>C1
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C2
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C3
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C4
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C5
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C6
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=294
C1 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C2 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C3 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C4 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C5 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C6 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
**************************************************
C1 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C2 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C3 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C4 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C5 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C6 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
**************************************************
C1 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C2 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C3 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C4 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C5 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C6 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
**************************************************
C1 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C2 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C3 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C4 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C5 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C6 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
**************************************************
C1 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C2 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C3 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C4 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C5 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C6 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
**************************************************
C1 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C2 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C3 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C4 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C5 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C6 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 294 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 294 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8820]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8820]--->[8820]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.505 Mb, Max= 30.855 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C2 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C3 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C4 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C5 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
C6 MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
**************************************************
C1 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C2 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C3 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C4 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C5 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
C6 LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
**************************************************
C1 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C2 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C3 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C4 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C5 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
C6 TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
**************************************************
C1 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C2 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C3 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C4 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C5 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
C6 GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
**************************************************
C1 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C2 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C3 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C4 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C5 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
C6 KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
**************************************************
C1 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C2 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C3 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C4 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C5 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
C6 AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
C2 ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
C3 ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
C4 ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
C5 ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
C6 ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
**************************************************
C1 GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
C2 GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
C3 GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
C4 GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
C5 GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
C6 GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
**************************************************
C1 ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
C2 ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
C3 ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
C4 ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
C5 ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
C6 ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
**************************************************
C1 CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
C2 CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
C3 CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
C4 CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
C5 CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
C6 CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
**************************************************
C1 CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
C2 CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
C3 CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
C4 CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
C5 CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
C6 CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
**************************************************
C1 CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
C2 CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
C3 CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
C4 CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
C5 CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
C6 CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
**************************************************
C1 ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
C2 ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
C3 ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
C4 ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
C5 ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
C6 ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
**************************************************
C1 GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
C2 GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
C3 GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
C4 GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
C5 GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
C6 GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
**************************************************
C1 AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
C2 AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
C3 AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
C4 AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
C5 AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
C6 AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
**************************************************
C1 GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
C2 GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
C3 GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
C4 GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
C5 GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
C6 GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
**************************************************
C1 CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
C2 CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
C3 CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
