencies: 0.008782
620500 -- (-589.339) (-588.792) (-589.113) [-589.449] * [-589.137] (-589.366) (-590.131) (-588.838) -- 0:00:23
621000 -- (-589.017) [-589.380] (-590.034) (-590.430) * [-590.074] (-588.751) (-588.134) (-588.194) -- 0:00:23
621500 -- (-593.092) [-592.876] (-587.953) (-589.566) * [-591.304] (-588.891) (-590.536) (-590.548) -- 0:00:23
622000 -- [-589.387] (-593.241) (-588.264) (-588.516) * (-591.412) [-590.504] (-588.916) (-589.427) -- 0:00:23
622500 -- (-589.866) (-589.933) (-589.928) [-587.644] * [-589.447] (-595.487) (-589.624) (-590.706) -- 0:00:23
623000 -- (-588.171) (-588.950) (-590.435) [-588.905] * (-589.845) (-589.467) [-592.758] (-587.706) -- 0:00:23
623500 -- (-589.052) (-593.596) [-588.324] (-593.343) * (-590.438) [-588.555] (-589.550) (-593.233) -- 0:00:23
624000 -- [-594.917] (-595.750) (-587.531) (-589.536) * (-590.251) [-588.551] (-594.728) (-589.498) -- 0:00:23
624500 -- [-588.109] (-588.682) (-588.214) (-590.915) * [-589.031] (-589.934) (-589.472) (-588.919) -- 0:00:23
625000 -- [-590.151] (-590.743) (-587.823) (-588.501) * (-588.293) [-588.526] (-590.306) (-590.178) -- 0:00:23
Average standard deviation of split frequencies: 0.008660
625500 -- [-589.543] (-590.207) (-595.593) (-588.733) * (-588.906) [-589.549] (-592.249) (-589.749) -- 0:00:23
626000 -- (-589.283) (-589.343) [-589.894] (-588.803) * (-589.792) (-587.546) [-589.584] (-594.454) -- 0:00:23
626500 -- (-588.778) [-587.975] (-589.290) (-588.196) * (-589.282) [-589.532] (-591.729) (-595.767) -- 0:00:23
627000 -- (-590.637) [-588.197] (-590.050) (-589.309) * (-591.984) (-590.239) [-588.865] (-591.896) -- 0:00:23
627500 -- (-593.147) (-589.246) (-592.578) [-590.188] * (-588.501) (-589.457) (-588.037) [-591.892] -- 0:00:23
628000 -- (-593.477) (-588.061) (-589.385) [-588.272] * [-588.335] (-587.683) (-588.679) (-588.306) -- 0:00:23
628500 -- (-590.614) [-589.891] (-591.210) (-590.891) * [-588.147] (-589.138) (-591.702) (-598.601) -- 0:00:23
629000 -- (-589.886) [-590.951] (-594.718) (-592.766) * (-593.862) [-588.593] (-590.499) (-590.025) -- 0:00:23
629500 -- (-595.249) (-588.752) (-591.517) [-589.346] * (-590.969) (-588.843) (-588.970) [-588.096] -- 0:00:22
630000 -- (-592.383) [-590.707] (-590.075) (-589.343) * (-588.454) (-591.552) (-587.899) [-588.077] -- 0:00:22
Average standard deviation of split frequencies: 0.009063
630500 -- (-589.059) (-589.108) [-589.390] (-591.186) * (-591.477) (-591.802) (-588.379) [-589.110] -- 0:00:22
631000 -- (-588.909) (-590.120) (-589.824) [-588.940] * (-588.521) (-587.643) [-588.501] (-588.538) -- 0:00:23
631500 -- [-588.880] (-589.634) (-589.049) (-589.230) * [-589.154] (-587.553) (-589.953) (-590.285) -- 0:00:23
632000 -- (-588.082) (-592.632) [-589.374] (-588.408) * (-589.932) (-592.959) (-590.305) [-590.531] -- 0:00:23
632500 -- (-588.371) [-587.649] (-590.381) (-588.841) * [-589.566] (-588.695) (-591.284) (-590.263) -- 0:00:23
633000 -- (-588.163) [-587.669] (-590.147) (-587.793) * (-588.136) [-593.404] (-591.802) (-591.786) -- 0:00:23
633500 -- (-587.206) [-588.498] (-590.633) (-590.037) * [-587.927] (-589.064) (-591.665) (-589.882) -- 0:00:23
634000 -- (-589.981) [-589.204] (-590.701) (-589.485) * (-587.848) (-589.549) (-589.046) [-590.620] -- 0:00:23
634500 -- (-593.644) (-588.701) [-594.424] (-587.822) * (-589.867) (-589.305) (-591.305) [-589.584] -- 0:00:23
635000 -- (-591.113) (-588.319) (-591.920) [-588.366] * [-589.949] (-589.483) (-600.771) (-591.287) -- 0:00:22
Average standard deviation of split frequencies: 0.008450
635500 -- [-588.718] (-590.700) (-591.611) (-593.929) * [-589.137] (-590.696) (-596.555) (-588.627) -- 0:00:22
636000 -- (-588.994) (-590.018) (-591.364) [-590.584] * (-592.508) (-591.786) (-588.256) [-589.960] -- 0:00:22
636500 -- (-589.430) [-588.964] (-591.172) (-589.555) * [-593.211] (-588.101) (-590.132) (-589.253) -- 0:00:22
637000 -- (-588.591) [-589.541] (-589.353) (-591.918) * [-594.462] (-589.812) (-590.512) (-594.293) -- 0:00:22
637500 -- (-593.431) (-591.203) [-590.099] (-589.993) * (-592.207) (-590.153) [-592.755] (-591.051) -- 0:00:22
638000 -- [-592.302] (-588.678) (-588.284) (-588.265) * [-588.285] (-592.701) (-591.242) (-589.028) -- 0:00:22
638500 -- (-589.008) (-589.898) (-588.297) [-589.751] * (-590.832) (-588.070) [-588.937] (-589.692) -- 0:00:22
639000 -- (-588.602) (-590.043) (-592.311) [-588.758] * (-592.093) (-589.199) (-588.392) [-589.014] -- 0:00:22
639500 -- (-588.347) (-589.646) [-589.766] (-593.231) * (-591.986) (-588.876) (-590.517) [-588.800] -- 0:00:22
640000 -- (-590.322) (-590.138) (-588.744) [-589.629] * [-592.609] (-588.637) (-593.980) (-589.450) -- 0:00:22
Average standard deviation of split frequencies: 0.009014
640500 -- [-589.599] (-592.671) (-588.898) (-590.123) * (-589.090) [-589.988] (-589.384) (-587.631) -- 0:00:22
641000 -- [-591.198] (-590.768) (-592.665) (-593.488) * [-588.721] (-591.068) (-588.762) (-589.645) -- 0:00:22
641500 -- (-591.725) (-587.598) [-591.194] (-589.024) * (-588.352) (-590.057) (-594.137) [-588.763] -- 0:00:22
642000 -- (-588.010) (-589.155) (-590.445) [-589.388] * [-589.739] (-587.345) (-590.369) (-590.101) -- 0:00:22
642500 -- (-591.075) (-589.853) [-589.556] (-590.933) * [-587.416] (-590.338) (-592.040) (-590.340) -- 0:00:22
643000 -- (-589.427) (-590.639) [-587.937] (-590.670) * [-590.852] (-591.438) (-588.541) (-588.629) -- 0:00:22
643500 -- (-588.362) (-590.557) (-592.420) [-589.167] * (-593.038) (-587.921) [-590.260] (-591.369) -- 0:00:22
644000 -- [-588.580] (-589.585) (-588.829) (-591.568) * (-590.563) (-591.486) (-589.511) [-590.965] -- 0:00:22
644500 -- (-589.187) (-587.951) [-588.452] (-590.795) * (-590.662) [-590.885] (-589.174) (-590.434) -- 0:00:22
645000 -- (-587.815) [-588.139] (-588.573) (-587.602) * (-589.241) [-592.957] (-588.951) (-593.097) -- 0:00:22
Average standard deviation of split frequencies: 0.008985
645500 -- (-590.247) [-592.076] (-589.206) (-588.245) * [-592.469] (-592.196) (-590.493) (-590.674) -- 0:00:21
646000 -- (-590.593) (-588.386) (-588.332) [-589.002] * [-588.480] (-588.875) (-591.863) (-592.167) -- 0:00:21
646500 -- [-593.060] (-590.458) (-593.848) (-590.711) * (-590.700) [-589.388] (-592.415) (-595.396) -- 0:00:21
647000 -- (-588.563) [-588.715] (-587.701) (-588.713) * (-591.222) [-590.144] (-589.586) (-589.594) -- 0:00:21
647500 -- (-588.881) (-591.819) [-590.152] (-589.595) * (-593.358) (-589.322) [-591.315] (-588.824) -- 0:00:22
648000 -- [-592.721] (-589.328) (-590.654) (-592.513) * (-588.418) (-589.511) [-588.835] (-592.993) -- 0:00:22
648500 -- [-589.805] (-587.915) (-590.943) (-589.024) * (-587.887) (-591.757) (-591.233) [-590.206] -- 0:00:22
649000 -- (-590.214) (-588.748) [-588.761] (-590.299) * (-588.432) (-592.442) (-588.170) [-588.139] -- 0:00:22
649500 -- (-589.049) [-589.014] (-588.308) (-599.513) * (-587.947) [-590.079] (-588.676) (-591.056) -- 0:00:22
650000 -- (-588.742) [-592.866] (-589.818) (-589.665) * (-594.787) [-591.090] (-590.487) (-588.197) -- 0:00:22
Average standard deviation of split frequencies: 0.008830
650500 -- [-590.391] (-591.889) (-590.950) (-589.915) * [-595.895] (-590.278) (-588.283) (-589.572) -- 0:00:22
651000 -- [-588.504] (-589.789) (-592.328) (-590.101) * (-595.617) (-590.637) (-587.653) [-589.443] -- 0:00:21
651500 -- [-589.733] (-589.854) (-592.735) (-591.139) * (-590.408) [-590.527] (-587.610) (-590.458) -- 0:00:21
652000 -- (-587.639) [-588.558] (-591.692) (-593.380) * (-590.605) (-587.687) [-588.042] (-588.634) -- 0:00:21
652500 -- (-587.797) (-589.716) (-588.297) [-589.140] * (-593.506) (-589.044) [-588.136] (-590.333) -- 0:00:21
653000 -- (-589.289) (-591.759) (-589.925) [-588.649] * [-589.375] (-592.908) (-588.255) (-594.397) -- 0:00:21
653500 -- (-591.169) [-595.868] (-589.875) (-588.365) * (-591.693) [-590.768] (-590.139) (-589.614) -- 0:00:21
654000 -- (-588.683) (-590.678) [-588.954] (-590.836) * [-588.722] (-595.254) (-587.896) (-587.901) -- 0:00:21
654500 -- [-588.199] (-591.580) (-592.001) (-587.709) * [-589.553] (-590.514) (-588.636) (-591.945) -- 0:00:21
655000 -- (-593.643) (-588.512) [-591.110] (-589.834) * (-589.716) [-590.432] (-588.328) (-592.293) -- 0:00:21
Average standard deviation of split frequencies: 0.008668
655500 -- (-588.905) (-588.082) (-588.951) [-592.165] * [-588.651] (-588.641) (-588.466) (-587.876) -- 0:00:21
656000 -- [-593.316] (-589.940) (-588.820) (-588.982) * [-587.791] (-588.797) (-593.191) (-589.103) -- 0:00:21
656500 -- [-590.138] (-587.895) (-591.248) (-587.963) * [-589.778] (-591.702) (-588.543) (-589.065) -- 0:00:21
657000 -- [-590.776] (-587.611) (-588.651) (-590.196) * (-588.766) (-591.177) [-589.259] (-589.318) -- 0:00:21
657500 -- (-591.847) [-590.855] (-590.335) (-590.715) * (-588.912) (-589.696) (-587.843) [-588.186] -- 0:00:21
658000 -- (-589.344) [-589.360] (-590.236) (-587.754) * (-588.113) (-593.763) [-589.151] (-587.884) -- 0:00:21
658500 -- [-587.797] (-595.892) (-592.114) (-593.711) * (-588.137) [-593.229] (-589.020) (-589.226) -- 0:00:21
659000 -- (-588.403) [-588.575] (-590.229) (-597.293) * (-588.653) [-591.626] (-588.523) (-588.688) -- 0:00:21
659500 -- (-589.384) (-588.729) (-591.031) [-590.026] * (-589.558) (-589.792) (-588.443) [-587.833] -- 0:00:21
660000 -- (-589.786) (-589.222) [-587.834] (-587.849) * (-590.678) [-587.595] (-589.018) (-592.228) -- 0:00:21
Average standard deviation of split frequencies: 0.008607
660500 -- (-593.118) [-592.342] (-590.102) (-587.835) * (-588.293) [-591.027] (-589.589) (-588.015) -- 0:00:21
661000 -- (-589.638) (-589.005) (-591.774) [-590.975] * (-589.876) (-591.364) [-590.603] (-589.003) -- 0:00:21
661500 -- (-595.870) [-589.057] (-589.600) (-588.396) * (-592.117) [-587.802] (-589.645) (-593.451) -- 0:00:20
662000 -- (-588.247) (-589.086) [-591.064] (-591.631) * (-589.297) (-587.537) (-589.280) [-588.788] -- 0:00:20
662500 -- (-591.709) [-589.102] (-590.791) (-588.368) * (-587.634) [-589.957] (-589.305) (-590.166) -- 0:00:20
663000 -- (-590.296) [-590.344] (-590.580) (-591.695) * (-591.542) (-594.648) (-589.450) [-588.008] -- 0:00:20
663500 -- (-589.736) (-590.933) [-590.375] (-589.810) * (-589.109) (-593.741) (-588.876) [-587.589] -- 0:00:20
664000 -- (-588.464) [-589.356] (-590.382) (-590.538) * (-591.646) (-591.560) [-588.468] (-587.472) -- 0:00:21
664500 -- (-591.120) [-591.572] (-589.716) (-588.690) * (-587.568) (-594.071) [-588.097] (-588.335) -- 0:00:21
665000 -- (-589.637) (-590.091) (-589.028) [-588.330] * [-587.740] (-591.205) (-592.112) (-590.087) -- 0:00:21
Average standard deviation of split frequencies: 0.009069
665500 -- (-590.255) (-590.033) (-591.129) [-590.678] * (-588.722) [-588.972] (-589.120) (-588.695) -- 0:00:21
666000 -- (-589.963) (-589.880) [-592.158] (-588.150) * (-589.902) (-591.199) [-588.457] (-590.055) -- 0:00:21
666500 -- (-590.868) (-589.432) (-591.227) [-589.533] * (-588.118) [-589.290] (-590.337) (-596.458) -- 0:00:21
667000 -- (-589.706) (-588.123) [-588.067] (-590.514) * (-594.226) (-589.118) (-588.941) [-587.734] -- 0:00:20
667500 -- [-591.553] (-588.444) (-588.525) (-589.281) * (-590.449) (-589.654) [-589.847] (-587.616) -- 0:00:20
668000 -- (-591.226) [-589.471] (-590.658) (-592.190) * (-589.868) (-587.886) [-589.897] (-589.388) -- 0:00:20
668500 -- (-592.233) [-589.518] (-590.192) (-588.531) * (-587.982) (-592.569) (-589.680) [-590.141] -- 0:00:20
669000 -- (-593.464) (-589.149) [-588.096] (-588.401) * (-589.018) (-593.535) (-589.222) [-588.238] -- 0:00:20
669500 -- (-593.919) (-588.633) (-589.655) [-588.303] * (-590.672) (-593.620) [-589.626] (-590.337) -- 0:00:20
670000 -- [-589.082] (-588.557) (-593.450) (-587.759) * (-588.304) (-593.165) (-591.167) [-588.218] -- 0:00:20
Average standard deviation of split frequencies: 0.008918
670500 -- (-589.819) (-589.559) [-589.864] (-591.681) * (-588.643) [-589.244] (-589.696) (-588.968) -- 0:00:20
671000 -- (-590.295) (-588.816) [-588.369] (-588.949) * (-591.184) [-592.806] (-593.597) (-594.984) -- 0:00:20
671500 -- (-591.300) (-589.500) [-591.979] (-592.544) * (-589.661) (-590.862) [-589.771] (-592.285) -- 0:00:20
672000 -- (-590.530) (-587.325) [-589.112] (-590.928) * [-588.199] (-590.203) (-591.385) (-595.847) -- 0:00:20
672500 -- [-589.496] (-587.325) (-588.476) (-588.943) * (-591.333) (-592.289) [-588.908] (-594.253) -- 0:00:20
673000 -- (-590.519) (-591.969) [-590.203] (-590.912) * [-589.436] (-594.040) (-589.900) (-588.577) -- 0:00:20
673500 -- (-590.661) [-589.106] (-588.261) (-592.394) * [-589.110] (-588.349) (-593.109) (-590.589) -- 0:00:20
674000 -- (-590.573) [-588.031] (-590.601) (-594.749) * (-594.496) (-591.656) (-592.734) [-589.305] -- 0:00:20
674500 -- (-591.180) (-587.513) [-587.626] (-589.710) * (-590.797) (-591.086) (-590.485) [-587.557] -- 0:00:20
675000 -- (-589.973) [-589.791] (-587.915) (-588.083) * [-592.161] (-589.104) (-593.723) (-589.576) -- 0:00:20
Average standard deviation of split frequencies: 0.008760
675500 -- (-590.239) (-590.154) (-587.915) [-589.306] * (-591.949) (-587.997) (-591.235) [-590.695] -- 0:00:20
676000 -- (-594.434) (-590.824) [-588.903] (-587.637) * [-587.793] (-592.144) (-589.248) (-587.919) -- 0:00:20
676500 -- [-588.105] (-590.959) (-592.253) (-588.099) * (-588.693) [-587.510] (-589.225) (-587.997) -- 0:00:20
677000 -- (-588.646) (-590.273) [-588.321] (-589.592) * (-593.296) (-587.632) [-587.738] (-591.264) -- 0:00:20
677500 -- (-588.530) (-590.111) (-590.405) [-591.241] * [-588.582] (-588.429) (-593.735) (-592.200) -- 0:00:19
678000 -- (-588.633) (-589.358) [-590.386] (-588.283) * (-595.366) [-588.319] (-587.736) (-592.339) -- 0:00:19
678500 -- (-589.950) (-589.583) (-591.546) [-587.960] * (-591.056) [-589.597] (-588.857) (-590.314) -- 0:00:19
679000 -- (-589.290) (-591.413) (-593.778) [-591.008] * (-590.989) (-595.103) [-591.577] (-589.179) -- 0:00:19
679500 -- (-588.173) (-594.156) (-590.636) [-587.907] * (-590.610) [-588.540] (-589.333) (-589.339) -- 0:00:19
680000 -- (-589.208) [-594.699] (-589.990) (-587.851) * (-587.899) (-590.580) (-591.346) [-588.376] -- 0:00:19
Average standard deviation of split frequencies: 0.008744
680500 -- (-588.130) (-591.430) (-591.307) [-589.892] * (-587.609) (-589.407) (-590.052) [-593.054] -- 0:00:20