C4 CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
C5 CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
C6 CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
**************************************************
C1 TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
C2 TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
C3 TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
C4 TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
C5 TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
C6 TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
**************************************************
C1 AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
C2 AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
C3 AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
C4 AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
C5 AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
C6 AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
**************************************************
C1 TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
C2 TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
C3 TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
C4 TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
C5 TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
C6 TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
**************************************************
C1 CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
C2 CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
C3 CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
C4 CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
C5 CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
C6 CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
**************************************************
C1 GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
C2 GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
C3 GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
C4 GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
C5 GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
C6 GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
**************************************************
C1 GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
C2 GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
C3 GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
C4 GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
C5 GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
C6 GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
**************************************************
C1 GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
C2 GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
C3 GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
C4 GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
C5 GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
C6 GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
********************************
>C1
ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
>C2
ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
>C3
ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
>C4
ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
>C5
ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
>C6
ATGGCTAGTTTCGCTCAGTGGATCTCGGGTGCTCGGCCACGGACGCTACC
GAACGCGGTGGCGCCCGTTGTTGCAGGCACCGGCACTGCGGCATGGCTGC
ACTCGGCCGTGTGGTGGAAAGCGCTGCTAGCGCTGGTCGTCGCTGTCGCG
CTTGTCATCGGGGTCAACTACGCCAATGACTACTCCGACGGCATCCGTGG
CACCGACGACCACCGGGCCGGGCCAATGCGCTTGGTGGGCTCGCGGCTAG
CTTTCCCGCGATCGGTGCTGACCGCCGCGGTTGTAGGCTTGACGGTCAGC
ACGGTGGCCGGGTTGGCACTCGCGCTACTCAGCGCACCGTGGCTAATCAT
GGTCGGCGCTACCTGCATCGCCGGAGCCTGGCTGTACACCGGTAGCTCGA
AGCCCTACGGCTATAAAGGTTTTGGCGAAGTCGCGGTGTTCGTGTTCTTC
GGCCTGGTCGCTGTGCTCGGCACCGAATACACCCAAGCATTGCGGGTGGA
CTGGGTGGGATTGGTGCTGGCGGTGTCGACCGGAGCGCTGTCGTCGTCAG
TCCTGGTGGCCAACAACTTGCGGGATATTCACACCGACACACAGTCACAC
AAATTCACCCTGGCGGTGCGCTTAGGTGATGCTCACACACGGCAATTATA
TCAAGCACTGCTGGTCGCCACCGGCGTGCTTACCGTGGTGCTGATGGTGG
CGACATCATGGTGTGCCGTCGGATTGGTGGCCACGCCGCTGGCTCTGCGC
GCCATGCGGCCGGTGCGCTCCGGCCGCATGGGGCCCGACTTGACCCCGGT
GCTGCGGGACACCGGACTTGCGATGGTGGTGTGGGCGATCGCGGTAGCTG
GAGCTTTAACACTGGCGGGGTCAGTGACGTAC
>C1
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C2
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C3
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C4
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C5
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
>C6
MASFAQWISGARPRTLPNAVAPVVAGTGTAAWLHSAVWWKALLALVVAVA
LVIGVNYANDYSDGIRGTDDHRAGPMRLVGSRLAFPRSVLTAAVVGLTVS
TVAGLALALLSAPWLIMVGATCIAGAWLYTGSSKPYGYKGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVSTGALSSSVLVANNLRDIHTDTQSH
KFTLAVRLGDAHTRQLYQALLVATGVLTVVLMVATSWCAVGLVATPLALR
AMRPVRSGRMGPDLTPVLRDTGLAMVVWAIAVAGALTLAGSVTY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 882 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856196
Setting output file names to "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 387129705
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5607014160
Seed = 948537713
Swapseed = 1579856196
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1973.958279 -- -24.965149
Chain 2 -- -1973.958164 -- -24.965149
Chain 3 -- -1973.958279 -- -24.965149
Chain 4 -- -1973.958164 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1973.958164 -- -24.965149
Chain 2 -- -1973.958279 -- -24.965149
Chain 3 -- -1973.957978 -- -24.965149
Chain 4 -- -1973.958164 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1973.958] (-1973.958) (-1973.958) (-1973.958) * [-1973.958] (-1973.958) (-1973.958) (-1973.958)
500 -- (-1207.487) (-1193.740) (-1210.024) [-1198.580] * (-1233.408) [-1193.132] (-1213.775) (-1192.867) -- 0:00:00
1000 -- [-1188.773] (-1191.197) (-1198.586) (-1190.415) * (-1195.522) (-1199.504) (-1199.314) [-1193.348] -- 0:00:00
1500 -- (-1192.509) (-1194.072) (-1193.892) [-1188.068] * [-1201.833] (-1192.867) (-1187.876) (-1193.620) -- 0:00:00
2000 -- (-1192.730) (-1191.986) (-1191.595) [-1189.496] * (-1195.784) (-1191.796) [-1196.080] (-1191.755) -- 0:00:00
2500 -- (-1186.910) (-1194.873) (-1191.230) [-1194.399] * (-1193.256) (-1194.432) [-1187.821] (-1189.437) -- 0:00:00
3000 -- (-1193.528) [-1194.487] (-1194.198) (-1198.302) * (-1189.692) [-1190.379] (-1195.654) (-1196.589) -- 0:00:00
3500 -- (-1195.046) (-1198.992) (-1191.004) [-1193.131] * (-1194.037) (-1192.115) [-1195.318] (-1196.094) -- 0:00:00
4000 -- (-1195.621) [-1192.469] (-1197.671) (-1192.491) * (-1190.678) (-1203.818) [-1185.074] (-1193.463) -- 0:00:00
4500 -- (-1189.447) (-1193.740) (-1197.882) [-1191.854] * [-1190.010] (-1193.766) (-1191.372) (-1189.656) -- 0:00:00
5000 -- [-1193.726] (-1188.687) (-1188.652) (-1192.021) * (-1200.327) (-1191.414) [-1189.408] (-1191.564) -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- [-1189.474] (-1194.412) (-1198.640) (-1197.672) * [-1191.115] (-1188.379) (-1194.458) (-1200.392) -- 0:00:00
6000 -- (-1189.165) (-1197.200) (-1193.039) [-1189.181] * (-1188.802) (-1195.239) [-1187.682] (-1193.746) -- 0:00:00
6500 -- (-1193.161) (-1191.743) (-1191.798) [-1191.898] * (-1197.300) (-1199.521) (-1187.725) [-1193.022] -- 0:02:32
7000 -- (-1200.119) (-1189.808) [-1188.842] (-1190.118) * (-1192.382) [-1186.719] (-1198.092) (-1186.609) -- 0:02:21
7500 -- [-1196.470] (-1184.406) (-1191.922) (-1192.637) * [-1191.808] (-1186.504) (-1197.206) (-1204.232) -- 0:02:12
8000 -- (-1189.875) (-1183.701) (-1191.979) [-1189.146] * (-1203.203) [-1197.189] (-1191.768) (-1190.792) -- 0:02:04
8500 -- [-1189.468] (-1185.018) (-1183.482) (-1198.909) * (-1200.558) [-1191.695] (-1189.831) (-1189.462) -- 0:01:56
9000 -- (-1194.590) [-1181.189] (-1184.065) (-1190.512) * (-1188.851) (-1194.287) (-1190.520) [-1188.715] -- 0:01:50
9500 -- (-1189.107) (-1182.440) (-1184.107) [-1192.624] * (-1188.018) [-1188.269] (-1188.984) (-1201.477) -- 0:01:44
10000 -- (-1191.155) (-1181.164) (-1181.744) [-1189.421] * (-1183.386) (-1195.327) (-1194.156) [-1189.678] -- 0:01:39
Average standard deviation of split frequencies: 0.057452
10500 -- [-1190.466] (-1183.294) (-1184.976) (-1205.585) * (-1184.179) (-1195.864) (-1190.180) [-1190.240] -- 0:01:34
11000 -- (-1197.775) (-1180.699) (-1185.361) [-1190.185] * [-1183.350] (-1200.083) (-1189.087) (-1186.829) -- 0:01:29
11500 -- (-1189.649) [-1181.681] (-1184.936) (-1186.754) * [-1181.534] (-1189.306) (-1188.969) (-1190.150) -- 0:01:25
12000 -- [-1195.088] (-1184.907) (-1182.717) (-1193.294) * (-1183.694) (-1192.632) [-1190.580] (-1192.283) -- 0:01:22
12500 -- (-1190.803) [-1186.247] (-1181.400) (-1194.849) * (-1182.314) (-1188.168) (-1190.484) [-1188.953] -- 0:01:19
13000 -- (-1193.378) (-1185.280) (-1181.887) [-1191.326] * (-1182.104) (-1191.276) (-1198.896) [-1192.820] -- 0:01:15
13500 -- (-1186.879) (-1181.915) [-1181.885] (-1193.250) * (-1187.822) (-1189.638) [-1188.938] (-1202.505) -- 0:01:13
14000 -- (-1190.289) (-1183.222) [-1183.305] (-1191.714) * [-1182.137] (-1191.492) (-1194.587) (-1192.726) -- 0:01:10
14500 -- [-1187.566] (-1182.211) (-1182.696) (-1191.735) * (-1181.918) (-1195.773) [-1190.141] (-1190.509) -- 0:01:07
15000 -- (-1191.686) [-1181.728] (-1181.173) (-1193.947) * (-1181.080) (-1190.635) [-1189.039] (-1189.770) -- 0:01:05
Average standard deviation of split frequencies: 0.049622