681000 -- [-593.190] (-589.451) (-596.209) (-592.544) * (-593.029) [-589.457] (-590.714) (-591.060) -- 0:00:20
681500 -- (-590.090) [-589.300] (-590.299) (-588.689) * (-591.799) (-589.064) [-593.817] (-588.801) -- 0:00:20
682000 -- (-591.523) [-590.954] (-588.988) (-590.863) * (-591.317) (-588.333) [-589.931] (-589.183) -- 0:00:20
682500 -- [-588.070] (-590.298) (-588.898) (-591.148) * (-589.627) (-592.160) [-589.119] (-590.464) -- 0:00:20
683000 -- [-588.461] (-589.216) (-589.899) (-588.623) * (-588.860) [-588.850] (-588.523) (-588.426) -- 0:00:19
683500 -- (-588.800) (-590.922) [-589.304] (-588.388) * (-588.797) (-588.066) (-588.662) [-590.416] -- 0:00:19
684000 -- (-588.473) [-589.365] (-589.673) (-589.079) * (-589.601) [-590.032] (-590.617) (-587.729) -- 0:00:19
684500 -- (-587.460) (-592.046) (-589.479) [-587.981] * (-591.577) (-589.235) (-589.199) [-587.816] -- 0:00:19
685000 -- (-588.203) (-591.492) (-587.445) [-587.853] * (-590.547) [-590.092] (-589.136) (-587.970) -- 0:00:19
Average standard deviation of split frequencies: 0.008418
685500 -- (-589.056) [-589.347] (-589.163) (-589.272) * [-587.967] (-588.304) (-587.941) (-587.866) -- 0:00:19
686000 -- (-588.834) (-590.125) [-588.943] (-589.867) * [-587.730] (-588.801) (-588.469) (-592.898) -- 0:00:19
686500 -- [-590.915] (-589.516) (-589.292) (-590.070) * (-590.760) (-592.608) [-588.494] (-591.344) -- 0:00:19
687000 -- [-589.814] (-589.237) (-590.477) (-592.249) * (-589.987) [-588.641] (-592.094) (-589.604) -- 0:00:19
687500 -- (-590.174) (-594.125) (-588.991) [-593.489] * (-589.440) (-588.038) (-589.425) [-590.167] -- 0:00:19
688000 -- [-587.696] (-604.381) (-597.166) (-593.821) * (-590.291) [-587.620] (-593.516) (-588.892) -- 0:00:19
688500 -- (-588.769) [-588.886] (-589.289) (-591.538) * (-590.606) (-589.308) (-591.316) [-590.768] -- 0:00:19
689000 -- (-589.393) (-587.694) [-588.501] (-593.253) * (-592.566) [-589.025] (-590.787) (-592.270) -- 0:00:19
689500 -- (-593.282) [-589.020] (-587.669) (-591.733) * (-588.892) (-591.960) [-588.569] (-591.417) -- 0:00:19
690000 -- (-589.104) (-591.219) (-590.149) [-589.222] * (-588.835) (-589.602) (-590.694) [-590.039] -- 0:00:19
Average standard deviation of split frequencies: 0.008361
690500 -- [-592.578] (-589.865) (-588.496) (-588.523) * (-589.421) (-589.241) [-588.852] (-588.769) -- 0:00:19
691000 -- (-588.614) [-589.277] (-589.985) (-591.498) * (-591.322) (-588.571) (-588.032) [-591.654] -- 0:00:19
691500 -- [-592.503] (-589.180) (-587.968) (-587.992) * (-590.285) [-587.922] (-590.415) (-588.271) -- 0:00:19
692000 -- (-595.425) [-589.458] (-593.083) (-588.171) * (-589.044) [-587.624] (-594.516) (-591.678) -- 0:00:19
692500 -- (-589.702) [-589.083] (-588.222) (-588.147) * (-589.286) (-587.938) [-588.356] (-590.058) -- 0:00:19
693000 -- (-589.565) (-592.453) [-588.830] (-590.360) * (-590.706) (-587.481) (-588.878) [-588.818] -- 0:00:19
693500 -- (-588.621) (-591.736) (-588.667) [-587.367] * (-588.726) [-588.419] (-588.132) (-590.261) -- 0:00:19
694000 -- (-590.522) [-593.273] (-589.181) (-588.447) * [-589.030] (-590.991) (-591.307) (-593.182) -- 0:00:18
694500 -- (-589.069) (-589.795) [-587.757] (-588.152) * (-589.040) (-591.524) (-592.512) [-588.769] -- 0:00:18
695000 -- [-587.665] (-590.189) (-594.049) (-588.356) * [-588.752] (-590.063) (-590.956) (-590.638) -- 0:00:18
Average standard deviation of split frequencies: 0.008339
695500 -- (-588.733) [-589.658] (-597.699) (-590.851) * (-592.501) (-591.716) [-590.455] (-590.743) -- 0:00:18
696000 -- (-590.741) (-590.205) [-589.298] (-590.837) * [-590.635] (-590.716) (-590.302) (-591.547) -- 0:00:18
696500 -- (-589.440) (-590.210) (-593.033) [-591.742] * [-590.421] (-588.190) (-589.128) (-588.987) -- 0:00:18
697000 -- [-590.418] (-589.679) (-590.205) (-591.438) * (-588.662) (-591.093) (-589.666) [-590.742] -- 0:00:19
697500 -- [-588.760] (-591.394) (-593.916) (-590.897) * [-589.679] (-599.090) (-589.896) (-589.131) -- 0:00:19
698000 -- (-589.721) (-590.584) [-590.269] (-591.527) * [-587.527] (-590.861) (-589.963) (-589.390) -- 0:00:19
698500 -- (-589.555) (-589.361) [-588.265] (-588.746) * [-587.544] (-591.458) (-589.808) (-588.504) -- 0:00:18
699000 -- (-588.872) [-592.314] (-588.626) (-588.041) * (-588.259) (-590.725) [-593.350] (-588.896) -- 0:00:18
699500 -- (-588.185) (-588.787) [-589.487] (-588.882) * (-588.726) (-588.605) [-591.021] (-588.547) -- 0:00:18
700000 -- (-589.259) (-593.855) (-587.850) [-588.466] * (-590.657) (-591.920) [-589.096] (-589.386) -- 0:00:18
Average standard deviation of split frequencies: 0.008284
700500 -- [-590.145] (-590.502) (-588.008) (-589.521) * (-590.962) [-588.318] (-592.304) (-589.913) -- 0:00:18
701000 -- (-590.460) (-592.389) (-590.573) [-588.955] * (-593.088) [-588.881] (-590.293) (-592.083) -- 0:00:18
701500 -- [-589.714] (-591.203) (-591.698) (-589.731) * [-589.347] (-588.828) (-590.486) (-591.067) -- 0:00:18
702000 -- (-590.133) (-592.087) (-592.311) [-589.561] * (-593.368) (-590.253) [-590.977] (-588.590) -- 0:00:18
702500 -- (-588.524) (-589.166) [-590.567] (-589.595) * [-588.533] (-590.623) (-591.030) (-589.139) -- 0:00:18
703000 -- (-588.034) [-588.576] (-591.095) (-589.533) * (-593.860) (-592.658) [-590.875] (-588.790) -- 0:00:18
703500 -- (-589.759) (-587.584) [-587.769] (-588.003) * (-587.914) (-592.472) [-589.864] (-588.640) -- 0:00:18
704000 -- (-592.262) [-589.123] (-589.670) (-589.862) * (-590.745) (-591.644) (-591.565) [-589.109] -- 0:00:18
704500 -- [-589.420] (-588.734) (-589.904) (-593.463) * (-591.985) (-591.044) (-588.472) [-588.886] -- 0:00:18
705000 -- (-589.322) [-588.682] (-592.993) (-588.467) * (-589.350) (-590.116) [-589.647] (-588.905) -- 0:00:18
Average standard deviation of split frequencies: 0.008346
705500 -- [-589.871] (-590.853) (-592.516) (-588.644) * (-589.445) (-588.065) [-590.191] (-588.401) -- 0:00:18
706000 -- [-589.867] (-589.997) (-591.185) (-590.894) * (-590.437) [-588.017] (-594.068) (-587.872) -- 0:00:18
706500 -- (-588.012) [-589.758] (-589.827) (-591.373) * [-589.881] (-590.258) (-590.827) (-590.464) -- 0:00:18
707000 -- [-587.920] (-588.966) (-589.408) (-594.044) * [-589.093] (-588.590) (-588.846) (-587.668) -- 0:00:18
707500 -- (-597.116) (-590.466) [-589.917] (-589.842) * (-592.000) (-588.856) (-590.375) [-590.422] -- 0:00:18
708000 -- (-594.220) [-589.165] (-589.935) (-593.433) * (-591.666) (-590.141) [-590.851] (-589.559) -- 0:00:18
708500 -- (-592.052) [-589.733] (-591.627) (-589.247) * (-590.106) (-587.501) [-590.475] (-588.833) -- 0:00:18
709000 -- (-592.154) [-590.328] (-587.744) (-588.059) * [-588.010] (-588.800) (-590.540) (-589.151) -- 0:00:18
709500 -- (-588.287) (-588.300) [-589.133] (-589.143) * (-588.546) (-590.084) [-588.914] (-590.301) -- 0:00:18
710000 -- [-590.128] (-588.093) (-589.739) (-590.062) * (-590.133) (-587.911) [-587.910] (-588.453) -- 0:00:17
Average standard deviation of split frequencies: 0.008831
710500 -- [-588.737] (-593.034) (-590.685) (-590.565) * [-589.361] (-588.019) (-589.435) (-593.344) -- 0:00:17
711000 -- [-591.205] (-589.171) (-587.978) (-588.600) * (-588.079) [-588.275] (-587.688) (-590.453) -- 0:00:17
711500 -- (-590.703) (-592.535) [-588.189] (-589.635) * (-592.115) (-589.119) (-590.506) [-587.475] -- 0:00:17
712000 -- (-589.128) (-587.908) (-588.727) [-589.369] * [-589.987] (-595.408) (-588.665) (-590.225) -- 0:00:17
712500 -- [-590.717] (-588.632) (-587.728) (-592.658) * (-588.259) [-589.674] (-591.100) (-588.084) -- 0:00:17
713000 -- [-590.290] (-589.460) (-589.445) (-591.624) * (-590.244) (-589.776) (-588.859) [-591.558] -- 0:00:17
713500 -- (-588.299) (-591.747) [-589.679] (-589.496) * (-592.674) (-589.021) [-588.787] (-591.334) -- 0:00:18
714000 -- (-591.684) (-587.808) [-591.413] (-589.561) * (-588.095) [-591.042] (-590.999) (-591.160) -- 0:00:18
714500 -- [-589.078] (-588.687) (-592.837) (-589.645) * (-592.560) [-589.008] (-587.983) (-589.492) -- 0:00:17
715000 -- (-593.510) (-591.910) (-587.929) [-589.572] * (-589.918) (-588.253) [-590.424] (-590.332) -- 0:00:17
Average standard deviation of split frequencies: 0.008641
715500 -- (-600.752) (-589.128) [-588.311] (-588.557) * [-588.576] (-589.103) (-589.055) (-590.623) -- 0:00:17
716000 -- [-597.421] (-590.730) (-588.283) (-588.425) * [-590.067] (-589.168) (-593.170) (-588.979) -- 0:00:17
716500 -- [-595.029] (-588.083) (-590.579) (-589.809) * (-589.053) (-592.509) (-592.024) [-592.498] -- 0:00:17
717000 -- [-590.083] (-590.607) (-591.321) (-588.948) * (-589.280) (-591.506) [-594.902] (-590.388) -- 0:00:17
717500 -- (-588.423) [-587.869] (-587.984) (-598.197) * (-589.227) (-589.967) (-592.133) [-589.624] -- 0:00:17
718000 -- (-588.788) (-591.107) [-589.975] (-593.624) * (-587.877) (-593.805) [-588.342] (-593.788) -- 0:00:17
718500 -- (-588.548) [-588.848] (-587.896) (-591.740) * (-590.739) (-591.886) [-587.889] (-588.214) -- 0:00:17
719000 -- (-588.991) (-589.226) (-587.546) [-588.223] * (-588.235) (-591.019) (-588.951) [-590.253] -- 0:00:17
719500 -- (-594.920) [-587.886] (-588.887) (-591.897) * (-589.029) (-590.237) (-589.672) [-588.601] -- 0:00:17
720000 -- (-589.026) (-587.992) [-589.410] (-591.650) * (-588.828) [-589.324] (-592.567) (-591.591) -- 0:00:17
Average standard deviation of split frequencies: 0.008155
720500 -- (-591.182) (-589.293) [-588.146] (-591.027) * (-588.905) (-588.754) [-590.701] (-589.484) -- 0:00:17
721000 -- (-587.680) (-591.657) (-589.324) [-588.026] * (-589.218) [-589.615] (-589.229) (-588.531) -- 0:00:17
721500 -- (-590.620) [-589.405] (-591.236) (-592.793) * (-587.449) (-588.124) (-589.211) [-588.124] -- 0:00:17
722000 -- (-593.128) [-591.528] (-588.448) (-589.254) * (-594.224) [-587.599] (-591.546) (-589.670) -- 0:00:17
722500 -- (-587.810) [-588.413] (-590.302) (-589.705) * (-588.903) (-588.998) [-589.266] (-589.737) -- 0:00:17
723000 -- [-588.460] (-588.061) (-590.432) (-589.793) * (-587.525) (-590.003) [-588.596] (-593.881) -- 0:00:17
723500 -- (-590.448) (-590.902) (-591.670) [-592.665] * (-595.194) (-589.543) [-587.877] (-588.467) -- 0:00:17
724000 -- (-587.982) (-589.128) (-590.869) [-591.863] * (-592.932) [-588.126] (-592.353) (-588.041) -- 0:00:17
724500 -- [-589.184] (-588.877) (-588.682) (-589.788) * (-598.415) (-588.518) [-588.319] (-588.476) -- 0:00:17
725000 -- (-590.777) [-591.608] (-589.370) (-591.331) * [-592.194] (-588.270) (-593.010) (-589.530) -- 0:00:17
Average standard deviation of split frequencies: 0.008725
725500 -- [-592.942] (-587.791) (-597.242) (-595.723) * (-589.980) (-589.940) [-588.063] (-588.249) -- 0:00:17
726000 -- (-591.843) (-592.799) (-590.336) [-591.914] * (-593.002) (-593.138) [-588.481] (-588.323) -- 0:00:16
726500 -- (-588.758) [-588.141] (-589.301) (-590.989) * (-590.162) [-588.261] (-589.621) (-591.138) -- 0:00:16
727000 -- (-588.784) (-591.152) [-588.559] (-590.218) * (-589.924) [-588.302] (-589.732) (-588.825) -- 0:00:16
727500 -- (-589.826) [-595.806] (-588.801) (-590.080) * (-590.525) (-591.471) (-588.970) [-588.187] -- 0:00:16
728000 -- [-588.487] (-588.184) (-588.184) (-589.716) * (-591.888) [-589.167] (-589.960) (-590.888) -- 0:00:16
728500 -- (-589.803) (-588.024) [-587.858] (-589.429) * (-593.569) (-587.764) (-587.870) [-591.155] -- 0:00:16
729000 -- (-588.699) (-587.980) [-588.352] (-588.614) * (-589.538) (-588.361) (-588.555) [-591.072] -- 0:00:16
729500 -- (-589.057) (-588.524) [-589.782] (-588.913) * [-589.063] (-587.953) (-589.881) (-589.922) -- 0:00:16
730000 -- (-595.180) (-590.567) (-592.652) [-590.220] * (-592.108) (-589.006) (-591.240) [-592.182] -- 0:00:17
Average standard deviation of split frequencies: 0.008559
730500 -- (-589.624) (-589.762) [-588.833] (-592.766) * [-588.498] (-588.034) (-587.472) (-590.084) -- 0:00:16
731000 -- (-588.548) (-591.184) (-589.445) [-589.366] * (-595.185) (-589.393) [-588.955] (-588.024) -- 0:00:16
731500 -- (-589.747) (-593.630) [-588.088] (-590.225) * (-590.432) (-592.011) (-590.858) [-591.081] -- 0:00:16
732000 -- [-590.545] (-593.897) (-593.608) (-589.727) * (-588.152) [-589.194] (-590.214) (-588.932) -- 0:00:16
732500 -- (-588.625) (-590.676) (-592.502) [-588.715] * (-591.379) (-591.171) (-587.837) [-590.178] -- 0:00:16
733000 -- (-591.358) [-587.954] (-597.166) (-588.283) * [-589.214] (-587.860) (-593.506) (-589.559) -- 0:00:16
733500 -- (-589.345) (-588.828) [-590.479] (-588.128) * (-590.755) (-588.668) [-591.095] (-589.948) -- 0:00:16
734000 -- (-591.399) (-588.308) [-589.099] (-590.061) * (-589.294) (-590.491) [-590.100] (-591.108) -- 0:00:16
734500 -- (-588.982) [-587.523] (-590.722) (-589.065) * (-591.157) (-591.072) [-588.487] (-590.397) -- 0:00:16
735000 -- (-590.074) (-587.633) [-591.646] (-588.851) * (-589.207) (-592.734) [-588.283] (-588.132) -- 0:00:16
Average standard deviation of split frequencies: 0.008967
735500 -- (-588.622) (-588.875) [-588.666] (-593.289) * (-591.890) (-589.960) (-587.892) [-587.660] -- 0:00:16
736000 -- (-589.907) [-588.399] (-589.101) (-589.936) * (-592.015) (-591.471) [-591.499] (-587.665) -- 0:00:16
736500 -- [-590.220] (-590.603) (-592.220) (-590.003) * (-591.757) [-589.877] (-589.406) (-589.855) -- 0:00:16
737000 -- (-588.715) [-589.633] (-588.604) (-588.246) * [-593.896] (-587.694) (-591.363) (-588.015) -- 0:00:16
737500 -- (-588.958) (-589.801) [-592.920] (-587.439) * (-590.908) [-587.910] (-590.762) (-589.798) -- 0:00:16
738000 -- (-589.250) (-589.653) [-589.993] (-588.138) * (-588.635) [-587.913] (-594.301) (-591.157) -- 0:00:16
738500 -- (-589.196) [-591.610] (-589.459) (-588.801) * (-589.350) (-590.403) (-590.623) [-590.269] -- 0:00:16
739000 -- [-591.577] (-588.100) (-590.465) (-590.553) * (-594.812) (-592.160) [-587.761] (-587.665) -- 0:00:16
739500 -- (-593.251) (-591.353) (-590.153) [-590.397] * (-593.041) (-592.832) (-592.727) [-591.174] -- 0:00:16
740000 -- [-592.579] (-588.981) (-590.512) (-589.150) * (-593.820) (-588.270) (-590.880) [-588.287] -- 0:00:16
Average standard deviation of split frequencies: 0.009268
740500 -- (-589.332) [-589.023] (-591.133) (-590.901) * (-589.167) (-588.973) [-589.672] (-591.045) -- 0:00:16
741000 -- (-589.284) [-590.667] (-589.659) (-590.499) * (-594.323) (-589.566) [-590.470] (-591.771) -- 0:00:16
741500 -- [-592.789] (-588.993) (-588.358) (-588.545) * [-587.749] (-589.073) (-592.871) (-589.710) -- 0:00:16
742000 -- [-592.050] (-588.806) (-589.080) (-589.177) * [-588.901] (-591.681) (-593.049) (-589.838) -- 0:00:15
742500 -- (-589.088) (-588.772) [-590.703] (-588.850) * [-588.945] (-592.644) (-589.633) (-592.523) -- 0:00:15
743000 -- (-589.820) (-589.095) (-592.531) [-587.762] * (-590.069) (-591.027) (-590.231) [-590.229] -- 0:00:15
743500 -- [-588.971] (-590.644) (-588.341) (-590.931) * (-588.820) [-588.971] (-590.147) (-592.780) -- 0:00:15
744000 -- (-589.310) [-598.346] (-591.822) (-588.767) * (-590.572) (-588.905) (-592.616) [-588.746] -- 0:00:15
744500 -- (-588.184) (-591.603) (-587.924) [-590.603] * (-588.858) (-589.968) [-591.463] (-588.151) -- 0:00:15
745000 -- (-588.814) [-589.800] (-587.814) (-589.177) * (-591.593) [-591.865] (-588.816) (-588.576) -- 0:00:15
Average standard deviation of split frequencies: 0.008926
745500 -- (-588.988) (-588.050) (-589.083) [-588.579] * (-587.880) (-596.869) (-590.027) [-589.082] -- 0:00:15
746000 -- (-591.793) (-588.578) [-589.362] (-588.007) * (-588.922) (-587.888) [-593.383] (-589.599) -- 0:00:16
746500 -- (-590.289) [-589.793] (-590.258) (-589.843) * (-589.907) (-587.775) [-588.327] (-591.491) -- 0:00:15
747000 -- (-588.243) (-589.138) (-591.485) [-588.280] * (-591.428) (-588.372) [-589.042] (-589.994) -- 0:00:15
747500 -- (-591.720) (-590.320) [-588.336] (-591.232) * [-589.138] (-588.871) (-590.294) (-591.512) -- 0:00:15
748000 -- (-590.474) [-591.125] (-588.665) (-589.032) * [-588.729] (-589.527) (-589.233) (-590.604) -- 0:00:15
748500 -- (-590.456) [-588.256] (-588.160) (-590.366) * (-593.387) (-588.544) [-588.563] (-588.309) -- 0:00:15
749000 -- [-590.226] (-589.404) (-590.674) (-588.047) * (-589.184) (-589.218) (-590.952) [-588.809] -- 0:00:15
749500 -- (-591.947) (-594.441) [-587.623] (-589.284) * (-588.353) (-590.963) (-590.088) [-588.837] -- 0:00:15
750000 -- (-589.918) [-590.406] (-587.423) (-588.496) * (-599.352) (-591.232) (-592.987) [-589.164] -- 0:00:15
Average standard deviation of split frequencies: 0.009145
750500 -- (-587.507) (-588.032) (-590.796) [-588.152] * (-591.406) (-588.933) [-587.788] (-588.379) -- 0:00:15
751000 -- (-589.035) (-591.400) [-588.119] (-588.947) * (-594.093) (-588.571) (-591.813) [-589.383] -- 0:00:15
751500 -- (-588.350) (-592.021) [-588.612] (-593.691) * [-588.688] (-589.914) (-588.423) (-589.938) -- 0:00:15
752000 -- (-588.350) (-591.305) (-594.128) [-587.635] * (-588.717) (-589.296) [-595.686] (-589.335) -- 0:00:15
752500 -- [-588.280] (-589.810) (-587.508) (-590.446) * (-589.547) (-588.473) [-591.110] (-593.254) -- 0:00:15
753000 -- (-590.242) [-587.419] (-587.526) (-588.320) * (-587.934) (-591.488) [-588.773] (-589.906) -- 0:00:15
753500 -- [-588.996] (-587.830) (-591.742) (-591.469) * [-589.903] (-592.764) (-590.421) (-587.359) -- 0:00:15
754000 -- (-588.839) (-588.927) [-592.129] (-588.352) * (-593.187) (-588.499) [-588.130] (-587.378) -- 0:00:15
754500 -- (-588.645) (-589.635) [-589.914] (-588.135) * (-589.779) [-589.038] (-590.942) (-587.659) -- 0:00:15
755000 -- (-588.553) (-591.124) (-596.040) [-589.270] * (-587.926) [-594.135] (-588.502) (-589.652) -- 0:00:15
Average standard deviation of split frequencies: 0.009314
755500 -- [-588.643] (-588.552) (-589.351) (-588.385) * [-589.289] (-588.898) (-590.134) (-588.785) -- 0:00:15
756000 -- (-589.443) (-587.608) [-588.615] (-592.911) * [-591.805] (-589.245) (-590.891) (-589.274) -- 0:00:15
756500 -- [-590.913] (-587.740) (-588.685) (-588.493) * [-591.129] (-588.427) (-590.040) (-589.142) -- 0:00:15
757000 -- [-590.558] (-589.273) (-590.947) (-588.660) * [-589.765] (-588.967) (-589.232) (-592.476) -- 0:00:15
757500 -- [-587.574] (-593.066) (-589.821) (-589.553) * (-589.007) [-591.005] (-590.362) (-592.446) -- 0:00:15
758000 -- (-589.247) (-591.440) [-594.707] (-588.107) * (-589.718) (-588.584) [-591.414] (-587.730) -- 0:00:15
758500 -- (-593.716) (-594.953) [-591.537] (-590.732) * (-588.083) (-590.326) (-588.164) [-589.973] -- 0:00:14
759000 -- [-591.247] (-593.190) (-590.488) (-588.305) * (-590.999) (-588.670) (-588.031) [-589.405] -- 0:00:14
759500 -- (-596.666) (-588.605) [-589.381] (-590.020) * (-589.154) [-589.540] (-588.175) (-589.114) -- 0:00:14
760000 -- (-588.790) [-590.848] (-587.860) (-589.780) * (-588.519) (-591.946) [-588.573] (-589.943) -- 0:00:14
Average standard deviation of split frequencies: 0.009296
760500 -- (-592.186) [-591.334] (-589.311) (-588.411) * (-592.066) (-591.812) (-589.740) [-589.805] -- 0:00:15
761000 -- (-593.977) (-589.148) (-597.170) [-588.282] * (-589.521) (-595.511) [-590.438] (-590.045) -- 0:00:15
761500 -- [-588.973] (-592.568) (-587.970) (-590.346) * [-589.749] (-591.946) (-590.518) (-590.331) -- 0:00:15
762000 -- (-588.050) [-589.982] (-589.114) (-588.415) * (-595.113) [-588.986] (-594.082) (-587.798) -- 0:00:14
762500 -- (-589.502) (-593.692) [-589.661] (-588.368) * (-590.278) [-587.509] (-590.850) (-588.261) -- 0:00:14
763000 -- (-590.217) (-588.973) [-589.641] (-587.917) * (-587.611) (-589.064) [-588.498] (-588.305) -- 0:00:14
763500 -- [-589.615] (-589.411) (-589.457) (-588.711) * (-588.868) (-587.930) (-588.811) [-587.805] -- 0:00:14
764000 -- (-590.195) (-588.369) (-589.092) [-591.129] * [-589.879] (-587.264) (-593.878) (-588.310) -- 0:00:14
764500 -- (-587.994) (-588.421) (-587.909) [-589.320] * [-590.831] (-589.977) (-592.317) (-588.217) -- 0:00:14
765000 -- (-588.220) [-588.948] (-593.481) (-590.963) * (-589.584) (-589.794) (-590.701) [-589.226] -- 0:00:14
Average standard deviation of split frequencies: 0.009231
765500 -- [-590.329] (-592.019) (-592.934) (-588.506) * (-587.806) [-590.575] (-588.021) (-590.076) -- 0:00:14
766000 -- (-589.093) (-589.123) (-589.313) [-593.363] * (-587.785) (-588.460) [-588.203] (-590.691) -- 0:00:14
766500 -- [-588.967] (-592.930) (-590.324) (-591.334) * (-588.449) (-589.923) [-588.340] (-591.051) -- 0:00:14
767000 -- (-587.609) (-590.417) (-592.411) [-591.330] * (-588.053) (-589.899) [-587.685] (-589.502) -- 0:00:14
767500 -- (-591.602) (-588.948) (-587.898) [-589.082] * (-589.954) (-588.516) [-589.012] (-588.784) -- 0:00:14
768000 -- (-590.956) (-588.750) (-589.000) [-594.327] * (-592.198) (-588.932) (-590.625) [-587.657] -- 0:00:14
768500 -- [-588.944] (-589.975) (-590.413) (-592.863) * (-590.034) [-588.240] (-591.428) (-592.492) -- 0:00:14
769000 -- (-589.687) [-590.217] (-588.163) (-591.300) * [-591.655] (-590.540) (-588.394) (-592.089) -- 0:00:14
769500 -- (-589.942) [-588.033] (-590.263) (-590.848) * (-589.601) (-589.921) (-589.226) [-590.012] -- 0:00:14
770000 -- [-592.470] (-587.899) (-587.442) (-590.074) * (-590.333) (-591.690) [-587.942] (-589.780) -- 0:00:14
Average standard deviation of split frequencies: 0.009022
770500 -- (-590.386) [-589.224] (-591.436) (-588.303) * [-588.434] (-588.425) (-591.054) (-587.630) -- 0:00:14
771000 -- [-589.868] (-593.154) (-590.959) (-593.774) * (-591.263) (-590.204) (-589.395) [-587.813] -- 0:00:14
771500 -- (-588.826) [-589.288] (-592.035) (-587.801) * (-589.909) (-590.735) [-589.673] (-591.580) -- 0:00:14
772000 -- [-589.226] (-588.577) (-591.771) (-588.386) * [-589.601] (-591.609) (-589.345) (-589.517) -- 0:00:14
772500 -- (-588.166) (-589.053) [-588.312] (-591.101) * (-592.562) (-588.750) [-591.328] (-591.586) -- 0:00:14
773000 -- (-591.294) [-589.573] (-589.399) (-589.142) * (-593.721) (-590.228) (-589.702) [-589.130] -- 0:00:14
773500 -- (-590.745) [-589.152] (-591.314) (-592.620) * (-588.203) [-594.310] (-588.018) (-591.309) -- 0:00:14
774000 -- [-590.700] (-589.607) (-591.227) (-588.630) * (-590.193) [-590.288] (-588.148) (-590.984) -- 0:00:14
774500 -- [-593.776] (-589.118) (-590.390) (-591.983) * [-588.823] (-588.209) (-588.260) (-590.409) -- 0:00:14
775000 -- [-590.281] (-593.368) (-594.258) (-590.114) * (-590.862) (-588.331) [-588.644] (-587.877) -- 0:00:14
Average standard deviation of split frequencies: 0.008581
775500 -- (-589.047) (-591.996) (-591.250) [-591.420] * (-588.832) [-593.461] (-590.002) (-588.804) -- 0:00:14
776000 -- (-588.464) (-588.259) [-593.310] (-589.957) * (-588.327) (-589.866) (-588.941) [-590.686] -- 0:00:14
776500 -- (-588.459) (-587.747) (-593.721) [-589.342] * (-588.427) (-589.557) (-592.640) [-588.243] -- 0:00:14
777000 -- (-588.318) (-588.511) [-589.617] (-590.706) * (-592.903) [-590.850] (-590.602) (-592.816) -- 0:00:14
777500 -- (-589.104) (-587.901) (-590.350) [-588.962] * (-588.356) (-590.732) (-589.228) [-590.660] -- 0:00:14
778000 -- (-590.042) (-589.472) (-587.598) [-590.083] * [-588.437] (-589.155) (-590.528) (-588.050) -- 0:00:13
778500 -- (-591.338) [-589.385] (-590.681) (-591.206) * (-588.240) (-588.853) (-590.257) [-589.603] -- 0:00:13
779000 -- [-592.257] (-589.404) (-588.815) (-590.603) * (-588.404) (-589.154) (-592.223) [-589.333] -- 0:00:13
779500 -- (-590.325) (-587.873) (-591.058) [-589.249] * (-589.181) (-593.374) [-588.896] (-590.755) -- 0:00:13
780000 -- (-592.073) [-588.811] (-592.806) (-590.770) * [-589.249] (-589.875) (-588.375) (-593.790) -- 0:00:13
Average standard deviation of split frequencies: 0.008227
780500 -- (-591.669) [-589.910] (-591.318) (-590.824) * (-588.701) [-590.365] (-592.684) (-589.691) -- 0:00:13
781000 -- (-592.858) (-591.573) [-591.183] (-590.714) * (-588.737) [-588.656] (-590.909) (-588.015) -- 0:00:13
781500 -- [-589.617] (-589.362) (-590.496) (-589.630) * [-588.777] (-590.208) (-588.326) (-588.064) -- 0:00:13
782000 -- (-587.892) (-589.201) (-589.068) [-590.464] * [-588.124] (-591.626) (-589.885) (-589.666) -- 0:00:13
782500 -- (-588.861) [-592.449] (-590.957) (-589.244) * (-589.409) (-589.856) (-587.764) [-590.591] -- 0:00:13
783000 -- (-589.739) (-589.734) (-594.276) [-589.617] * (-590.536) (-590.127) (-593.372) [-588.234] -- 0:00:13
783500 -- (-589.317) [-588.533] (-591.647) (-589.184) * (-593.205) (-589.499) [-588.973] (-591.482) -- 0:00:13
784000 -- [-588.079] (-590.252) (-594.173) (-591.017) * (-588.970) (-588.448) [-589.542] (-589.863) -- 0:00:13
784500 -- (-591.784) (-588.417) (-588.376) [-590.116] * (-591.525) (-589.090) [-587.746] (-589.869) -- 0:00:13
785000 -- [-589.613] (-589.484) (-588.388) (-590.845) * (-593.101) (-592.431) (-588.638) [-589.603] -- 0:00:13
Average standard deviation of split frequencies: 0.008397
785500 -- (-590.736) (-593.367) [-590.293] (-591.915) * (-588.497) (-592.083) [-589.605] (-589.594) -- 0:00:13
786000 -- [-590.200] (-593.342) (-592.125) (-588.936) * (-591.148) [-587.562] (-592.610) (-591.405) -- 0:00:13
786500 -- (-588.425) (-590.754) [-592.919] (-590.050) * (-589.580) [-588.145] (-590.474) (-593.855) -- 0:00:13
787000 -- (-588.571) [-589.030] (-592.494) (-592.701) * (-588.856) (-589.063) [-588.814] (-588.628) -- 0:00:13
787500 -- (-589.040) [-589.947] (-588.323) (-590.296) * [-590.338] (-591.782) (-594.205) (-592.249) -- 0:00:13
788000 -- (-591.752) (-589.870) (-591.500) [-591.000] * (-591.566) (-589.211) (-590.470) [-589.099] -- 0:00:13
788500 -- (-588.895) [-588.804] (-588.856) (-589.727) * (-594.478) [-589.784] (-592.733) (-589.340) -- 0:00:13
789000 -- [-589.027] (-589.552) (-593.101) (-587.696) * (-589.081) [-589.897] (-588.303) (-587.418) -- 0:00:13
789500 -- (-590.870) (-592.548) (-590.109) [-589.717] * (-592.657) (-594.707) [-588.535] (-588.582) -- 0:00:13
790000 -- (-588.048) (-589.099) [-588.403] (-593.031) * (-590.649) [-589.237] (-588.429) (-590.604) -- 0:00:13
Average standard deviation of split frequencies: 0.008421
790500 -- [-589.810] (-592.493) (-587.253) (-595.438) * (-592.560) (-590.652) [-590.479] (-589.483) -- 0:00:12
791000 -- (-589.355) (-590.385) [-588.647] (-591.388) * (-591.749) (-590.751) (-595.154) [-587.617] -- 0:00:13
791500 -- (-590.924) (-590.851) [-589.568] (-590.720) * (-590.660) [-588.941] (-594.173) (-587.564) -- 0:00:13
792000 -- (-588.018) (-594.608) [-588.510] (-589.540) * (-590.296) (-588.561) [-593.347] (-587.933) -- 0:00:13
792500 -- (-592.042) (-589.417) (-595.848) [-588.826] * (-590.058) (-589.136) [-590.327] (-593.807) -- 0:00:13
793000 -- (-589.013) (-588.273) [-588.099] (-589.861) * [-587.563] (-590.965) (-588.302) (-590.585) -- 0:00:13
793500 -- (-590.500) (-589.152) (-589.810) [-592.854] * (-589.164) (-589.917) (-593.584) [-592.018] -- 0:00:13
794000 -- (-592.171) (-588.882) (-591.590) [-590.314] * (-589.618) [-598.016] (-592.732) (-592.641) -- 0:00:12
794500 -- [-589.105] (-589.987) (-588.968) (-593.968) * (-588.796) (-587.353) (-592.756) [-593.567] -- 0:00:12
795000 -- (-589.346) [-588.732] (-589.798) (-593.128) * (-588.235) (-589.511) [-591.380] (-588.292) -- 0:00:12
Average standard deviation of split frequencies: 0.008439
795500 -- (-592.515) (-589.133) (-589.208) [-589.989] * (-590.574) (-589.527) (-589.879) [-588.305] -- 0:00:12
796000 -- (-590.720) (-589.657) (-589.415) [-589.111] * [-590.076] (-589.899) (-587.912) (-588.470) -- 0:00:12
796500 -- (-587.659) [-588.923] (-588.837) (-589.116) * (-590.331) (-590.466) (-589.442) [-588.331] -- 0:00:12
797000 -- (-592.145) [-589.816] (-589.680) (-589.578) * (-590.643) [-591.069] (-589.269) (-588.321) -- 0:00:12
797500 -- [-590.407] (-587.896) (-587.675) (-588.804) * (-590.896) (-588.744) (-589.847) [-588.012] -- 0:00:12
798000 -- (-589.310) (-588.185) [-588.350] (-588.085) * (-591.006) (-590.426) [-587.453] (-588.218) -- 0:00:12
798500 -- (-590.487) (-589.786) [-589.700] (-588.860) * (-588.898) (-594.197) (-589.761) [-591.859] -- 0:00:12
799000 -- (-590.617) (-590.863) (-588.128) [-589.630] * (-588.914) (-591.301) (-588.629) [-589.878] -- 0:00:12
799500 -- (-592.730) [-591.017] (-595.083) (-589.207) * [-592.569] (-590.270) (-587.788) (-589.969) -- 0:00:12
800000 -- [-590.635] (-589.386) (-588.766) (-589.291) * (-588.732) [-591.418] (-589.193) (-592.363) -- 0:00:12
Average standard deviation of split frequencies: 0.007912
800500 -- (-590.162) (-588.134) (-590.616) [-590.386] * (-587.918) [-588.465] (-591.144) (-590.540) -- 0:00:12
801000 -- (-591.589) (-588.835) (-590.867) [-592.092] * [-589.457] (-589.244) (-588.892) (-589.162) -- 0:00:12
801500 -- [-588.012] (-590.940) (-588.781) (-589.034) * (-590.315) (-591.553) [-591.192] (-593.702) -- 0:00:12
802000 -- (-594.183) [-592.883] (-588.623) (-591.900) * (-591.057) (-589.640) [-591.249] (-591.464) -- 0:00:12
802500 -- (-597.068) (-588.308) [-589.766] (-595.049) * (-590.128) (-590.088) (-589.520) [-588.257] -- 0:00:12