15500 -- [-1192.797] (-1181.030) (-1180.654) (-1191.541) * (-1182.278) [-1192.912] (-1189.872) (-1190.701) -- 0:01:03
16000 -- (-1189.665) (-1183.513) (-1180.654) [-1193.186] * (-1182.399) (-1202.638) [-1187.071] (-1191.642) -- 0:01:01
16500 -- [-1199.434] (-1184.364) (-1181.218) (-1193.729) * (-1181.698) (-1186.177) (-1193.908) [-1185.629] -- 0:00:59
17000 -- (-1190.559) [-1182.259] (-1181.121) (-1183.684) * (-1182.257) (-1202.950) [-1191.176] (-1189.708) -- 0:00:57
17500 -- [-1192.275] (-1183.009) (-1182.986) (-1181.749) * [-1182.362] (-1190.842) (-1192.990) (-1192.618) -- 0:00:56
18000 -- (-1190.102) (-1184.285) (-1181.598) [-1183.835] * (-1183.634) [-1185.236] (-1190.611) (-1196.675) -- 0:00:54
18500 -- (-1199.971) [-1187.855] (-1180.931) (-1182.910) * (-1181.674) [-1181.406] (-1191.828) (-1188.723) -- 0:00:53
19000 -- (-1200.199) (-1189.859) (-1180.796) [-1182.486] * (-1181.322) (-1181.832) (-1200.758) [-1192.926] -- 0:00:51
19500 -- (-1185.667) (-1181.408) (-1180.796) [-1181.977] * (-1181.726) (-1182.421) [-1184.164] (-1197.576) -- 0:00:50
20000 -- [-1193.052] (-1182.340) (-1181.048) (-1183.891) * (-1183.289) [-1185.690] (-1186.165) (-1193.600) -- 0:00:49
Average standard deviation of split frequencies: 0.055224
20500 -- (-1197.214) (-1185.206) [-1182.477] (-1182.697) * (-1186.620) [-1181.618] (-1183.854) (-1192.951) -- 0:00:47
21000 -- (-1196.432) (-1182.465) (-1181.267) [-1182.125] * (-1185.220) (-1182.240) (-1183.221) [-1188.160] -- 0:00:46
21500 -- (-1196.336) [-1182.846] (-1182.881) (-1180.755) * [-1184.607] (-1183.971) (-1183.845) (-1196.609) -- 0:00:45
22000 -- (-1191.708) (-1181.916) (-1183.223) [-1180.879] * (-1192.323) (-1183.914) [-1182.794] (-1194.823) -- 0:00:44
22500 -- (-1199.598) [-1180.943] (-1182.226) (-1183.097) * (-1187.251) (-1180.853) (-1182.033) [-1190.994] -- 0:01:26
23000 -- [-1192.276] (-1180.935) (-1185.946) (-1182.942) * (-1182.632) (-1185.101) [-1183.648] (-1198.220) -- 0:01:24
23500 -- (-1192.913) (-1181.613) (-1183.731) [-1183.422] * [-1182.292] (-1187.209) (-1183.423) (-1190.287) -- 0:01:23
24000 -- (-1189.971) (-1180.569) [-1181.822] (-1180.720) * (-1182.733) (-1185.847) [-1181.574] (-1201.038) -- 0:01:21
24500 -- [-1189.343] (-1182.347) (-1185.398) (-1184.287) * (-1183.316) [-1181.638] (-1180.735) (-1196.558) -- 0:01:19
25000 -- (-1189.045) (-1185.185) (-1181.357) [-1183.268] * (-1182.743) (-1184.156) [-1180.789] (-1191.459) -- 0:01:18
Average standard deviation of split frequencies: 0.051240
25500 -- [-1194.880] (-1183.165) (-1181.296) (-1184.274) * (-1183.973) (-1182.568) [-1180.850] (-1191.424) -- 0:01:16
26000 -- (-1191.313) [-1182.781] (-1186.463) (-1182.829) * (-1182.915) [-1181.577] (-1181.112) (-1190.280) -- 0:01:14
26500 -- (-1187.029) (-1183.586) [-1185.624] (-1184.437) * [-1182.912] (-1180.943) (-1184.344) (-1192.308) -- 0:01:13
27000 -- [-1186.848] (-1183.714) (-1182.954) (-1181.823) * (-1181.172) [-1182.788] (-1182.876) (-1198.291) -- 0:01:12
27500 -- [-1188.501] (-1183.638) (-1182.490) (-1182.458) * (-1181.687) [-1181.443] (-1182.011) (-1194.684) -- 0:01:10
28000 -- (-1198.080) (-1181.516) [-1184.133] (-1182.493) * (-1182.332) (-1183.157) (-1183.362) [-1191.874] -- 0:01:09
28500 -- (-1204.212) (-1181.076) (-1186.133) [-1183.785] * [-1181.617] (-1182.506) (-1180.888) (-1189.722) -- 0:01:08
29000 -- (-1182.809) (-1180.620) (-1183.695) [-1183.096] * (-1182.979) (-1182.490) [-1180.759] (-1208.841) -- 0:01:06
29500 -- (-1181.953) [-1182.707] (-1182.481) (-1183.027) * (-1180.455) (-1182.390) (-1188.822) [-1191.018] -- 0:01:05
30000 -- [-1183.292] (-1186.013) (-1187.646) (-1181.098) * (-1184.266) (-1182.354) (-1182.124) [-1196.635] -- 0:01:04
Average standard deviation of split frequencies: 0.043810
30500 -- [-1182.109] (-1186.426) (-1187.910) (-1181.251) * (-1184.099) (-1184.918) [-1181.499] (-1197.288) -- 0:01:03
31000 -- (-1182.015) (-1184.477) [-1183.058] (-1181.073) * (-1181.330) (-1183.198) [-1184.694] (-1199.057) -- 0:01:02
31500 -- (-1182.595) (-1186.092) [-1181.501] (-1182.265) * (-1182.993) (-1182.517) (-1183.471) [-1198.849] -- 0:01:01
32000 -- (-1182.152) [-1183.882] (-1181.485) (-1183.842) * (-1183.611) [-1181.005] (-1185.622) (-1193.274) -- 0:01:00
32500 -- (-1182.403) (-1181.591) (-1180.532) [-1184.918] * (-1183.805) (-1180.815) (-1181.921) [-1189.136] -- 0:00:59
33000 -- (-1182.325) [-1182.105] (-1181.221) (-1186.715) * (-1183.819) (-1183.037) [-1181.351] (-1197.591) -- 0:00:58
33500 -- (-1181.219) (-1183.004) [-1183.746] (-1182.445) * [-1182.104] (-1180.949) (-1181.563) (-1195.113) -- 0:00:57
34000 -- (-1181.576) (-1181.483) (-1182.664) [-1182.417] * [-1182.368] (-1180.563) (-1180.532) (-1193.065) -- 0:00:56