803000 -- (-590.161) (-589.586) [-593.710] (-588.330) * (-589.043) [-587.416] (-588.502) (-589.932) -- 0:00:12
803500 -- (-593.437) (-588.883) [-591.298] (-588.541) * (-590.947) [-589.877] (-590.286) (-591.237) -- 0:00:12
804000 -- (-597.572) [-590.248] (-594.388) (-588.079) * (-591.598) [-588.000] (-591.179) (-590.390) -- 0:00:12
804500 -- (-592.937) (-592.365) (-593.539) [-590.956] * [-589.166] (-588.383) (-588.559) (-590.911) -- 0:00:12
805000 -- (-588.374) (-590.972) (-591.078) [-590.277] * (-591.495) (-590.258) [-587.796] (-589.515) -- 0:00:12
Average standard deviation of split frequencies: 0.007676
805500 -- (-591.337) (-588.553) (-589.422) [-589.841] * [-589.952] (-589.203) (-592.464) (-590.092) -- 0:00:12
806000 -- (-587.467) (-588.874) [-590.894] (-589.314) * (-588.948) [-588.609] (-592.357) (-593.592) -- 0:00:12
806500 -- [-591.515] (-589.004) (-587.614) (-591.252) * (-590.613) (-587.629) (-591.770) [-590.861] -- 0:00:11
807000 -- (-588.207) (-588.788) [-587.635] (-592.142) * (-588.116) (-587.555) (-591.289) [-591.389] -- 0:00:11
807500 -- (-588.054) (-589.421) [-587.675] (-588.433) * (-588.348) (-587.883) [-589.965] (-589.659) -- 0:00:12
808000 -- (-587.969) (-590.498) [-589.660] (-589.159) * (-590.019) [-588.287] (-588.840) (-590.650) -- 0:00:12
808500 -- (-588.211) (-591.788) (-592.060) [-588.072] * (-588.355) (-587.688) [-588.421] (-592.008) -- 0:00:12
809000 -- [-587.755] (-592.277) (-591.819) (-590.227) * (-590.169) (-588.706) [-592.571] (-591.176) -- 0:00:12
809500 -- (-589.421) (-589.493) (-592.438) [-593.223] * (-590.968) (-588.380) (-589.024) [-588.980] -- 0:00:12
810000 -- (-589.321) (-590.299) [-591.700] (-587.684) * (-591.142) (-588.257) (-588.818) [-590.673] -- 0:00:11
Average standard deviation of split frequencies: 0.007414
810500 -- [-588.824] (-588.734) (-589.391) (-593.570) * (-591.373) (-588.655) (-588.694) [-588.381] -- 0:00:11
811000 -- (-590.380) [-590.739] (-587.479) (-590.142) * (-588.279) (-593.312) (-593.656) [-587.808] -- 0:00:11
811500 -- (-594.207) (-590.478) (-588.858) [-591.106] * (-589.613) [-590.287] (-589.184) (-588.724) -- 0:00:11
812000 -- [-592.049] (-588.972) (-588.108) (-590.628) * (-595.272) (-588.223) [-588.719] (-588.793) -- 0:00:11
812500 -- (-588.403) (-591.741) [-588.312] (-589.134) * [-587.582] (-589.346) (-589.341) (-589.896) -- 0:00:11
813000 -- (-589.561) [-589.152] (-590.196) (-589.761) * [-590.429] (-589.274) (-587.938) (-590.641) -- 0:00:11
813500 -- (-589.720) (-589.437) [-590.036] (-588.201) * [-588.306] (-587.618) (-588.534) (-588.811) -- 0:00:11
814000 -- (-588.364) (-590.053) [-588.423] (-591.298) * (-589.558) [-588.404] (-590.130) (-588.312) -- 0:00:11
814500 -- (-590.129) (-591.177) (-591.197) [-591.452] * (-590.519) (-590.546) [-587.472] (-589.177) -- 0:00:11
815000 -- (-590.520) (-589.969) (-591.815) [-594.739] * (-590.636) [-589.765] (-589.024) (-588.873) -- 0:00:11
Average standard deviation of split frequencies: 0.007618
815500 -- [-588.869] (-590.233) (-589.036) (-594.036) * (-587.851) [-591.778] (-588.113) (-593.774) -- 0:00:11
816000 -- (-588.425) (-588.211) [-589.337] (-589.660) * [-588.705] (-595.928) (-588.085) (-592.970) -- 0:00:11
816500 -- (-588.160) (-588.948) (-587.421) [-588.152] * (-590.497) (-592.892) [-587.736] (-591.223) -- 0:00:11
817000 -- (-588.191) (-588.531) [-588.991] (-592.452) * (-588.200) [-588.441] (-588.586) (-589.756) -- 0:00:11
817500 -- [-588.985] (-590.359) (-588.291) (-588.780) * (-589.228) (-587.423) (-588.647) [-590.826] -- 0:00:11
818000 -- (-589.474) [-589.077] (-589.233) (-589.190) * (-588.966) [-588.646] (-590.131) (-592.217) -- 0:00:11
818500 -- (-589.082) (-589.005) (-588.672) [-589.299] * (-591.923) [-592.167] (-587.964) (-589.862) -- 0:00:11
819000 -- (-590.398) (-589.651) [-590.450] (-589.400) * (-591.232) (-595.053) (-587.799) [-588.521] -- 0:00:11
819500 -- [-589.346] (-588.546) (-588.238) (-594.950) * (-589.253) [-587.617] (-589.021) (-589.788) -- 0:00:11
820000 -- [-588.015] (-588.680) (-589.766) (-588.690) * [-589.242] (-587.669) (-589.030) (-591.630) -- 0:00:11
Average standard deviation of split frequencies: 0.007647
820500 -- [-588.559] (-588.577) (-594.385) (-588.080) * (-588.160) [-587.817] (-589.938) (-596.588) -- 0:00:11
821000 -- (-589.774) (-589.226) [-592.272] (-591.247) * [-589.311] (-588.854) (-590.301) (-591.411) -- 0:00:11
821500 -- [-593.956] (-588.317) (-592.659) (-587.532) * (-588.847) (-588.477) [-589.453] (-590.934) -- 0:00:11
822000 -- (-589.789) (-590.323) [-590.152] (-593.412) * (-587.907) [-592.601] (-588.161) (-589.620) -- 0:00:11
822500 -- (-590.516) [-588.581] (-588.704) (-590.635) * (-588.304) [-592.313] (-588.908) (-588.481) -- 0:00:11
823000 -- [-589.053] (-590.044) (-588.482) (-587.424) * (-589.428) [-588.484] (-588.791) (-589.261) -- 0:00:10
823500 -- (-590.556) [-590.484] (-588.959) (-591.196) * (-589.697) (-589.401) [-589.371] (-592.030) -- 0:00:10
824000 -- [-588.437] (-592.926) (-588.207) (-589.386) * (-590.642) (-592.718) [-587.873] (-589.571) -- 0:00:10
824500 -- (-587.901) [-588.027] (-588.053) (-588.279) * (-589.630) (-591.060) [-587.525] (-590.852) -- 0:00:11
825000 -- (-589.808) (-588.568) (-589.402) [-588.869] * (-591.863) (-589.314) (-588.097) [-588.547] -- 0:00:11
Average standard deviation of split frequencies: 0.007205
825500 -- (-587.706) (-594.446) [-590.205] (-590.600) * (-593.563) (-588.681) [-587.375] (-590.788) -- 0:00:10
826000 -- (-588.451) (-587.995) [-590.913] (-593.553) * (-589.524) [-589.416] (-587.546) (-589.164) -- 0:00:10
826500 -- (-590.872) (-589.150) (-589.698) [-595.226] * (-592.742) (-594.079) (-587.539) [-588.823] -- 0:00:10
827000 -- (-589.753) (-589.004) [-588.352] (-590.984) * (-592.530) (-590.022) (-587.762) [-591.347] -- 0:00:10
827500 -- (-589.300) (-591.770) (-589.393) [-588.540] * (-588.525) (-587.749) (-589.233) [-589.360] -- 0:00:10
828000 -- [-589.205] (-592.116) (-589.650) (-588.269) * (-589.359) (-592.262) (-588.142) [-587.806] -- 0:00:10
828500 -- (-597.531) (-588.985) (-592.478) [-587.712] * [-590.902] (-590.162) (-588.326) (-587.698) -- 0:00:10
829000 -- (-594.779) [-590.399] (-591.267) (-589.005) * (-591.041) [-591.554] (-587.877) (-592.167) -- 0:00:10
829500 -- (-596.651) [-589.264] (-589.451) (-588.288) * (-597.661) [-588.150] (-589.378) (-588.726) -- 0:00:10
830000 -- [-588.971] (-593.115) (-588.399) (-589.270) * (-590.166) [-589.192] (-593.211) (-588.214) -- 0:00:10
Average standard deviation of split frequencies: 0.007236
830500 -- (-590.862) (-588.424) [-589.256] (-588.909) * (-594.747) (-588.889) (-590.805) [-588.202] -- 0:00:10
831000 -- (-589.732) (-588.273) (-589.704) [-589.212] * (-595.184) (-588.517) (-587.488) [-588.048] -- 0:00:10
831500 -- (-589.433) (-589.445) [-588.159] (-588.141) * (-588.774) [-589.110] (-590.840) (-590.508) -- 0:00:10
832000 -- [-588.852] (-589.003) (-592.246) (-590.999) * (-588.936) (-590.247) [-589.508] (-594.169) -- 0:00:10
832500 -- (-595.610) [-591.425] (-589.316) (-588.314) * (-587.869) (-589.497) (-591.140) [-592.715] -- 0:00:10
833000 -- (-588.124) [-591.240] (-588.105) (-593.156) * (-590.443) [-591.709] (-588.219) (-595.274) -- 0:00:10
833500 -- (-587.942) [-587.738] (-587.728) (-589.669) * (-589.965) [-588.225] (-590.412) (-589.286) -- 0:00:10
834000 -- (-588.943) (-588.960) [-590.599] (-590.652) * (-588.440) [-587.425] (-591.349) (-591.022) -- 0:00:10
834500 -- (-592.232) [-587.919] (-590.038) (-590.001) * [-588.961] (-587.450) (-590.734) (-591.852) -- 0:00:10
835000 -- [-589.414] (-588.563) (-587.498) (-589.508) * (-589.845) (-587.852) [-590.467] (-590.446) -- 0:00:10
Average standard deviation of split frequencies: 0.006943
835500 -- (-588.483) (-590.252) [-589.716] (-590.227) * (-592.170) (-588.004) (-589.208) [-589.818] -- 0:00:10
836000 -- (-594.215) (-589.838) [-592.770] (-596.508) * (-592.705) [-589.624] (-587.936) (-591.308) -- 0:00:10
836500 -- (-591.228) (-592.691) [-588.774] (-590.310) * (-592.859) [-588.108] (-587.732) (-590.792) -- 0:00:10
837000 -- (-589.110) (-589.067) (-588.180) [-590.352] * (-589.675) (-588.242) [-592.965] (-591.001) -- 0:00:10
837500 -- (-592.089) (-587.421) [-588.220] (-589.996) * (-588.363) (-594.634) (-590.760) [-591.866] -- 0:00:10
838000 -- (-595.151) [-589.108] (-592.590) (-591.235) * (-590.543) [-590.831] (-589.222) (-587.753) -- 0:00:10
838500 -- (-589.970) (-590.407) (-591.063) [-589.317] * (-592.335) [-588.071] (-590.066) (-589.854) -- 0:00:10
839000 -- (-589.363) (-591.435) [-592.742] (-588.468) * [-591.482] (-589.651) (-590.254) (-590.623) -- 0:00:09
839500 -- (-588.833) (-589.667) [-588.479] (-589.978) * (-591.477) (-588.463) (-588.702) [-590.007] -- 0:00:09
840000 -- [-587.899] (-590.907) (-587.593) (-588.763) * (-589.001) (-589.279) (-589.070) [-588.295] -- 0:00:09
Average standard deviation of split frequencies: 0.006904
840500 -- (-588.376) (-590.473) (-588.755) [-589.973] * (-590.797) [-588.292] (-590.333) (-587.938) -- 0:00:09
841000 -- [-589.370] (-594.573) (-587.982) (-593.392) * (-590.331) [-588.993] (-598.903) (-593.489) -- 0:00:10
841500 -- [-588.409] (-591.169) (-588.480) (-594.025) * (-588.746) [-587.944] (-591.094) (-588.693) -- 0:00:09
842000 -- (-589.839) [-590.467] (-588.508) (-594.676) * (-590.273) (-587.793) (-588.440) [-588.208] -- 0:00:09
842500 -- (-594.877) (-587.245) (-589.939) [-593.219] * (-587.910) [-588.163] (-588.212) (-588.715) -- 0:00:09
843000 -- (-591.618) (-588.998) (-588.623) [-587.768] * (-590.797) (-587.938) (-589.018) [-588.831] -- 0:00:09
843500 -- (-595.925) [-590.551] (-590.648) (-588.871) * (-595.947) [-589.630] (-588.611) (-590.393) -- 0:00:09
844000 -- (-591.250) [-588.537] (-592.108) (-589.258) * (-591.565) [-590.767] (-591.156) (-588.804) -- 0:00:09
844500 -- (-588.389) [-589.330] (-589.210) (-589.406) * [-589.441] (-587.968) (-588.248) (-589.155) -- 0:00:09
845000 -- (-595.099) [-596.413] (-588.515) (-589.791) * (-588.416) (-587.675) [-589.568] (-588.577) -- 0:00:09
Average standard deviation of split frequencies: 0.007000
845500 -- [-588.092] (-589.526) (-589.182) (-588.399) * (-588.840) (-589.402) (-589.061) [-587.796] -- 0:00:09
846000 -- (-588.914) (-591.336) [-589.892] (-587.953) * (-591.027) (-590.772) [-587.863] (-589.368) -- 0:00:09
846500 -- (-590.580) [-589.367] (-589.700) (-587.526) * [-589.971] (-588.636) (-589.134) (-588.683) -- 0:00:09
847000 -- (-592.464) (-592.178) (-589.891) [-593.692] * (-589.225) (-592.948) (-591.429) [-595.061] -- 0:00:09
847500 -- [-590.586] (-588.643) (-589.755) (-589.608) * [-589.203] (-589.944) (-595.997) (-590.531) -- 0:00:09
848000 -- (-592.218) (-588.381) [-588.775] (-589.880) * [-587.543] (-591.266) (-592.414) (-592.917) -- 0:00:09
848500 -- (-591.467) (-595.172) [-593.253] (-592.446) * (-588.391) [-588.863] (-589.544) (-589.115) -- 0:00:09
849000 -- (-588.685) [-589.929] (-590.202) (-591.141) * (-590.235) [-589.874] (-589.133) (-590.058) -- 0:00:09
849500 -- (-588.634) (-589.623) [-588.087] (-589.336) * (-588.815) (-588.522) [-589.983] (-587.793) -- 0:00:09
850000 -- (-594.132) [-592.495] (-588.373) (-589.428) * (-589.957) (-588.804) (-589.310) [-591.467] -- 0:00:09
Average standard deviation of split frequencies: 0.006927
850500 -- (-594.036) (-588.263) [-589.250] (-589.642) * (-593.750) (-589.667) [-591.846] (-590.086) -- 0:00:09
851000 -- (-588.568) [-594.102] (-589.213) (-588.240) * (-595.502) [-592.278] (-593.871) (-589.887) -- 0:00:09
851500 -- [-588.552] (-590.712) (-588.149) (-587.510) * (-589.625) [-590.343] (-590.525) (-588.121) -- 0:00:09
852000 -- [-590.638] (-588.394) (-588.025) (-587.851) * [-590.854] (-588.827) (-587.889) (-588.531) -- 0:00:09
852500 -- (-591.204) [-587.826] (-587.415) (-587.813) * (-591.569) (-589.727) (-587.780) [-591.353] -- 0:00:09
853000 -- (-588.177) (-588.409) [-588.894] (-588.746) * (-588.939) (-590.314) [-588.333] (-591.118) -- 0:00:09
853500 -- (-588.211) (-589.493) [-589.649] (-589.210) * [-587.991] (-589.611) (-589.323) (-591.555) -- 0:00:09
854000 -- (-588.807) [-590.023] (-589.583) (-588.339) * [-587.839] (-589.581) (-591.621) (-588.685) -- 0:00:09
854500 -- (-588.995) (-593.280) [-588.846] (-588.430) * [-588.994] (-589.427) (-590.739) (-588.107) -- 0:00:09
855000 -- (-590.775) (-589.303) (-588.850) [-589.364] * (-594.031) (-589.090) [-591.317] (-591.276) -- 0:00:08
Average standard deviation of split frequencies: 0.007056
855500 -- (-589.890) (-597.074) (-589.163) [-588.917] * [-590.418] (-588.001) (-591.363) (-589.524) -- 0:00:08
856000 -- (-590.329) (-588.348) [-590.045] (-590.364) * (-587.637) (-589.304) (-590.607) [-589.084] -- 0:00:08
856500 -- [-587.944] (-588.848) (-588.669) (-590.450) * [-591.118] (-589.734) (-593.016) (-592.555) -- 0:00:08
857000 -- (-590.227) [-588.667] (-588.652) (-592.267) * (-587.914) (-588.926) [-588.431] (-588.658) -- 0:00:08
857500 -- (-591.170) (-589.774) [-594.608] (-588.882) * [-589.904] (-591.877) (-590.386) (-590.381) -- 0:00:08
858000 -- (-593.316) (-599.638) [-589.717] (-587.619) * (-588.388) (-589.654) [-588.889] (-588.207) -- 0:00:08
858500 -- (-595.846) [-598.208] (-591.260) (-588.124) * (-588.932) (-591.503) (-591.091) [-588.305] -- 0:00:08
859000 -- (-590.738) [-590.220] (-588.695) (-589.390) * [-593.562] (-590.109) (-589.548) (-591.723) -- 0:00:08
859500 -- (-591.491) [-588.535] (-589.227) (-590.619) * (-589.695) (-591.175) [-587.550] (-588.996) -- 0:00:08
860000 -- (-587.775) (-591.666) (-591.095) [-591.623] * (-589.358) (-591.324) (-587.157) [-587.487] -- 0:00:08
Average standard deviation of split frequencies: 0.006881
860500 -- (-588.032) (-591.667) [-588.177] (-589.607) * (-589.384) (-590.473) [-587.437] (-589.173) -- 0:00:08
861000 -- [-587.874] (-588.277) (-592.129) (-591.912) * (-591.655) [-588.773] (-588.097) (-589.391) -- 0:00:08
861500 -- (-588.772) [-588.211] (-594.473) (-589.569) * (-588.375) (-589.737) (-589.093) [-591.011] -- 0:00:08
862000 -- (-589.143) (-594.023) [-588.707] (-589.615) * (-590.642) (-588.989) [-588.602] (-589.212) -- 0:00:08
862500 -- [-588.950] (-590.913) (-589.595) (-589.672) * (-590.280) [-587.794] (-588.086) (-591.144) -- 0:00:08
863000 -- (-590.000) (-590.838) [-590.351] (-588.700) * (-590.684) (-588.536) [-589.793] (-587.801) -- 0:00:08
863500 -- (-588.989) [-592.863] (-589.468) (-589.592) * [-589.038] (-590.152) (-589.793) (-590.835) -- 0:00:08
864000 -- [-589.255] (-588.740) (-588.193) (-591.041) * [-590.020] (-588.569) (-588.253) (-589.520) -- 0:00:08
864500 -- [-589.804] (-589.155) (-588.221) (-591.402) * [-588.055] (-588.068) (-588.152) (-591.071) -- 0:00:08
865000 -- (-593.029) (-591.249) [-593.217] (-589.876) * [-588.156] (-589.669) (-590.281) (-589.793) -- 0:00:08
Average standard deviation of split frequencies: 0.006940
865500 -- [-589.887] (-588.135) (-590.063) (-590.584) * (-589.367) (-593.270) [-589.346] (-589.305) -- 0:00:08
866000 -- (-592.538) (-593.635) [-590.430] (-587.431) * (-588.622) [-591.113] (-592.001) (-588.875) -- 0:00:08
866500 -- (-594.908) [-590.067] (-589.214) (-589.182) * (-589.225) [-591.535] (-589.098) (-591.755) -- 0:00:08
867000 -- (-590.238) [-587.477] (-592.428) (-589.829) * [-590.455] (-591.146) (-591.355) (-592.678) -- 0:00:08
867500 -- [-589.860] (-594.820) (-589.936) (-591.890) * (-590.815) (-588.530) (-595.030) [-590.712] -- 0:00:08
868000 -- (-592.020) (-588.755) (-587.612) [-589.590] * (-591.070) [-589.070] (-587.915) (-587.885) -- 0:00:08
868500 -- (-591.793) (-588.989) (-588.094) [-589.819] * (-587.918) (-588.726) [-589.679] (-587.932) -- 0:00:08
869000 -- (-588.569) (-588.429) [-588.094] (-592.773) * (-589.895) (-587.889) [-589.375] (-588.286) -- 0:00:08
869500 -- (-588.235) (-592.343) [-589.320] (-593.460) * (-594.157) (-591.558) (-589.908) [-588.853] -- 0:00:08
870000 -- (-592.784) (-589.879) [-589.869] (-590.326) * (-591.256) (-590.250) [-589.441] (-589.080) -- 0:00:08
Average standard deviation of split frequencies: 0.006802
870500 -- [-589.181] (-588.164) (-589.502) (-588.983) * [-589.170] (-588.113) (-590.045) (-588.102) -- 0:00:08
871000 -- (-589.613) (-590.389) (-589.667) [-591.347] * (-591.404) (-588.573) (-590.529) [-587.603] -- 0:00:07
871500 -- (-588.858) [-593.140] (-588.906) (-588.337) * (-590.745) (-591.968) (-590.889) [-587.809] -- 0:00:07
872000 -- [-588.527] (-590.294) (-590.685) (-589.040) * (-588.955) (-594.761) [-589.910] (-589.848) -- 0:00:07
872500 -- [-591.194] (-592.382) (-588.196) (-592.276) * (-588.219) (-589.120) (-592.667) [-588.501] -- 0:00:07
873000 -- (-591.673) (-589.471) (-595.448) [-590.141] * (-589.060) [-588.425] (-591.345) (-587.719) -- 0:00:08
873500 -- (-588.345) (-590.252) [-590.593] (-588.997) * [-592.243] (-588.265) (-589.579) (-587.267) -- 0:00:07
874000 -- (-594.248) (-590.105) [-593.365] (-589.354) * (-590.172) (-589.225) (-591.070) [-588.247] -- 0:00:07
874500 -- (-589.889) (-588.765) (-588.958) [-587.723] * (-593.630) [-588.022] (-591.060) (-588.501) -- 0:00:07
875000 -- (-589.859) (-589.089) [-588.196] (-587.954) * (-594.273) (-588.708) [-588.038] (-592.864) -- 0:00:07
Average standard deviation of split frequencies: 0.006135
875500 -- (-592.952) [-588.135] (-588.114) (-590.521) * [-589.806] (-591.326) (-588.641) (-591.367) -- 0:00:07
876000 -- (-591.902) (-591.206) [-587.968] (-593.677) * [-587.676] (-589.248) (-588.508) (-589.504) -- 0:00:07
876500 -- [-592.771] (-591.778) (-589.482) (-595.542) * (-589.088) (-592.815) [-588.368] (-588.939) -- 0:00:07
877000 -- (-591.387) (-588.147) [-589.701] (-594.718) * (-588.806) (-589.687) [-588.269] (-593.075) -- 0:00:07
877500 -- (-592.109) (-589.137) (-590.136) [-592.234] * (-590.964) (-591.122) [-590.379] (-591.700) -- 0:00:07
878000 -- (-590.344) (-591.677) [-591.067] (-588.448) * [-589.288] (-594.838) (-590.159) (-588.849) -- 0:00:07
878500 -- (-589.670) (-589.729) (-593.371) [-588.484] * (-591.822) [-588.795] (-591.658) (-592.130) -- 0:00:07
879000 -- (-588.068) [-588.638] (-592.472) (-587.854) * (-589.659) (-588.266) (-589.161) [-593.399] -- 0:00:07
879500 -- (-588.207) (-587.990) (-593.094) [-589.787] * (-588.995) [-588.153] (-591.440) (-592.350) -- 0:00:07
880000 -- [-588.280] (-592.890) (-589.802) (-588.466) * (-589.075) [-591.819] (-590.611) (-587.830) -- 0:00:07
Average standard deviation of split frequencies: 0.005710
880500 -- (-592.199) (-589.164) [-591.920] (-590.165) * (-595.292) (-590.200) (-590.277) [-587.752] -- 0:00:07
881000 -- (-591.697) (-589.817) [-588.579] (-588.634) * (-590.717) [-588.110] (-590.053) (-588.910) -- 0:00:07
881500 -- (-589.421) (-589.834) [-588.315] (-588.265) * (-589.671) (-589.788) [-588.198] (-587.889) -- 0:00:07
882000 -- (-589.041) (-588.813) [-589.258] (-592.841) * (-593.596) (-588.239) [-590.563] (-591.499) -- 0:00:07
882500 -- [-590.347] (-589.490) (-590.555) (-590.053) * [-589.330] (-590.328) (-587.870) (-592.402) -- 0:00:07
883000 -- (-589.493) (-591.271) (-589.533) [-589.930] * (-588.004) (-587.782) (-588.393) [-589.867] -- 0:00:07
883500 -- (-591.659) [-588.662] (-589.019) (-588.175) * [-589.916] (-588.729) (-588.799) (-593.660) -- 0:00:07
884000 -- (-588.203) (-589.074) (-588.097) [-590.295] * [-588.079] (-588.220) (-590.351) (-588.939) -- 0:00:07
884500 -- [-589.828] (-591.501) (-589.833) (-589.019) * (-587.615) [-589.682] (-593.688) (-587.733) -- 0:00:07
885000 -- (-590.473) (-592.591) [-589.685] (-590.937) * [-590.135] (-591.911) (-588.158) (-589.232) -- 0:00:07
Average standard deviation of split frequencies: 0.005604
885500 -- (-589.507) [-590.243] (-589.660) (-591.933) * [-587.835] (-588.344) (-587.478) (-588.204) -- 0:00:07
886000 -- (-588.502) (-589.323) (-590.377) [-590.352] * (-588.597) (-590.379) (-588.465) [-589.731] -- 0:00:07
886500 -- (-589.159) (-598.014) (-589.795) [-589.300] * (-588.403) (-593.700) (-587.910) [-588.465] -- 0:00:07
887000 -- (-596.724) (-590.974) [-592.450] (-592.978) * (-588.791) [-590.438] (-588.261) (-588.371) -- 0:00:07
887500 -- (-588.949) [-589.225] (-589.512) (-591.462) * (-592.436) (-589.402) [-590.200] (-587.853) -- 0:00:06
888000 -- (-588.900) (-588.350) [-588.053] (-590.546) * (-592.042) [-588.059] (-589.568) (-588.872) -- 0:00:07
888500 -- [-587.595] (-588.695) (-590.558) (-587.798) * (-589.435) [-587.785] (-589.963) (-588.976) -- 0:00:07
889000 -- [-588.205] (-589.061) (-592.135) (-589.042) * (-590.429) (-592.554) [-593.326] (-587.648) -- 0:00:06
889500 -- (-589.308) (-588.885) (-589.146) [-588.100] * (-592.199) (-589.193) (-588.583) [-589.118] -- 0:00:06
890000 -- [-588.452] (-589.027) (-588.440) (-595.402) * (-591.542) (-592.712) [-588.265] (-589.966) -- 0:00:06
Average standard deviation of split frequencies: 0.005751
890500 -- (-590.672) [-587.962] (-588.240) (-590.337) * (-589.521) (-591.182) [-594.560] (-587.983) -- 0:00:06
891000 -- (-588.623) (-587.814) (-592.171) [-587.901] * (-588.979) (-592.351) [-589.185] (-588.085) -- 0:00:06
891500 -- (-589.459) [-588.329] (-590.770) (-592.581) * [-588.233] (-592.565) (-590.735) (-588.777) -- 0:00:06
892000 -- [-589.198] (-590.079) (-595.050) (-590.251) * [-589.185] (-591.370) (-589.905) (-595.855) -- 0:00:06
892500 -- (-589.074) [-589.689] (-599.038) (-591.374) * (-591.880) (-588.501) (-589.258) [-590.029] -- 0:00:06
893000 -- (-590.280) (-590.028) (-597.208) [-588.490] * [-591.709] (-590.124) (-593.380) (-593.640) -- 0:00:06
893500 -- (-589.634) (-591.784) (-593.781) [-588.683] * (-588.743) (-588.810) (-590.103) [-594.311] -- 0:00:06
894000 -- (-589.200) (-591.591) [-590.872] (-588.649) * (-590.356) [-590.472] (-592.263) (-590.499) -- 0:00:06
894500 -- [-591.984] (-591.683) (-590.143) (-590.184) * [-587.924] (-590.717) (-593.692) (-593.595) -- 0:00:06
895000 -- (-591.712) (-588.748) [-588.569] (-589.295) * [-591.157] (-592.588) (-591.628) (-591.852) -- 0:00:06
Average standard deviation of split frequencies: 0.005647
895500 -- (-588.372) (-592.873) (-589.075) [-590.621] * (-590.943) (-588.600) [-588.693] (-589.838) -- 0:00:06
896000 -- (-589.236) (-588.244) (-592.477) [-590.579] * (-592.324) (-591.270) [-588.778] (-589.657) -- 0:00:06
896500 -- (-589.546) [-589.199] (-589.121) (-591.307) * (-590.653) (-589.884) (-590.467) [-589.845] -- 0:00:06
897000 -- (-590.624) (-591.418) [-591.868] (-592.379) * [-590.265] (-590.130) (-591.611) (-592.545) -- 0:00:06
897500 -- (-588.303) [-591.315] (-590.744) (-591.857) * (-590.537) [-589.397] (-590.374) (-588.637) -- 0:00:06
898000 -- [-587.816] (-591.075) (-589.909) (-594.631) * (-588.244) (-589.422) (-589.838) [-588.024] -- 0:00:06
898500 -- (-593.319) (-590.877) (-588.428) [-594.496] * (-587.742) (-589.724) [-588.981] (-591.151) -- 0:00:06
899000 -- (-588.878) (-589.391) (-592.421) [-590.104] * (-589.174) (-591.070) (-588.531) [-589.406] -- 0:00:06
899500 -- [-590.266] (-591.294) (-588.920) (-587.787) * (-588.943) (-588.312) (-590.736) [-589.557] -- 0:00:06
900000 -- [-589.203] (-587.938) (-591.486) (-587.767) * [-590.387] (-589.933) (-587.993) (-588.237) -- 0:00:06
Average standard deviation of split frequencies: 0.005688
900500 -- (-590.353) [-588.062] (-587.357) (-588.337) * (-589.378) [-588.226] (-591.561) (-595.683) -- 0:00:06
901000 -- [-593.389] (-587.759) (-589.831) (-590.870) * (-590.563) (-588.619) [-590.775] (-590.016) -- 0:00:06
901500 -- (-591.355) (-589.463) [-588.997] (-589.879) * (-590.681) (-588.545) [-590.046] (-589.243) -- 0:00:06
902000 -- (-590.456) (-588.758) [-589.985] (-588.905) * (-590.975) (-587.833) (-588.378) [-593.435] -- 0:00:06
902500 -- (-589.396) [-589.069] (-589.535) (-588.793) * [-591.081] (-592.185) (-594.646) (-594.056) -- 0:00:06
903000 -- (-588.569) (-588.752) [-589.679] (-588.575) * (-592.371) (-594.116) [-590.799] (-587.948) -- 0:00:06
903500 -- (-589.521) (-588.379) [-589.245] (-589.865) * [-593.391] (-591.784) (-591.017) (-591.210) -- 0:00:06
904000 -- (-589.927) (-587.297) [-588.192] (-588.722) * (-591.270) (-592.487) [-589.981] (-588.899) -- 0:00:06
904500 -- (-590.242) [-589.442] (-589.567) (-594.037) * (-591.586) (-591.067) (-590.548) [-589.721] -- 0:00:06
905000 -- (-591.488) (-589.176) (-590.778) [-595.363] * (-590.343) (-591.631) (-591.315) [-587.705] -- 0:00:05
Average standard deviation of split frequencies: 0.005723
905500 -- (-593.980) (-589.601) [-588.810] (-590.367) * (-592.119) [-588.432] (-589.277) (-590.817) -- 0:00:05
906000 -- (-588.357) [-588.092] (-589.217) (-589.274) * (-591.915) [-589.891] (-591.396) (-589.953) -- 0:00:05
906500 -- (-590.384) (-587.625) (-591.957) [-589.162] * [-591.071] (-590.020) (-589.632) (-590.194) -- 0:00:05
907000 -- (-590.620) [-587.652] (-588.921) (-589.720) * (-589.020) (-589.383) (-587.868) [-589.244] -- 0:00:05
907500 -- (-591.677) (-588.115) [-589.692] (-594.197) * (-587.847) (-589.508) (-588.245) [-588.384] -- 0:00:05
908000 -- (-588.260) (-587.944) (-588.998) [-590.829] * (-587.916) (-589.179) [-588.191] (-591.362) -- 0:00:05
908500 -- (-591.004) [-591.304] (-595.337) (-591.410) * (-592.675) (-588.821) (-587.410) [-588.950] -- 0:00:05
909000 -- [-589.497] (-590.480) (-589.824) (-592.267) * (-590.818) (-588.774) [-587.848] (-588.275) -- 0:00:05
909500 -- (-591.986) (-589.288) (-587.931) [-589.186] * [-589.058] (-588.208) (-590.463) (-589.774) -- 0:00:05
910000 -- (-592.635) [-588.753] (-592.025) (-588.409) * (-588.609) [-588.914] (-589.130) (-590.840) -- 0:00:05
Average standard deviation of split frequencies: 0.005729
910500 -- (-590.146) (-589.673) [-591.115] (-590.927) * (-588.871) (-589.829) (-589.475) [-589.547] -- 0:00:05
911000 -- [-591.070] (-588.181) (-590.728) (-593.028) * (-590.653) [-588.739] (-589.116) (-588.322) -- 0:00:05
911500 -- [-591.119] (-588.129) (-591.425) (-591.291) * [-588.896] (-588.508) (-589.421) (-588.853) -- 0:00:05
912000 -- (-590.621) [-588.129] (-591.527) (-588.956) * (-594.417) (-589.175) [-588.172] (-593.981) -- 0:00:05
912500 -- (-589.091) [-589.117] (-589.115) (-588.417) * (-592.477) (-588.744) [-590.113] (-588.353) -- 0:00:05
913000 -- (-593.576) (-591.066) (-590.464) [-588.054] * [-591.141] (-590.049) (-588.893) (-590.106) -- 0:00:05
913500 -- (-588.358) [-590.245] (-589.666) (-589.701) * (-591.251) (-590.911) (-590.164) [-589.299] -- 0:00:05
914000 -- [-587.599] (-588.400) (-591.404) (-589.500) * (-593.787) [-591.814] (-590.122) (-589.691) -- 0:00:05
914500 -- (-596.194) (-593.336) (-588.730) [-591.324] * (-587.629) (-589.420) [-589.530] (-587.885) -- 0:00:05
915000 -- (-594.715) (-592.473) [-589.147] (-593.904) * (-591.114) [-587.706] (-590.177) (-591.162) -- 0:00:05
Average standard deviation of split frequencies: 0.005730
915500 -- (-590.529) (-589.475) (-590.887) [-594.196] * (-588.976) (-589.618) [-592.925] (-591.657) -- 0:00:05
916000 -- (-588.603) [-589.753] (-588.838) (-587.580) * (-589.400) [-588.086] (-590.548) (-591.285) -- 0:00:05
916500 -- (-590.724) [-589.296] (-589.105) (-588.662) * (-589.888) [-587.793] (-590.094) (-588.208) -- 0:00:05
917000 -- (-590.649) (-590.331) [-588.147] (-589.446) * (-590.763) (-589.401) (-589.282) [-589.329] -- 0:00:05
917500 -- (-592.469) [-589.320] (-591.725) (-590.585) * [-591.844] (-588.429) (-588.515) (-587.954) -- 0:00:05
918000 -- (-589.953) (-590.541) [-592.562] (-589.254) * [-592.075] (-589.638) (-588.167) (-588.935) -- 0:00:05
918500 -- (-592.510) [-593.816] (-592.113) (-589.057) * [-588.507] (-595.025) (-589.167) (-589.814) -- 0:00:05
919000 -- (-588.172) (-591.110) [-590.461] (-591.810) * [-588.519] (-598.584) (-589.839) (-590.617) -- 0:00:05
919500 -- (-589.879) (-591.759) [-588.950] (-593.686) * (-595.986) (-590.423) (-589.440) [-589.435] -- 0:00:05
920000 -- (-596.928) (-590.503) (-587.905) [-590.395] * (-589.508) (-590.727) (-588.102) [-588.277] -- 0:00:05
Average standard deviation of split frequencies: 0.005803
920500 -- (-590.501) (-589.931) [-590.182] (-587.679) * (-588.579) (-590.065) [-588.203] (-588.594) -- 0:00:05
921000 -- [-589.047] (-589.519) (-590.541) (-588.203) * [-588.417] (-592.261) (-587.830) (-588.450) -- 0:00:04
921500 -- (-588.628) (-593.830) (-589.517) [-588.997] * (-589.697) [-591.997] (-592.080) (-588.281) -- 0:00:04
922000 -- (-589.158) (-593.422) [-590.389] (-590.254) * (-589.484) (-590.047) [-589.361] (-588.551) -- 0:00:04
922500 -- (-594.432) (-591.511) (-589.703) [-588.352] * [-588.189] (-591.993) (-592.298) (-591.459) -- 0:00:04
923000 -- (-589.979) [-588.707] (-589.993) (-588.783) * (-588.253) [-590.924] (-592.859) (-590.271) -- 0:00:04
923500 -- (-592.020) (-590.351) (-592.497) [-587.802] * (-591.504) (-590.793) (-589.279) [-589.299] -- 0:00:04
924000 -- (-590.369) (-591.695) (-588.178) [-587.553] * [-590.157] (-591.599) (-590.046) (-588.303) -- 0:00:04