34500 -- (-1182.568) (-1184.949) (-1183.863) [-1184.537] * [-1180.883] (-1182.134) (-1183.066) (-1188.187) -- 0:00:55
35000 -- (-1183.419) (-1184.002) (-1181.921) [-1183.199] * (-1182.107) (-1182.311) (-1182.390) [-1191.121] -- 0:00:55
Average standard deviation of split frequencies: 0.042921
35500 -- [-1181.139] (-1182.602) (-1181.294) (-1184.152) * (-1181.220) (-1180.912) [-1180.958] (-1190.425) -- 0:00:54
36000 -- (-1184.522) (-1182.797) [-1180.650] (-1182.507) * (-1181.796) [-1182.746] (-1180.670) (-1197.374) -- 0:00:53
36500 -- (-1183.609) [-1181.988] (-1183.527) (-1185.629) * [-1181.778] (-1181.625) (-1180.907) (-1190.687) -- 0:00:52
37000 -- (-1193.191) (-1182.531) [-1185.856] (-1183.634) * (-1181.345) [-1183.544] (-1183.034) (-1187.544) -- 0:00:52
37500 -- (-1184.744) (-1184.452) (-1183.655) [-1183.451] * [-1182.842] (-1180.942) (-1184.244) (-1190.005) -- 0:00:51
38000 -- [-1184.307] (-1186.039) (-1185.575) (-1181.247) * (-1182.658) (-1180.974) [-1182.829] (-1187.028) -- 0:00:50
38500 -- (-1182.337) [-1181.033] (-1182.290) (-1184.871) * (-1182.142) (-1181.477) [-1181.976] (-1193.764) -- 0:01:14
39000 -- [-1182.394] (-1182.157) (-1182.714) (-1186.331) * (-1182.394) (-1181.344) [-1182.974] (-1200.659) -- 0:01:13
39500 -- (-1180.983) (-1183.016) (-1184.784) [-1184.657] * (-1181.086) [-1183.200] (-1181.048) (-1191.836) -- 0:01:12
40000 -- (-1181.163) (-1184.621) [-1181.762] (-1183.614) * (-1181.447) [-1181.343] (-1185.576) (-1192.761) -- 0:01:12
Average standard deviation of split frequencies: 0.035386
40500 -- (-1183.095) (-1184.255) [-1181.961] (-1183.385) * [-1180.989] (-1184.139) (-1183.191) (-1193.190) -- 0:01:11
41000 -- (-1182.414) (-1185.844) (-1184.218) [-1182.434] * (-1183.963) [-1181.283] (-1180.717) (-1190.617) -- 0:01:10
41500 -- (-1182.953) (-1184.293) [-1180.596] (-1181.809) * [-1182.112] (-1181.241) (-1184.081) (-1190.576) -- 0:01:09
42000 -- [-1181.150] (-1186.375) (-1183.527) (-1182.364) * (-1183.738) (-1181.376) [-1183.934] (-1194.294) -- 0:01:08
42500 -- (-1181.724) [-1182.247] (-1185.220) (-1182.263) * [-1181.902] (-1182.076) (-1184.646) (-1188.738) -- 0:01:07
43000 -- [-1180.629] (-1184.250) (-1189.347) (-1181.700) * (-1181.898) [-1182.079] (-1182.644) (-1189.359) -- 0:01:06
43500 -- [-1181.232] (-1182.746) (-1185.601) (-1181.613) * (-1187.819) (-1182.854) [-1181.811] (-1192.362) -- 0:01:05
44000 -- (-1185.872) (-1183.717) (-1182.683) [-1184.191] * [-1183.611] (-1180.834) (-1182.175) (-1185.896) -- 0:01:05
44500 -- (-1181.694) (-1183.732) [-1183.935] (-1184.868) * (-1185.837) [-1180.711] (-1181.274) (-1182.623) -- 0:01:04
45000 -- (-1184.450) (-1184.428) (-1183.558) [-1182.525] * (-1182.334) [-1183.605] (-1180.870) (-1181.222) -- 0:01:03
Average standard deviation of split frequencies: 0.034843
45500 -- [-1183.138] (-1184.864) (-1190.672) (-1182.776) * (-1184.834) [-1182.931] (-1181.631) (-1180.718) -- 0:01:02
46000 -- [-1182.581] (-1184.744) (-1188.006) (-1183.518) * (-1185.447) [-1183.055] (-1183.324) (-1180.698) -- 0:01:02
46500 -- (-1184.249) [-1182.642] (-1183.431) (-1182.965) * (-1182.221) (-1185.065) [-1181.882] (-1184.745) -- 0:01:01
47000 -- (-1181.236) (-1187.453) (-1185.937) [-1182.531] * (-1180.737) (-1183.484) [-1182.297] (-1181.157) -- 0:01:00
47500 -- [-1181.140] (-1181.254) (-1187.047) (-1181.893) * (-1181.267) (-1184.007) [-1181.942] (-1183.282) -- 0:01:00
48000 -- [-1182.686] (-1181.623) (-1184.898) (-1181.950) * [-1181.817] (-1182.529) (-1182.560) (-1181.754) -- 0:00:59
48500 -- [-1183.501] (-1181.081) (-1184.792) (-1182.342) * (-1181.834) (-1182.538) (-1182.558) [-1183.294] -- 0:00:58
49000 -- (-1182.503) (-1181.571) (-1181.800) [-1182.330] * [-1181.486] (-1183.030) (-1183.442) (-1182.949) -- 0:00:58
49500 -- (-1183.091) (-1181.602) (-1185.187) [-1182.796] * [-1183.940] (-1181.546) (-1183.963) (-1183.121) -- 0:00:57
50000 -- (-1182.518) [-1181.347] (-1181.588) (-1182.861) * (-1181.654) (-1183.018) [-1183.206] (-1185.728) -- 0:00:57
Average standard deviation of split frequencies: 0.043419
50500 -- (-1185.949) (-1181.279) [-1181.689] (-1188.974) * (-1181.168) [-1184.749] (-1182.381) (-1184.249) -- 0:00:56
51000 -- (-1182.395) [-1180.728] (-1186.575) (-1183.759) * (-1183.223) (-1183.570) (-1183.910) [-1183.236] -- 0:00:55
51500 -- (-1184.365) (-1182.427) [-1184.073] (-1186.831) * (-1182.584) (-1188.680) (-1185.488) [-1183.516] -- 0:00:55
52000 -- (-1181.660) (-1181.639) [-1184.554] (-1182.861) * (-1183.035) (-1182.004) (-1190.351) [-1183.599] -- 0:00:54
52500 -- [-1182.212] (-1181.541) (-1183.413) (-1181.342) * [-1183.134] (-1181.217) (-1182.575) (-1180.389) -- 0:00:54