924500 -- (-589.355) (-590.040) [-589.670] (-588.858) * (-589.609) [-595.440] (-594.821) (-588.682) -- 0:00:04
925000 -- (-589.397) (-588.922) [-590.604] (-591.267) * (-591.697) (-597.735) [-591.790] (-587.926) -- 0:00:04
Average standard deviation of split frequencies: 0.005227
925500 -- [-587.981] (-591.139) (-588.173) (-588.338) * (-592.355) [-587.725] (-589.744) (-589.764) -- 0:00:04
926000 -- (-591.230) (-591.427) [-590.328] (-588.035) * (-592.118) (-588.574) [-589.798] (-591.460) -- 0:00:04
926500 -- (-591.106) (-590.608) (-590.815) [-587.375] * (-589.250) (-590.825) (-587.623) [-588.202] -- 0:00:04
927000 -- (-595.992) (-591.481) (-588.303) [-588.474] * (-588.333) (-591.877) (-589.556) [-588.883] -- 0:00:04
927500 -- (-596.815) [-590.676] (-589.327) (-588.388) * [-589.478] (-588.467) (-590.488) (-589.833) -- 0:00:04
928000 -- [-590.915] (-588.622) (-589.408) (-588.763) * [-587.844] (-588.179) (-588.923) (-591.047) -- 0:00:04
928500 -- [-588.025] (-590.164) (-588.112) (-588.539) * (-588.013) [-590.159] (-588.681) (-588.353) -- 0:00:04
929000 -- (-588.282) (-590.622) [-589.098] (-588.290) * (-588.913) (-589.931) [-590.532] (-588.200) -- 0:00:04
929500 -- (-588.420) (-591.129) (-592.617) [-588.371] * (-590.703) (-589.765) (-590.265) [-588.585] -- 0:00:04
930000 -- (-590.704) (-588.135) [-589.035] (-587.807) * [-588.318] (-587.947) (-590.170) (-590.094) -- 0:00:04
Average standard deviation of split frequencies: 0.005200
930500 -- (-589.574) (-589.534) (-588.159) [-591.152] * (-590.316) [-587.817] (-590.222) (-589.136) -- 0:00:04
931000 -- (-590.436) [-590.041] (-589.150) (-591.798) * (-591.125) (-587.736) (-590.104) [-590.270] -- 0:00:04
931500 -- [-590.751] (-588.450) (-588.106) (-593.130) * (-590.288) [-588.999] (-590.070) (-589.268) -- 0:00:04
932000 -- (-591.688) (-591.178) [-590.890] (-591.139) * (-592.959) (-589.033) (-588.926) [-588.863] -- 0:00:04
932500 -- (-589.609) (-589.664) (-589.563) [-590.726] * (-588.169) (-588.181) [-587.581] (-588.760) -- 0:00:04
933000 -- (-591.503) [-587.732] (-591.863) (-589.871) * (-593.472) [-587.779] (-587.500) (-589.278) -- 0:00:04
933500 -- (-592.859) [-589.157] (-595.326) (-589.794) * (-588.924) [-590.607] (-594.231) (-592.649) -- 0:00:04
934000 -- (-591.609) (-588.235) [-588.935] (-587.762) * (-590.686) (-590.713) (-588.056) [-592.191] -- 0:00:04
934500 -- (-588.545) (-594.288) (-592.695) [-588.654] * (-589.836) (-590.526) [-588.722] (-590.381) -- 0:00:04
935000 -- (-591.163) [-589.491] (-590.692) (-590.510) * [-590.249] (-587.958) (-591.589) (-590.871) -- 0:00:04
Average standard deviation of split frequencies: 0.004936
935500 -- (-589.173) [-588.708] (-592.997) (-589.267) * [-588.429] (-591.216) (-592.562) (-590.013) -- 0:00:04
936000 -- (-589.176) [-588.538] (-595.046) (-589.438) * (-587.982) [-590.149] (-588.070) (-590.764) -- 0:00:04
936500 -- (-589.784) [-589.440] (-588.559) (-589.119) * (-590.698) (-593.311) (-590.844) [-589.575] -- 0:00:04
937000 -- (-591.565) (-589.761) [-589.463] (-591.964) * (-587.400) [-588.265] (-589.054) (-589.103) -- 0:00:03
937500 -- (-595.643) (-589.349) (-589.185) [-589.536] * (-589.680) (-591.256) [-588.764] (-589.968) -- 0:00:03
938000 -- (-591.163) [-589.825] (-590.358) (-590.132) * [-589.707] (-590.390) (-587.978) (-592.113) -- 0:00:03
938500 -- [-588.619] (-590.614) (-587.998) (-589.273) * (-589.054) (-590.237) (-589.373) [-590.314] -- 0:00:03
939000 -- (-590.552) (-590.453) (-588.901) [-587.771] * (-589.770) (-588.133) (-589.309) [-589.661] -- 0:00:03
939500 -- [-588.674] (-588.432) (-589.434) (-587.453) * [-588.492] (-588.640) (-588.134) (-591.709) -- 0:00:03
940000 -- (-590.507) [-587.985] (-590.589) (-587.773) * (-587.741) (-590.886) (-588.633) [-592.115] -- 0:00:03
Average standard deviation of split frequencies: 0.005713
940500 -- (-588.714) [-588.358] (-592.776) (-589.701) * (-588.847) [-590.423] (-589.641) (-588.483) -- 0:00:03
941000 -- (-589.650) [-589.789] (-591.772) (-592.100) * (-590.521) (-593.408) [-589.399] (-590.061) -- 0:00:03
941500 -- (-592.100) (-590.042) (-591.824) [-590.122] * (-588.591) (-590.773) (-590.638) [-590.925] -- 0:00:03
942000 -- (-590.922) (-592.108) [-589.703] (-590.549) * (-590.169) (-590.327) (-588.727) [-589.314] -- 0:00:03
942500 -- (-591.128) (-590.935) [-589.225] (-594.030) * (-591.632) (-591.052) [-588.484] (-588.895) -- 0:00:03
943000 -- (-594.444) (-590.666) [-590.761] (-596.817) * (-588.488) [-588.743] (-590.659) (-588.180) -- 0:00:03
943500 -- (-590.506) (-588.976) [-588.934] (-588.539) * (-592.839) (-587.597) (-588.593) [-589.785] -- 0:00:03
944000 -- (-589.051) [-589.852] (-588.431) (-588.231) * [-589.575] (-590.204) (-590.356) (-590.152) -- 0:00:03
944500 -- [-588.247] (-588.759) (-590.596) (-589.529) * (-589.212) (-589.757) (-589.250) [-588.397] -- 0:00:03
945000 -- (-588.681) [-588.327] (-589.062) (-592.609) * [-588.044] (-592.545) (-588.626) (-588.146) -- 0:00:03
Average standard deviation of split frequencies: 0.005382
945500 -- (-592.195) (-587.809) (-591.212) [-589.072] * (-587.907) (-596.346) (-589.056) [-588.988] -- 0:00:03
946000 -- (-590.563) (-587.628) [-590.363] (-591.885) * (-589.247) (-591.319) [-589.714] (-588.907) -- 0:00:03
946500 -- (-588.430) (-589.883) (-589.809) [-590.597] * (-588.671) (-594.710) (-589.060) [-588.589] -- 0:00:03
947000 -- (-588.770) [-591.773] (-590.099) (-592.570) * (-588.581) (-587.881) (-588.937) [-589.119] -- 0:00:03
947500 -- (-594.443) (-593.047) (-587.737) [-590.135] * (-589.924) [-588.958] (-589.690) (-593.055) -- 0:00:03
948000 -- [-591.712] (-592.712) (-588.115) (-594.158) * (-591.777) [-589.698] (-592.408) (-594.715) -- 0:00:03
948500 -- (-591.240) (-588.963) (-588.535) [-589.789] * (-589.360) (-593.330) (-591.105) [-596.051] -- 0:00:03
949000 -- (-594.982) (-588.688) (-588.708) [-590.436] * (-588.638) (-592.670) [-587.991] (-588.164) -- 0:00:03
949500 -- (-588.992) (-588.520) (-590.735) [-588.578] * (-590.951) (-589.775) (-590.822) [-587.862] -- 0:00:03
950000 -- (-595.314) [-588.835] (-591.694) (-588.891) * [-587.701] (-589.338) (-588.636) (-589.042) -- 0:00:03
Average standard deviation of split frequencies: 0.005124
950500 -- [-591.100] (-587.910) (-589.425) (-589.491) * (-587.361) [-589.748] (-591.565) (-590.011) -- 0:00:03
951000 -- (-590.790) (-588.188) [-589.298] (-589.086) * (-592.119) (-589.405) [-589.098] (-590.653) -- 0:00:03
951500 -- (-589.234) (-589.276) (-588.669) [-587.863] * (-590.959) (-588.016) (-588.391) [-589.294] -- 0:00:03
952000 -- (-588.754) [-589.033] (-590.756) (-589.586) * (-592.834) [-587.695] (-591.673) (-588.664) -- 0:00:03
952500 -- (-589.605) [-592.342] (-593.614) (-589.798) * (-596.905) (-591.726) (-589.572) [-590.379] -- 0:00:02
953000 -- [-592.392] (-589.087) (-588.395) (-588.139) * (-589.384) [-588.585] (-589.195) (-590.880) -- 0:00:02
953500 -- (-590.914) (-589.866) [-589.139] (-590.550) * (-590.485) (-588.479) [-589.508] (-591.853) -- 0:00:02
954000 -- (-588.360) [-587.583] (-588.214) (-590.651) * (-588.635) (-588.968) [-590.749] (-587.590) -- 0:00:02
954500 -- (-587.277) (-590.007) (-588.711) [-589.169] * (-588.851) (-589.032) (-592.595) [-593.189] -- 0:00:02
955000 -- [-588.895] (-589.234) (-589.902) (-589.237) * (-594.101) [-589.409] (-590.534) (-591.539) -- 0:00:02
Average standard deviation of split frequencies: 0.005095
955500 -- (-589.725) (-590.368) (-591.616) [-588.270] * (-588.421) [-588.154] (-587.671) (-597.077) -- 0:00:02
956000 -- (-590.390) (-590.774) [-590.126] (-589.246) * (-590.302) (-588.386) [-587.799] (-590.644) -- 0:00:02
956500 -- [-589.071] (-589.601) (-590.890) (-589.083) * [-588.699] (-588.966) (-587.931) (-592.749) -- 0:00:02
957000 -- [-588.604] (-592.073) (-592.516) (-590.071) * (-589.547) (-591.668) (-589.831) [-592.555] -- 0:00:02
957500 -- (-590.782) [-590.859] (-589.716) (-588.194) * (-589.812) [-589.741] (-592.657) (-590.480) -- 0:00:02
958000 -- [-587.995] (-591.360) (-589.935) (-588.081) * [-590.433] (-588.606) (-590.302) (-590.398) -- 0:00:02
958500 -- (-590.798) (-589.714) [-588.041] (-587.985) * (-589.896) [-590.720] (-588.476) (-589.291) -- 0:00:02
959000 -- (-596.067) [-588.271] (-592.852) (-587.247) * (-594.217) [-587.988] (-589.551) (-590.188) -- 0:00:02
959500 -- (-590.355) (-588.128) (-591.290) [-589.898] * (-590.252) [-589.048] (-588.610) (-590.358) -- 0:00:02
960000 -- (-588.778) (-588.350) [-588.284] (-591.767) * (-591.554) [-592.236] (-593.705) (-588.545) -- 0:00:02
Average standard deviation of split frequencies: 0.004711
960500 -- (-587.584) (-588.765) [-590.452] (-595.776) * (-591.126) (-593.788) [-588.750] (-590.202) -- 0:00:02
961000 -- (-587.629) (-591.873) [-592.429] (-595.438) * (-592.950) (-592.338) (-589.104) [-588.139] -- 0:00:02
961500 -- (-590.592) (-590.384) [-589.158] (-590.212) * (-592.980) [-588.379] (-588.451) (-599.571) -- 0:00:02
962000 -- (-589.162) (-588.772) [-589.399] (-590.854) * (-589.146) (-588.747) [-588.599] (-589.325) -- 0:00:02
962500 -- (-589.647) [-589.480] (-589.750) (-590.231) * (-588.729) [-591.819] (-588.669) (-589.706) -- 0:00:02
963000 -- [-588.996] (-588.973) (-589.917) (-595.827) * [-589.008] (-589.545) (-587.714) (-590.939) -- 0:00:02
963500 -- (-588.508) [-590.753] (-588.098) (-596.789) * (-589.682) [-590.088] (-587.747) (-589.372) -- 0:00:02
964000 -- (-590.010) (-590.963) (-590.120) [-594.046] * (-591.060) (-594.252) (-589.234) [-588.177] -- 0:00:02
964500 -- (-592.190) (-589.134) (-589.507) [-588.894] * [-588.645] (-588.452) (-588.025) (-589.126) -- 0:00:02
965000 -- (-590.191) [-588.345] (-591.309) (-587.427) * (-589.083) (-588.653) (-587.698) [-590.957] -- 0:00:02
Average standard deviation of split frequencies: 0.004457
965500 -- (-591.253) [-587.581] (-590.458) (-591.661) * (-588.007) (-594.421) (-589.590) [-589.531] -- 0:00:02
966000 -- (-588.817) (-593.108) (-589.324) [-591.383] * (-588.548) [-589.284] (-592.480) (-589.320) -- 0:00:02
966500 -- [-589.386] (-588.372) (-590.005) (-590.237) * (-587.772) (-588.075) (-592.704) [-587.871] -- 0:00:02
967000 -- [-592.540] (-591.134) (-591.075) (-587.940) * (-587.794) (-589.776) (-588.859) [-587.344] -- 0:00:02
967500 -- (-587.586) [-588.175] (-588.440) (-590.387) * (-587.794) (-588.305) [-588.332] (-589.945) -- 0:00:02
968000 -- (-591.505) [-588.094] (-589.937) (-596.514) * (-587.902) (-589.084) [-589.515] (-588.034) -- 0:00:02
968500 -- (-589.809) (-588.134) [-589.361] (-592.662) * (-589.138) [-587.961] (-590.294) (-589.598) -- 0:00:01
969000 -- [-589.775] (-594.260) (-588.652) (-590.010) * [-588.729] (-589.112) (-588.229) (-588.962) -- 0:00:01
969500 -- (-591.352) (-591.074) (-589.126) [-592.242] * (-589.403) (-590.015) [-588.637] (-589.154) -- 0:00:01
970000 -- (-593.484) (-598.074) [-590.001] (-588.231) * (-589.544) [-590.322] (-588.308) (-589.425) -- 0:00:01
Average standard deviation of split frequencies: 0.004209
970500 -- [-589.182] (-589.574) (-589.294) (-588.741) * (-591.340) (-588.618) (-590.412) [-589.146] -- 0:00:01
971000 -- (-588.656) [-589.237] (-594.489) (-593.601) * (-593.676) [-587.689] (-588.534) (-591.145) -- 0:00:01
971500 -- (-589.076) [-589.133] (-590.518) (-589.083) * (-595.554) (-591.599) [-591.425] (-589.231) -- 0:00:01
972000 -- (-594.079) [-593.372] (-587.997) (-590.905) * [-589.708] (-592.353) (-589.817) (-590.180) -- 0:00:01
972500 -- [-589.406] (-591.211) (-587.773) (-589.191) * (-589.015) [-589.115] (-589.137) (-589.792) -- 0:00:01
973000 -- (-588.078) (-589.321) (-588.756) [-589.577] * (-588.098) (-589.701) (-589.025) [-588.251] -- 0:00:01
973500 -- (-588.414) (-590.311) (-588.480) [-590.462] * (-591.501) (-591.490) (-591.155) [-589.403] -- 0:00:01
974000 -- (-590.567) [-588.971] (-588.482) (-587.711) * (-588.411) [-588.616] (-590.758) (-589.012) -- 0:00:01
974500 -- (-590.524) (-591.795) [-588.885] (-587.770) * (-589.999) (-588.938) (-590.455) [-588.706] -- 0:00:01
975000 -- (-590.329) (-590.053) [-589.374] (-591.115) * (-590.746) (-588.529) [-590.850] (-589.068) -- 0:00:01
Average standard deviation of split frequencies: 0.004057
975500 -- (-590.689) (-589.060) [-589.673] (-590.022) * (-589.931) (-589.399) [-588.352] (-589.070) -- 0:00:01
976000 -- (-587.995) [-587.970] (-587.503) (-590.843) * (-591.273) [-591.634] (-588.615) (-588.977) -- 0:00:01
976500 -- (-591.996) (-588.236) [-587.748] (-588.049) * [-590.156] (-592.082) (-589.173) (-596.416) -- 0:00:01
977000 -- (-593.327) (-589.395) (-589.014) [-587.330] * [-590.715] (-591.083) (-590.680) (-589.860) -- 0:00:01
977500 -- (-590.852) (-590.502) [-590.604] (-591.620) * (-591.514) [-588.863] (-587.236) (-591.039) -- 0:00:01
978000 -- (-589.783) [-591.009] (-593.883) (-589.299) * (-590.099) (-589.268) (-589.133) [-588.765] -- 0:00:01
978500 -- (-591.679) [-591.318] (-591.793) (-587.802) * (-589.741) (-592.672) [-587.944] (-589.664) -- 0:00:01
979000 -- [-592.602] (-587.665) (-589.172) (-588.288) * (-589.226) (-592.395) [-587.977] (-589.388) -- 0:00:01
979500 -- [-590.859] (-587.473) (-591.591) (-589.693) * [-589.772] (-596.072) (-588.457) (-592.977) -- 0:00:01
980000 -- (-591.176) (-589.121) [-589.172] (-591.564) * (-590.529) (-591.343) [-588.013] (-589.719) -- 0:00:01
Average standard deviation of split frequencies: 0.003910
980500 -- [-589.813] (-592.197) (-588.026) (-588.388) * (-588.877) (-590.873) (-587.943) [-589.347] -- 0:00:01
981000 -- (-591.602) [-588.148] (-589.713) (-588.950) * (-590.430) (-590.901) (-591.122) [-589.023] -- 0:00:01
981500 -- (-590.910) (-590.626) [-591.862] (-590.452) * [-589.361] (-590.025) (-591.486) (-590.204) -- 0:00:01
982000 -- (-587.840) (-590.502) (-589.831) [-587.727] * (-590.001) (-593.042) [-589.056] (-589.190) -- 0:00:01
982500 -- (-589.332) (-590.874) (-587.689) [-587.518] * (-589.925) [-593.576] (-588.190) (-588.158) -- 0:00:01
983000 -- (-591.511) (-589.033) (-590.896) [-588.055] * (-597.079) [-589.168] (-588.702) (-589.490) -- 0:00:01
983500 -- (-588.394) [-587.943] (-592.922) (-588.916) * (-587.718) [-590.796] (-589.378) (-589.854) -- 0:00:01
984000 -- (-589.177) (-590.461) [-592.334] (-588.966) * (-588.633) (-594.033) [-587.466] (-587.370) -- 0:00:01
984500 -- (-589.044) [-588.861] (-592.417) (-589.464) * (-588.059) (-589.993) [-588.017] (-590.441) -- 0:00:00