53000 -- [-1180.967] (-1183.066) (-1184.516) (-1181.564) * [-1183.043] (-1187.206) (-1182.674) (-1181.387) -- 0:00:53
53500 -- (-1181.801) [-1180.560] (-1183.983) (-1180.877) * (-1180.848) (-1184.434) [-1184.144] (-1182.774) -- 0:00:53
54000 -- (-1182.131) (-1181.225) [-1184.655] (-1183.314) * (-1182.080) (-1183.763) (-1182.512) [-1181.387] -- 0:00:52
54500 -- [-1182.537] (-1180.625) (-1186.085) (-1184.277) * [-1182.906] (-1181.880) (-1180.902) (-1182.607) -- 0:00:52
55000 -- (-1182.650) [-1181.504] (-1184.590) (-1182.990) * [-1185.509] (-1183.156) (-1182.140) (-1183.397) -- 0:01:08
Average standard deviation of split frequencies: 0.039685
55500 -- (-1183.566) (-1182.837) [-1182.425] (-1186.232) * [-1182.384] (-1181.419) (-1181.567) (-1181.711) -- 0:01:08
56000 -- [-1180.847] (-1184.980) (-1186.380) (-1187.477) * (-1180.864) (-1182.202) [-1183.805] (-1186.462) -- 0:01:07
56500 -- (-1184.441) (-1183.365) (-1183.561) [-1183.729] * (-1187.266) [-1182.267] (-1185.828) (-1185.468) -- 0:01:06
57000 -- (-1185.457) (-1181.655) [-1181.845] (-1183.474) * [-1183.675] (-1182.768) (-1186.529) (-1184.677) -- 0:01:06
57500 -- (-1184.666) (-1182.112) [-1181.526] (-1185.570) * (-1184.096) [-1182.943] (-1186.160) (-1181.842) -- 0:01:05
58000 -- (-1185.149) [-1182.283] (-1181.693) (-1183.730) * [-1184.311] (-1181.236) (-1181.049) (-1183.102) -- 0:01:04
58500 -- (-1184.215) (-1181.297) [-1183.224] (-1183.592) * (-1185.844) [-1181.588] (-1185.722) (-1183.134) -- 0:01:04
59000 -- (-1181.488) (-1182.165) [-1181.299] (-1185.158) * (-1182.079) [-1185.103] (-1182.991) (-1183.834) -- 0:01:03
59500 -- (-1182.651) [-1181.875] (-1181.616) (-1184.582) * (-1182.274) (-1184.221) (-1185.264) [-1181.005] -- 0:01:03
60000 -- [-1183.917] (-1183.247) (-1187.212) (-1180.870) * [-1181.105] (-1182.506) (-1189.487) (-1180.623) -- 0:01:02
Average standard deviation of split frequencies: 0.039241
60500 -- (-1183.545) [-1182.127] (-1183.194) (-1182.454) * [-1181.613] (-1182.500) (-1186.682) (-1181.743) -- 0:01:02
61000 -- (-1181.263) (-1182.069) [-1183.474] (-1182.452) * (-1182.189) [-1182.871] (-1185.347) (-1180.893) -- 0:01:01
61500 -- (-1181.070) (-1182.747) [-1183.300] (-1186.576) * (-1183.952) [-1184.026] (-1181.749) (-1181.152) -- 0:01:01
62000 -- (-1183.856) (-1189.138) (-1183.026) [-1182.155] * (-1184.103) [-1182.160] (-1184.408) (-1183.170) -- 0:01:00
62500 -- (-1182.177) (-1185.116) [-1181.411] (-1182.250) * (-1181.594) (-1181.030) [-1185.088] (-1181.417) -- 0:01:00
63000 -- (-1181.515) (-1184.131) [-1182.908] (-1183.751) * [-1182.348] (-1180.791) (-1181.661) (-1181.706) -- 0:00:59
63500 -- [-1181.242] (-1183.949) (-1186.534) (-1182.593) * (-1182.223) (-1180.582) [-1181.355] (-1183.018) -- 0:00:58
64000 -- [-1182.567] (-1184.483) (-1186.527) (-1181.764) * (-1183.049) (-1181.624) (-1188.037) [-1181.127] -- 0:00:58
64500 -- (-1181.527) [-1185.509] (-1186.826) (-1181.916) * (-1183.611) (-1181.520) (-1184.775) [-1181.356] -- 0:00:58
65000 -- (-1180.953) [-1184.345] (-1182.858) (-1183.648) * (-1182.560) (-1180.483) (-1185.100) [-1180.429] -- 0:00:57
Average standard deviation of split frequencies: 0.032651
65500 -- [-1181.548] (-1180.586) (-1181.708) (-1183.663) * (-1183.070) (-1182.023) (-1183.895) [-1180.862] -- 0:00:57
66000 -- (-1181.099) (-1185.737) (-1181.356) [-1182.650] * (-1183.080) (-1183.626) [-1181.728] (-1183.305) -- 0:00:56
66500 -- [-1185.669] (-1183.074) (-1182.892) (-1184.787) * [-1183.387] (-1182.770) (-1184.579) (-1183.714) -- 0:00:56
67000 -- (-1184.308) (-1182.478) (-1182.975) [-1182.364] * [-1181.784] (-1183.496) (-1183.817) (-1184.874) -- 0:00:55
67500 -- [-1182.453] (-1183.457) (-1183.834) (-1180.673) * [-1181.764] (-1182.141) (-1182.988) (-1182.798) -- 0:00:55
68000 -- (-1182.547) [-1181.912] (-1181.931) (-1180.835) * (-1188.905) (-1180.962) (-1181.019) [-1181.180] -- 0:00:54
68500 -- [-1182.015] (-1181.850) (-1181.188) (-1182.265) * (-1181.154) [-1180.870] (-1184.052) (-1182.569) -- 0:00:54
69000 -- [-1181.232] (-1182.154) (-1185.152) (-1185.934) * (-1180.695) (-1181.329) (-1181.432) [-1182.547] -- 0:00:53
69500 -- (-1181.216) [-1181.876] (-1181.138) (-1181.725) * (-1180.921) (-1180.857) (-1181.244) [-1182.587] -- 0:00:53
70000 -- (-1184.188) (-1181.408) [-1180.807] (-1181.242) * [-1180.841] (-1181.470) (-1184.495) (-1188.958) -- 0:00:53
Average standard deviation of split frequencies: 0.033688
70500 -- [-1181.616] (-1182.766) (-1183.062) (-1182.324) * (-1180.734) (-1183.174) [-1185.346] (-1183.375) -- 0:00:52
71000 -- (-1181.517) (-1182.766) (-1181.307) [-1185.135] * [-1182.125] (-1183.166) (-1181.351) (-1181.561) -- 0:00:52