985000 -- (-588.992) [-588.767] (-588.088) (-590.020) * (-589.901) (-590.546) [-588.510] (-588.860) -- 0:00:00
Average standard deviation of split frequencies: 0.003889
985500 -- [-590.559] (-588.142) (-593.272) (-589.835) * [-590.275] (-589.332) (-592.340) (-594.371) -- 0:00:00
986000 -- (-589.034) (-590.189) (-591.384) [-595.997] * (-594.085) (-589.593) [-588.802] (-590.219) -- 0:00:00
986500 -- [-590.679] (-590.428) (-590.754) (-588.931) * (-589.517) (-588.955) (-588.457) [-587.841] -- 0:00:00
987000 -- (-587.903) (-593.198) (-588.752) [-588.022] * (-588.308) (-592.559) (-589.943) [-590.563] -- 0:00:00
987500 -- [-587.656] (-589.432) (-592.217) (-588.408) * (-587.830) (-589.633) (-589.629) [-589.759] -- 0:00:00
988000 -- (-588.490) [-588.994] (-591.295) (-588.489) * [-590.412] (-591.218) (-588.724) (-598.528) -- 0:00:00
988500 -- (-588.167) [-588.309] (-595.921) (-590.428) * [-588.241] (-590.353) (-588.423) (-587.926) -- 0:00:00
989000 -- (-588.533) (-591.908) (-591.233) [-588.345] * (-588.297) (-590.856) [-588.780] (-588.391) -- 0:00:00
989500 -- [-590.047] (-588.945) (-590.484) (-592.221) * (-588.274) [-587.495] (-589.256) (-589.231) -- 0:00:00
990000 -- (-589.543) (-591.800) (-590.855) [-589.230] * [-588.462] (-588.638) (-589.596) (-589.493) -- 0:00:00
Average standard deviation of split frequencies: 0.004156
990500 -- (-588.466) (-588.437) [-590.143] (-589.548) * (-588.655) (-589.445) [-589.767] (-591.091) -- 0:00:00
991000 -- [-588.284] (-591.175) (-589.193) (-589.106) * (-590.218) [-588.476] (-589.597) (-591.343) -- 0:00:00
991500 -- (-589.953) [-589.287] (-590.623) (-589.383) * (-589.972) [-588.312] (-590.056) (-591.316) -- 0:00:00
992000 -- (-589.972) [-588.338] (-588.164) (-590.038) * (-588.440) [-591.783] (-591.649) (-593.665) -- 0:00:00
992500 -- (-591.045) [-588.168] (-588.114) (-590.163) * (-588.466) [-588.531] (-589.960) (-589.143) -- 0:00:00
993000 -- (-587.903) (-588.508) [-587.999] (-592.160) * (-588.431) (-594.363) [-588.198] (-590.283) -- 0:00:00
993500 -- [-589.471] (-588.395) (-588.551) (-590.025) * (-593.863) (-593.202) (-588.076) [-591.661] -- 0:00:00
994000 -- (-591.240) (-591.566) [-588.630] (-589.827) * (-588.666) (-588.219) (-589.234) [-588.318] -- 0:00:00
994500 -- (-590.804) [-590.090] (-591.248) (-589.355) * (-588.305) [-589.308] (-590.574) (-588.060) -- 0:00:00
995000 -- [-588.349] (-588.563) (-592.343) (-592.448) * (-591.508) (-588.578) (-591.393) [-587.474] -- 0:00:00
Average standard deviation of split frequencies: 0.004228
995500 -- (-588.763) (-589.534) [-590.132] (-590.365) * (-589.745) (-588.558) (-589.824) [-587.761] -- 0:00:00
996000 -- (-590.620) (-591.108) (-589.142) [-590.787] * [-589.723] (-589.352) (-590.109) (-589.227) -- 0:00:00
996500 -- (-589.383) (-589.470) (-591.369) [-587.634] * (-588.835) [-592.411] (-591.744) (-588.752) -- 0:00:00
997000 -- (-589.227) (-589.357) (-591.192) [-589.079] * (-590.450) [-590.727] (-587.657) (-591.735) -- 0:00:00
997500 -- (-587.914) [-590.312] (-589.219) (-589.533) * (-591.021) (-588.529) [-589.262] (-592.861) -- 0:00:00
998000 -- (-588.756) (-588.228) [-590.901] (-589.954) * (-588.742) (-594.143) (-590.168) [-589.380] -- 0:00:00
998500 -- (-592.904) [-588.365] (-590.004) (-589.700) * (-588.467) [-588.936] (-590.947) (-593.544) -- 0:00:00
999000 -- (-589.245) [-587.773] (-591.598) (-589.380) * (-589.479) (-593.020) [-593.034] (-590.904) -- 0:00:00
999500 -- (-589.605) [-588.813] (-588.934) (-590.436) * (-590.971) [-590.448] (-590.604) (-592.839) -- 0:00:00
1000000 -- (-589.322) (-589.162) (-591.985) [-592.553] * [-588.374] (-588.914) (-592.820) (-592.882) -- 0:00:00
Average standard deviation of split frequencies: 0.004397
Analysis completed in 1 mins 3 seconds
Analysis used 61.71 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -587.16
Likelihood of best state for "cold" chain of run 2 was -587.16
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.3 % ( 23 %) Dirichlet(Pi{all})
34.1 % ( 27 %) Slider(Pi{all})
79.1 % ( 49 %) Multiplier(Alpha{1,2})
77.9 % ( 54 %) Multiplier(Alpha{3})
24.1 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.3 % ( 24 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
33.1 % ( 21 %) Dirichlet(Pi{all})
33.9 % ( 23 %) Slider(Pi{all})
78.5 % ( 63 %) Multiplier(Alpha{1,2})
78.1 % ( 56 %) Multiplier(Alpha{3})
24.2 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % ( 99 %) NNI(Tau{all},V{all})
89.5 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166795 0.82 0.67
3 | 166923 166574 0.84
4 | 166149 167140 166419
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166888 0.82 0.67
3 | 166638 166677 0.84
4 | 166560 166783 166454
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -588.98
| 1 2 2 |
| 2 1 2 2 2 1|
| 1 * 2 * 2 22 22 |
| 2 1 1* 1 2 1 22 2 22 1 1 * 22|
|* 122 1 2 11 1 1 11 2 1 2 * |
| 1 2 2 122 22 1 2 2 * 1 11 2 1 1 |
| 1 1 2 2 2 2 1 * 1 1 121 1 |
| 11 1 1 1 2 2 |
| 2 2 2 1 2 111 |
| 2 1 2 1 11 |
| 1 2 2 |
| 1 1 1 |
| |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -590.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -588.93 -592.94
2 -588.87 -592.14
--------------------------------------
TOTAL -588.90 -592.62
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891530 0.087313 0.347974 1.467001 0.861369 1372.68 1436.84 1.000
r(A<->C){all} 0.168838 0.020818 0.000161 0.460192 0.129014 183.73 227.97 1.000
r(A<->G){all} 0.170234 0.019051 0.000550 0.442348 0.139500 153.76 218.29 1.005
r(A<->T){all} 0.157609 0.017899 0.000016 0.429874 0.123367 193.93 229.60 1.000
r(C<->G){all} 0.159208 0.019369 0.000002 0.439756 0.119861 270.25 297.30 1.013
r(C<->T){all} 0.162124 0.019047 0.000112 0.442701 0.123054 117.80 221.87 1.000
r(G<->T){all} 0.181987 0.022866 0.000001 0.482234 0.141771 155.48 175.44 1.006
pi(A){all} 0.197535 0.000375 0.161074 0.236939 0.196976 1146.16 1206.07 1.000
pi(C){all} 0.308741 0.000498 0.264717 0.350346 0.308349 1216.07 1343.25 1.000
pi(G){all} 0.305193 0.000488 0.263354 0.350390 0.304971 1334.62 1383.07 1.000
pi(T){all} 0.188531 0.000351 0.151366 0.223611 0.188087 1181.23 1230.63 1.000
alpha{1,2} 0.422952 0.227647 0.000491 1.400559 0.249429 1244.95 1266.19 1.000
alpha{3} 0.461538 0.250938 0.000175 1.458216 0.295714 1060.63 1116.22 1.001
pinvar{all} 0.996351 0.000019 0.988080 0.999997 0.997722 1292.11 1396.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- ...*.*
9 -- .*.*..
10 -- .*.***
11 -- .*..*.
12 -- .****.
13 -- ..****
14 -- ..**..
15 -- .**.**
16 -- ..*.*.
17 -- .***.*
18 -- ..*..*
19 -- ...**.
20 -- .*...*
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 484 0.161226 0.004711 0.157895 0.164557 2
8 454 0.151233 0.001884 0.149900 0.152565 2
9 446 0.148568 0.000942 0.147901 0.149234 2
10 445 0.148235 0.004240 0.145237 0.151233 2
11 445 0.148235 0.003298 0.145903 0.150566 2
12 444 0.147901 0.000942 0.147235 0.148568 2
13 443 0.147568 0.003298 0.145237 0.149900 2
14 430 0.143238 0.004711 0.139907 0.146569 2
15 427 0.142239 0.007066 0.137242 0.147235 2
16 420 0.139907 0.000942 0.139241 0.140573 2
17 415 0.138241 0.022141 0.122585 0.153897 2
18 407 0.135576 0.001413 0.134577 0.136576 2
19 394 0.131246 0.005653 0.127249 0.135243 2
20 392 0.130580 0.000942 0.129913 0.131246 2
21 390 0.129913 0.003769 0.127249 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.095140 0.009297 0.000130 0.280619 0.063676 1.000 2
length{all}[2] 0.096374 0.009386 0.000084 0.287293 0.067808 1.000 2
length{all}[3] 0.100432 0.009922 0.000019 0.293434 0.070665 1.000 2
length{all}[4] 0.098086 0.010418 0.000004 0.296541 0.066622 1.000 2
length{all}[5] 0.102858 0.011123 0.000021 0.318738 0.069095 1.001 2
length{all}[6] 0.100723 0.010307 0.000024 0.315608 0.068673 1.000 2
length{all}[7] 0.101887 0.010388 0.000231 0.305021 0.070672 1.006 2
length{all}[8] 0.103884 0.009796 0.000348 0.309457 0.078337 0.998 2
length{all}[9] 0.099698 0.009836 0.000254 0.328279 0.068787 1.001 2
length{all}[10] 0.101327 0.009936 0.000166 0.296697 0.068956 0.998 2
length{all}[11] 0.101804 0.008683 0.000660 0.295468 0.074602 0.999 2
length{all}[12] 0.102691 0.009260 0.000924 0.286446 0.076421 0.999 2
length{all}[13] 0.101904 0.010594 0.000443 0.325109 0.068015 0.998 2
length{all}[14] 0.108303 0.010667 0.000083 0.316001 0.075571 1.000 2
length{all}[15] 0.094122 0.010171 0.000274 0.297719 0.060717 1.000 2
length{all}[16] 0.102148 0.010512 0.000631 0.284952 0.072427 0.999 2
length{all}[17] 0.104063 0.011505 0.000150 0.319563 0.071878 0.998 2
length{all}[18] 0.094112 0.009656 0.000329 0.303108 0.060108 0.998 2
length{all}[19] 0.103126 0.010699 0.000016 0.281981 0.075440 1.002 2
length{all}[20] 0.106041 0.009555 0.000716 0.293434 0.073836 0.999 2
length{all}[21] 0.095629 0.009790 0.000718 0.314707 0.064034 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004397
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 432
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 144 / 144 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 144 / 144 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074098 0.024353 0.037987 0.043162 0.078099 0.012202 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -611.270383
Iterating by ming2
Initial: fx= 611.270383
x= 0.07410 0.02435 0.03799 0.04316 0.07810 0.01220 0.30000 1.30000
1 h-m-p 0.0000 0.0001 344.5905 ++ 601.021636 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0060 51.4019 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 314.8681 ++ 592.479757 m 0.0001 44 | 2/8
4 h-m-p 0.0006 0.0075 40.9471 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 281.8831 ++ 584.779129 m 0.0001 75 | 3/8
6 h-m-p 0.0008 0.0100 31.1987 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 244.4035 ++ 582.581474 m 0.0000 106 | 4/8
8 h-m-p 0.0003 0.0137 23.0220 ----------.. | 4/8
9 h-m-p 0.0000 0.0002 199.3539 +++ 573.774313 m 0.0002 137 | 5/8
10 h-m-p 0.0021 0.0223 14.5145 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 141.6675 ++ 573.200135 m 0.0000 169 | 6/8
12 h-m-p 0.4553 8.0000 0.0000 Y 573.200135 0 0.4553 180 | 6/8
13 h-m-p 0.8874 8.0000 0.0000 Y 573.200135 0 0.2219 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -C 573.200135 0 0.0010 207
Out..
lnL = -573.200135
208 lfun, 208 eigenQcodon, 1248 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081803 0.089129 0.099161 0.096561 0.015397 0.056518 0.299912 0.801104 0.251498
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.486136
np = 9
lnL0 = -633.084138
Iterating by ming2
Initial: fx= 633.084138
x= 0.08180 0.08913 0.09916 0.09656 0.01540 0.05652 0.29991 0.80110 0.25150
1 h-m-p 0.0000 0.0001 323.0654 ++ 620.984274 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 341.6124 ++ 592.928592 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 7258.0265 ++ 578.934689 m 0.0000 38 | 3/9
4 h-m-p 0.0003 0.0014 58.2589 ++ 575.378017 m 0.0014 50 | 4/9
5 h-m-p 0.0000 0.0000 677.4362 ++ 575.201161 m 0.0000 62 | 5/9
6 h-m-p 0.0021 1.0275 2.1020 ------------.. | 5/9
7 h-m-p 0.0000 0.0000 199.4299 ++ 573.517832 m 0.0000 96 | 6/9
8 h-m-p 0.0028 0.1634 2.1544 ------------.. | 6/9
9 h-m-p 0.0000 0.0000 142.0668 ++ 573.200149 m 0.0000 130 | 7/9
10 h-m-p 0.0212 8.0000 0.0000 ----C 573.200149 0 0.0000 146 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 573.200149 m 8.0000 163 | 6/9
12 h-m-p 0.0042 0.0212 0.0176 ------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 573.200149 m 8.0000 206 | 6/9
14 h-m-p 0.0037 1.8686 0.3195 +++++ 573.200132 m 1.8686 224 | 7/9
15 h-m-p 0.5838 2.9188 0.1225 ++ 573.200130 m 2.9188 239 | 8/9
16 h-m-p 1.6000 8.0000 0.0001 C 573.200130 0 1.6000 253 | 8/9
17 h-m-p 1.6000 8.0000 0.0001 N 573.200130 0 1.6000 266 | 8/9
18 h-m-p 1.5000 8.0000 0.0001 Y 573.200130 0 1.5000 279 | 8/9
19 h-m-p 1.6000 8.0000 0.0000 N 573.200130 0 1.6000 292 | 8/9
20 h-m-p 1.6000 8.0000 0.0000 N 573.200130 0 1.6000 305 | 8/9
21 h-m-p 1.6000 8.0000 0.0000 N 573.200130 0 1.6000 318
Out..
lnL = -573.200130
319 lfun, 957 eigenQcodon, 3828 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075183 0.104818 0.071469 0.083985 0.088175 0.053648 0.000100 0.821945 0.472763 0.372624 1.491594
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.307441
np = 11
lnL0 = -637.789028
Iterating by ming2
Initial: fx= 637.789028
x= 0.07518 0.10482 0.07147 0.08399 0.08817 0.05365 0.00011 0.82195 0.47276 0.37262 1.49159
1 h-m-p 0.0000 0.0000 317.3064 ++ 637.426672 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0015 196.6064 ++++ 594.150763 m 0.0015 32 | 2/11
3 h-m-p 0.0000 0.0000 2063.7500 ++ 582.422582 m 0.0000 46 | 3/11
4 h-m-p 0.0003 0.0013 53.8203 ++ 580.204679 m 0.0013 60 | 4/11
5 h-m-p 0.0000 0.0001 22.2634 --------.. | 4/11
6 h-m-p 0.0000 0.0000 275.9521 ++ 579.455640 m 0.0000 94 | 5/11
7 h-m-p 0.0160 8.0000 5.1283 -------------.. | 5/11
8 h-m-p 0.0000 0.0001 239.3634 ++ 576.267794 m 0.0001 133 | 6/11
9 h-m-p 0.0160 8.0000 3.5449 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 197.7141 ++ 575.246547 m 0.0000 172 | 7/11
11 h-m-p 0.0160 8.0000 1.9347 -------------.. | 7/11
12 h-m-p 0.0000 0.0001 140.0816 ++ 573.200134 m 0.0001 211 | 8/11
13 h-m-p 0.1243 8.0000 0.0000 ++++ 573.200134 m 8.0000 227 | 8/11
14 h-m-p 0.0285 8.0000 0.0016 +++++ 573.200134 m 8.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 1.5693 ++++C 573.200127 0 4.0960 268 | 8/11
16 h-m-p 1.6000 8.0000 0.2596 ++ 573.200127 m 8.0000 282 | 8/11
17 h-m-p 1.6000 8.0000 0.1366 C 573.200127 0 0.6167 299 | 8/11
18 h-m-p 1.6000 8.0000 0.0000 ++ 573.200127 m 8.0000 316 | 8/11
19 h-m-p 0.0160 8.0000 0.3579 ++++Y 573.200127 0 5.3073 337 | 8/11
20 h-m-p 1.6000 8.0000 0.0646 ++ 573.200126 m 8.0000 354 | 8/11
21 h-m-p 0.0518 2.2687 9.9888 -----------C 573.200126 0 0.0000 382 | 8/11
22 h-m-p 0.0037 1.8353 3.6505 +++Y 573.200126 0 0.4488 399 | 8/11
23 h-m-p 0.6379 3.1895 1.5870 C 573.200126 0 0.1595 413 | 8/11
24 h-m-p 1.6000 8.0000 0.0532 ------N 573.200126 0 0.0001 433 | 8/11
25 h-m-p 1.6000 8.0000 0.0000 ++ 573.200126 m 8.0000 450 | 8/11
26 h-m-p 0.0160 8.0000 0.0025 +++++ 573.200126 m 8.0000 470 | 8/11
27 h-m-p 0.0091 4.5736 23.5101 +++++ 573.200119 m 4.5736 490 | 8/11
28 h-m-p -0.0000 -0.0000 1.5026
h-m-p: -0.00000000e+00 -0.00000000e+00 1.50257987e+00 573.200119
.. | 8/11
29 h-m-p 0.0160 8.0000 0.0000 Y 573.200119 0 0.0040 515 | 8/11
30 h-m-p 1.6000 8.0000 0.0000 -C 573.200119 0 0.1000 533
Out..
lnL = -573.200119
534 lfun, 2136 eigenQcodon, 9612 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -573.197141 S = -573.196796 -0.000132
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:03
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:04
did 40 / 48 patterns 0:04
did 48 / 48 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037459 0.093715 0.094799 0.017158 0.099859 0.049558 0.000100 0.304226 1.789174
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.204630
np = 9
lnL0 = -626.581111
Iterating by ming2
Initial: fx= 626.581111
x= 0.03746 0.09371 0.09480 0.01716 0.09986 0.04956 0.00011 0.30423 1.78917
1 h-m-p 0.0000 0.0000 321.3027 ++ 626.296672 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0572 23.2735 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 321.4347 ++ 613.275971 m 0.0001 46 | 2/9
4 h-m-p 0.0018 0.1087 20.6943 ------------.. | 2/9
5 h-m-p 0.0000 0.0002 297.7340 ++ 599.752705 m 0.0002 80 | 3/9
6 h-m-p 0.0033 0.1938 12.1360 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 270.9824 ++ 593.148974 m 0.0001 114 | 4/9
8 h-m-p 0.0031 0.3163 6.6559 ------------.. | 4/9
9 h-m-p 0.0000 0.0003 236.1142 +++ 574.276884 m 0.0003 149 | 5/9
10 h-m-p 0.0210 0.7775 3.0471 -------------.. | 5/9
11 h-m-p 0.0000 0.0000 200.6370 ++ 573.954332 m 0.0000 184 | 6/9
12 h-m-p 0.0069 3.4624 2.5213 -------------.. | 6/9
13 h-m-p 0.0000 0.0000 141.8092 ++ 573.200148 m 0.0000 219 | 7/9
14 h-m-p 0.2200 8.0000 0.0000 +++ 573.200148 m 8.0000 232 | 7/9
15 h-m-p 0.0352 8.0000 0.0002 --------------.. | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 573.200148 m 8.0000 275 | 7/9
17 h-m-p 0.0160 8.0000 0.4029 +++++ 573.200133 m 8.0000 292 | 7/9
18 h-m-p 1.6000 8.0000 0.1457 ++ 573.200132 m 8.0000 306 | 7/9
19 h-m-p 0.6597 3.4996 1.7664 +
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
+ 573.200130 m 3.4996 320
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
20 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
N 573.200130 0 1.6000 332
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72319, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72261, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
21 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
N 573.200130 0 0.0160 346
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -573.200130
347 lfun, 3817 eigenQcodon, 20820 P(t)
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.72290, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054724 0.029758 0.084071 0.093909 0.090560 0.089857 0.000100 0.900000 0.976074 1.620929 1.300019
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.404593
np = 11
lnL0 = -632.717580
Iterating by ming2
Initial: fx= 632.717580
x= 0.05472 0.02976 0.08407 0.09391 0.09056 0.08986 0.00011 0.90000 0.97607 1.62093 1.30002
1 h-m-p 0.0000 0.0000 313.3088 ++ 632.388540 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0012 159.2805 ++++ 608.931863 m 0.0012 32 | 2/11
3 h-m-p 0.0001 0.0004 257.3597 ++ 591.905641 m 0.0004 46 | 3/11
4 h-m-p 0.0020 0.0136 44.1465 ++ 577.163497 m 0.0136 60 | 4/11
5 h-m-p 0.0000 0.0000 17853.3046 ++ 574.100570 m 0.0000 74 | 5/11
6 h-m-p 0.0002 0.0010 345.4549 ++ 573.652059 m 0.0010 88 | 6/11
7 h-m-p 0.0000 0.0000 158158.8279 ++ 573.345059 m 0.0000 102 | 6/11
8 h-m-p 0.0008 0.0039 531.6947 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 141.2979 ++ 573.200128 m 0.0000 139 | 7/11
10 h-m-p 0.0000 0.0002 0.0000 Y 573.200128 0 0.0001 153
Out..
lnL = -573.200128
154 lfun, 1848 eigenQcodon, 10164 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -573.204038 S = -573.197627 -0.002809
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:12
did 20 / 48 patterns 0:12
did 30 / 48 patterns 0:12
did 40 / 48 patterns 0:12
did 48 / 48 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=144
NC_011896_1_WP_010908868_1_2559_MLBR_RS12190 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
NC_002677_1_NP_302548_1_1420_ML2392 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG
**************************************************
NC_011896_1_WP_010908868_1_2559_MLBR_RS12190 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
NC_002677_1_NP_302548_1_1420_ML2392 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485 TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR
**************************************************
NC_011896_1_WP_010908868_1_2559_MLBR_RS12190 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
NC_002677_1_NP_302548_1_1420_ML2392 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485 REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
********************************************
>NC_011896_1_WP_010908868_1_2559_MLBR_RS12190 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG GAACCGATGTACCGGGCTACCTGCGCCCAGCC >NC_002677_1_NP_302548_1_1420_ML2392 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG GAACCGATGTACCGGGCTACCTGCGCCCAGCC >NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG GAACCGATGTACCGGGCTACCTGCGCCCAGCC >NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG GAACCGATGTACCGGGCTACCTGCGCCCAGCC >NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG GAACCGATGTACCGGGCTACCTGCGCCCAGCC >NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485 ATGAACCAAGCTTTCACCCCACTTACTGAGACCCGGTACGGACGTTCCCG ACTGCCCGGCAGATCACGGCACCGTGGCGTCATCGCGCTGACCGTGTTGG CTGTTGCTGCCAGCACTGGCATCGCTGTCATCGGTTACCAACGGCTCGGC ACCAGCGACGTTGCGGGCTCGCTCGCCAGCTACCGAGTTCTCGACGACGA GACGGTGTCGGTGACGATAAGCGTGATGCGCTCCGACCCGTCACGTCCGG TAGATTGCATTGTGCGAGTTCGTGCCAAAGACGGCAGCGAAACAGGTAGA CGTGAAGTGTTGGTAGCACCAGCCGAGGCGACCACGGTTCAGGTAGTTAC GACGGTGAAATCCGCCCGACCACCGGTGATGGCCGATATCTATGGCTGCG GAACCGATGTACCGGGCTACCTGCGCCCAGCC
>NC_011896_1_WP_010908868_1_2559_MLBR_RS12190 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA >NC_002677_1_NP_302548_1_1420_ML2392 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA >NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA >NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA >NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA >NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485 MNQAFTPLTETRYGRSRLPGRSRHRGVIALTVLAVAASTGIAVIGYQRLG TSDVAGSLASYRVLDDETVSVTISVMRSDPSRPVDCIVRVRAKDGSETGR REVLVAPAEATTVQVVTTVKSARPPVMADIYGCGTDVPGYLRPA
#NEXUS
[ID: 5823832713]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908868_1_2559_MLBR_RS12190
NC_002677_1_NP_302548_1_1420_ML2392
NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405
NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115
NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165
NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908868_1_2559_MLBR_RS12190,
2 NC_002677_1_NP_302548_1_1420_ML2392,
3 NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405,
4 NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115,
5 NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165,
6 NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06367571,2:0.06780767,3:0.07066483,4:0.06662228,5:0.06909467,6:0.06867255);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06367571,2:0.06780767,3:0.07066483,4:0.06662228,5:0.06909467,6:0.06867255);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -588.93 -592.94
2 -588.87 -592.14
--------------------------------------
TOTAL -588.90 -592.62
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2392/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891530 0.087313 0.347974 1.467001 0.861369 1372.68 1436.84 1.000
r(A<->C){all} 0.168838 0.020818 0.000161 0.460192 0.129014 183.73 227.97 1.000
r(A<->G){all} 0.170234 0.019051 0.000550 0.442348 0.139500 153.76 218.29 1.005
r(A<->T){all} 0.157609 0.017899 0.000016 0.429874 0.123367 193.93 229.60 1.000
r(C<->G){all} 0.159208 0.019369 0.000002 0.439756 0.119861 270.25 297.30 1.013
r(C<->T){all} 0.162124 0.019047 0.000112 0.442701 0.123054 117.80 221.87 1.000
r(G<->T){all} 0.181987 0.022866 0.000001 0.482234 0.141771 155.48 175.44 1.006
pi(A){all} 0.197535 0.000375 0.161074 0.236939 0.196976 1146.16 1206.07 1.000
pi(C){all} 0.308741 0.000498 0.264717 0.350346 0.308349 1216.07 1343.25 1.000
pi(G){all} 0.305193 0.000488 0.263354 0.350390 0.304971 1334.62 1383.07 1.000
pi(T){all} 0.188531 0.000351 0.151366 0.223611 0.188087 1181.23 1230.63 1.000
alpha{1,2} 0.422952 0.227647 0.000491 1.400559 0.249429 1244.95 1266.19 1.000
alpha{3} 0.461538 0.250938 0.000175 1.458216 0.295714 1060.63 1116.22 1.001
pinvar{all} 0.996351 0.000019 0.988080 0.999997 0.997722 1292.11 1396.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2392/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 144
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 5 5 5 5 5 5
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 4 4 4 4 4 4 | Gln CAA 2 2 2 2 2 2 | CGA 4 4 4 4 4 4
CTG 3 3 3 3 3 3 | CCG 4 4 4 4 4 4 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 6 6 6 6 6 6 | AAC 1 1 1 1 1 1 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 2 2 2 2 2 2
Met ATG 3 3 3 3 3 3 | ACG 5 5 5 5 5 5 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 4 4 4 4 4 4 | Asp GAT 3 3 3 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 2 2 2 2 2 2 | GCC 7 7 7 7 7 7 | GAC 5 5 5 5 5 5 | GGC 8 8 8 8 8 8
GTA 4 4 4 4 4 4 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 8 8 8 8 8 8 | GCG 3 3 3 3 3 3 | GAG 3 3 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908868_1_2559_MLBR_RS12190
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
#2: NC_002677_1_NP_302548_1_1420_ML2392
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
#3: NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
#4: NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
#5: NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
#6: NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 18 | TAC 24 | TGC 12
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 30
CTC 18 | CCC 6 | CAC 6 | CGC 12
CTA 0 | CCA 24 | Gln Q CAA 12 | CGA 24
CTG 18 | CCG 24 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 24 | ACC 36 | AAC 6 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 12
Met M ATG 18 | ACG 30 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 24 | Asp D GAT 18 | Gly G GGT 12
GTC 12 | GCC 42 | GAC 30 | GGC 48
GTA 24 | GCA 6 | Glu E GAA 12 | GGA 12
GTG 48 | GCG 18 | GAG 18 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11806 C:0.23611 A:0.22917 G:0.41667
position 2: T:0.27083 C:0.31250 A:0.17361 G:0.24306
position 3: T:0.17361 C:0.38194 A:0.18750 G:0.25694
Average T:0.18750 C:0.31019 A:0.19676 G:0.30556
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -573.200135 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299912 1.300019
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908868_1_2559_MLBR_RS12190: 0.000004, NC_002677_1_NP_302548_1_1420_ML2392: 0.000004, NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405: 0.000004, NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115: 0.000004, NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165: 0.000004, NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29991
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 308.6 123.4 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 308.6 123.4 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 308.6 123.4 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 308.6 123.4 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 308.6 123.4 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 308.6 123.4 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -573.200130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.517209
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908868_1_2559_MLBR_RS12190: 0.000004, NC_002677_1_NP_302548_1_1420_ML2392: 0.000004, NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405: 0.000004, NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115: 0.000004, NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165: 0.000004, NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.51721 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -573.200119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 23.626885
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908868_1_2559_MLBR_RS12190: 0.000004, NC_002677_1_NP_302548_1_1420_ML2392: 0.000004, NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405: 0.000004, NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115: 0.000004, NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165: 0.000004, NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 23.62688
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 310.6 121.4 23.6269 0.0000 0.0000 0.0 0.0
7..2 0.000 310.6 121.4 23.6269 0.0000 0.0000 0.0 0.0
7..3 0.000 310.6 121.4 23.6269 0.0000 0.0000 0.0 0.0
7..4 0.000 310.6 121.4 23.6269 0.0000 0.0000 0.0 0.0
7..5 0.000 310.6 121.4 23.6269 0.0000 0.0000 0.0 0.0
7..6 0.000 310.6 121.4 23.6269 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908868_1_2559_MLBR_RS12190)
Pr(w>1) post mean +- SE for w
1 M 1.000** 23.627
2 N 1.000** 23.627
3 Q 1.000** 23.627
4 A 1.000** 23.627
5 F 1.000** 23.627
6 T 1.000** 23.627
7 P 1.000** 23.627
8 L 1.000** 23.627
9 T 1.000** 23.627
10 E 1.000** 23.627
11 T 1.000** 23.627
12 R 1.000** 23.627
13 Y 1.000** 23.627
14 G 1.000** 23.627
15 R 1.000** 23.627
16 S 1.000** 23.627
17 R 1.000** 23.627
18 L 1.000** 23.627
19 P 1.000** 23.627
20 G 1.000** 23.627
21 R 1.000** 23.627
22 S 1.000** 23.627
23 R 1.000** 23.627
24 H 1.000** 23.627
25 R 1.000** 23.627
26 G 1.000** 23.627
27 V 1.000** 23.627
28 I 1.000** 23.627
29 A 1.000** 23.627
30 L 1.000** 23.627
31 T 1.000** 23.627
32 V 1.000** 23.627
33 L 1.000** 23.627
34 A 1.000** 23.627
35 V 1.000** 23.627
36 A 1.000** 23.627
37 A 1.000** 23.627
38 S 1.000** 23.627
39 T 1.000** 23.627
40 G 1.000** 23.627
41 I 1.000** 23.627
42 A 1.000** 23.627
43 V 1.000** 23.627
44 I 1.000** 23.627
45 G 1.000** 23.627
46 Y 1.000** 23.627
47 Q 1.000** 23.627
48 R 1.000** 23.627
49 L 1.000** 23.627
50 G 1.000** 23.627
51 T 1.000** 23.627
52 S 1.000** 23.627
53 D 1.000** 23.627
54 V 1.000** 23.627
55 A 1.000** 23.627
56 G 1.000** 23.627
57 S 1.000** 23.627
58 L 1.000** 23.627
59 A 1.000** 23.627
60 S 1.000** 23.627
61 Y 1.000** 23.627
62 R 1.000** 23.627
63 V 1.000** 23.627
64 L 1.000** 23.627
65 D 1.000** 23.627
66 D 1.000** 23.627
67 E 1.000** 23.627
68 T 1.000** 23.627
69 V 1.000** 23.627
70 S 1.000** 23.627
71 V 1.000** 23.627
72 T 1.000** 23.627
73 I 1.000** 23.627
74 S 1.000** 23.627
75 V 1.000** 23.627
76 M 1.000** 23.627
77 R 1.000** 23.627
78 S 1.000** 23.627
79 D 1.000** 23.627
80 P 1.000** 23.627
81 S 1.000** 23.627
82 R 1.000** 23.627
83 P 1.000** 23.627
84 V 1.000** 23.627
85 D 1.000** 23.627
86 C 1.000** 23.627
87 I 1.000** 23.627
88 V 1.000** 23.627
89 R 1.000** 23.627
90 V 1.000** 23.627
91 R 1.000** 23.627
92 A 1.000** 23.627
93 K 1.000** 23.627
94 D 1.000** 23.627
95 G 1.000** 23.627
96 S 1.000** 23.627
97 E 1.000** 23.627
98 T 1.000** 23.627
99 G 1.000** 23.627
100 R 1.000** 23.627
101 R 1.000** 23.627
102 E 1.000** 23.627
103 V 1.000** 23.627
104 L 1.000** 23.627
105 V 1.000** 23.627
106 A 1.000** 23.627
107 P 1.000** 23.627
108 A 1.000** 23.627
109 E 1.000** 23.627
110 A 1.000** 23.627
111 T 1.000** 23.627
112 T 1.000** 23.627
113 V 1.000** 23.627
114 Q 1.000** 23.627
115 V 1.000** 23.627
116 V 1.000** 23.627
117 T 1.000** 23.627
118 T 1.000** 23.627
119 V 1.000** 23.627
120 K 1.000** 23.627
121 S 1.000** 23.627
122 A 1.000** 23.627
123 R 1.000** 23.627
124 P 1.000** 23.627
125 P 1.000** 23.627
126 V 1.000** 23.627
127 M 1.000** 23.627
128 A 1.000** 23.627
129 D 1.000** 23.627
130 I 1.000** 23.627
131 Y 1.000** 23.627
132 G 1.000** 23.627
133 C 1.000** 23.627
134 G 1.000** 23.627
135 T 1.000** 23.627
136 D 1.000** 23.627
137 V 1.000** 23.627
138 P 1.000** 23.627
139 G 1.000** 23.627
140 Y 1.000** 23.627
141 L 1.000** 23.627
142 R 1.000** 23.627
143 P 1.000** 23.627
144 A 1.000** 23.627
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908868_1_2559_MLBR_RS12190)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -573.200130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 10.722900 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908868_1_2559_MLBR_RS12190: 0.000004, NC_002677_1_NP_302548_1_1420_ML2392: 0.000004, NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405: 0.000004, NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115: 0.000004, NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165: 0.000004, NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 10.72290 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 310.6 121.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -573.200128 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.505474 0.005000 2.021309 2.621131
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908868_1_2559_MLBR_RS12190: 0.000004, NC_002677_1_NP_302548_1_1420_ML2392: 0.000004, NZ_LVXE01000076_1_WP_010908868_1_2653_A3216_RS13405: 0.000004, NZ_LYPH01000076_1_WP_010908868_1_2523_A8144_RS12115: 0.000004, NZ_CP029543_1_WP_010908868_1_2584_DIJ64_RS13165: 0.000004, NZ_AP014567_1_WP_010908868_1_2648_JK2ML_RS13485: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.50547 p = 0.00500 q = 2.02131
(p1 = 0.49453) w = 2.62113
MLEs of dN/dS (w) for site classes (K=11)
p: 0.05055 0.05055 0.05055 0.05055 0.05055 0.05055 0.05055 0.05055 0.05055 0.05055 0.49453
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.62113
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 310.6 121.4 1.2962 0.0000 0.0000 0.0 0.0
7..2 0.000 310.6 121.4 1.2962 0.0000 0.0000 0.0 0.0
7..3 0.000 310.6 121.4 1.2962 0.0000 0.0000 0.0 0.0
7..4 0.000 310.6 121.4 1.2962 0.0000 0.0000 0.0 0.0
7..5 0.000 310.6 121.4 1.2962 0.0000 0.0000 0.0 0.0
7..6 0.000 310.6 121.4 1.2962 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908868_1_2559_MLBR_RS12190)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908868_1_2559_MLBR_RS12190)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:12
Model 1: NearlyNeutral -573.20013 Model 2: PositiveSelection -573.200119 Model 0: one-ratio -573.200135 Model 7: beta -573.20013 Model 8: beta&w>1 -573.200128 Model 0 vs 1 1.0000000202126103E-5 Model 2 vs 1 2.199999994445534E-5 Model 8 vs 7 3.999999989900971E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