71500 -- [-1183.960] (-1181.963) (-1180.867) (-1187.770) * (-1180.927) (-1181.177) (-1182.498) [-1181.401] -- 0:01:04
72000 -- (-1181.655) (-1181.397) (-1181.307) [-1189.447] * (-1183.005) (-1181.554) (-1181.108) [-1181.230] -- 0:01:04
72500 -- (-1181.486) (-1182.295) [-1183.417] (-1182.555) * (-1184.352) (-1184.556) [-1182.421] (-1181.346) -- 0:01:03
73000 -- (-1180.840) (-1181.797) (-1184.024) [-1181.754] * [-1183.330] (-1182.446) (-1183.817) (-1183.745) -- 0:01:03
73500 -- (-1184.350) [-1181.714] (-1183.881) (-1183.290) * [-1182.312] (-1181.376) (-1182.964) (-1182.723) -- 0:01:03
74000 -- (-1181.301) [-1181.467] (-1187.433) (-1180.698) * [-1182.836] (-1187.230) (-1184.133) (-1184.199) -- 0:01:02
74500 -- [-1181.838] (-1181.616) (-1182.018) (-1183.455) * [-1181.758] (-1184.259) (-1187.975) (-1183.767) -- 0:01:02
75000 -- (-1183.362) [-1181.373] (-1184.055) (-1184.285) * [-1182.707] (-1182.224) (-1185.419) (-1183.294) -- 0:01:01
Average standard deviation of split frequencies: 0.028222
75500 -- (-1184.187) [-1182.582] (-1182.843) (-1181.672) * (-1180.711) [-1180.768] (-1183.498) (-1185.479) -- 0:01:01
76000 -- (-1181.483) (-1186.304) (-1185.068) [-1182.023] * (-1185.381) (-1181.020) [-1182.697] (-1182.163) -- 0:01:00
76500 -- (-1181.522) [-1185.388] (-1182.235) (-1183.173) * (-1184.491) [-1181.130] (-1185.999) (-1182.358) -- 0:01:00
77000 -- (-1181.390) (-1182.316) [-1181.817] (-1184.660) * (-1182.417) (-1181.066) (-1181.610) [-1181.851] -- 0:00:59
77500 -- [-1182.036] (-1182.932) (-1181.127) (-1183.686) * (-1180.830) (-1185.846) [-1182.274] (-1182.761) -- 0:00:59
78000 -- [-1182.148] (-1184.363) (-1181.813) (-1182.475) * (-1181.395) (-1184.983) [-1181.506] (-1182.560) -- 0:00:59
78500 -- (-1182.078) [-1185.314] (-1182.609) (-1181.557) * [-1181.422] (-1181.510) (-1182.609) (-1183.741) -- 0:00:58
79000 -- (-1181.349) (-1186.964) (-1181.257) [-1181.480] * (-1184.995) (-1181.909) [-1184.643] (-1183.912) -- 0:00:58
79500 -- (-1182.110) (-1185.164) [-1181.712] (-1183.678) * (-1188.139) (-1181.511) (-1184.417) [-1184.663] -- 0:00:57
80000 -- (-1181.296) (-1186.251) (-1186.048) [-1183.107] * (-1182.772) [-1183.908] (-1186.683) (-1186.734) -- 0:00:57
Average standard deviation of split frequencies: 0.027271
80500 -- (-1182.323) [-1182.394] (-1186.701) (-1183.192) * (-1183.323) [-1184.859] (-1183.182) (-1184.274) -- 0:00:57
81000 -- (-1181.922) (-1183.733) [-1181.020] (-1182.649) * (-1180.793) (-1182.750) [-1182.932] (-1184.790) -- 0:00:56
81500 -- (-1182.663) (-1183.143) [-1181.007] (-1182.015) * [-1181.140] (-1182.326) (-1183.125) (-1183.596) -- 0:00:56
82000 -- [-1182.761] (-1184.134) (-1182.649) (-1184.679) * [-1181.722] (-1182.009) (-1181.747) (-1182.353) -- 0:00:55
82500 -- (-1183.276) (-1185.877) (-1181.872) [-1181.928] * (-1181.124) (-1182.298) [-1181.974] (-1185.163) -- 0:00:55
83000 -- (-1184.441) (-1181.519) (-1185.664) [-1181.901] * (-1181.084) [-1182.160] (-1184.309) (-1182.367) -- 0:00:55
83500 -- (-1184.162) (-1181.179) [-1181.688] (-1183.045) * (-1180.805) [-1180.544] (-1183.009) (-1181.999) -- 0:00:54
84000 -- (-1182.697) (-1183.508) [-1182.990] (-1181.609) * (-1180.689) [-1181.842] (-1185.345) (-1182.275) -- 0:00:54
84500 -- (-1183.519) (-1181.175) (-1181.712) [-1181.360] * (-1180.801) [-1181.984] (-1183.958) (-1182.738) -- 0:00:54
85000 -- (-1183.778) (-1182.727) [-1181.549] (-1182.328) * [-1180.794] (-1186.164) (-1182.344) (-1189.991) -- 0:00:53
Average standard deviation of split frequencies: 0.022970
85500 -- (-1181.663) [-1182.160] (-1183.425) (-1180.937) * (-1182.665) [-1184.703] (-1182.948) (-1184.563) -- 0:00:53
86000 -- (-1181.166) (-1182.644) [-1185.044] (-1183.155) * (-1181.218) (-1182.231) (-1180.910) [-1183.216] -- 0:00:53
86500 -- (-1182.012) [-1182.535] (-1184.958) (-1182.850) * (-1182.552) (-1181.271) (-1180.899) [-1183.817] -- 0:00:52
87000 -- (-1182.688) (-1181.910) (-1183.028) [-1182.943] * [-1181.240] (-1182.116) (-1182.084) (-1185.423) -- 0:00:52
87500 -- (-1181.574) (-1181.262) (-1185.114) [-1182.310] * [-1182.747] (-1183.322) (-1182.051) (-1185.815) -- 0:01:02
88000 -- (-1187.200) (-1182.787) [-1183.645] (-1181.510) * [-1181.930] (-1184.097) (-1181.030) (-1183.862) -- 0:01:02
88500 -- [-1184.597] (-1181.814) (-1183.538) (-1181.389) * (-1182.118) (-1183.700) [-1182.231] (-1182.244) -- 0:01:01
89000 -- (-1181.658) (-1180.990) (-1187.039) [-1184.922] * (-1182.146) [-1186.301] (-1182.450) (-1181.223) -- 0:01:01
89500 -- (-1183.731) (-1181.768) (-1181.687) [-1184.871] * (-1181.803) [-1188.742] (-1182.931) (-1181.989) -- 0:01:01
90000 -- (-1181.823) [-1182.186] (-1185.090) (-1183.003) * (-1185.022) [-1182.857] (-1181.662) (-1181.575) -- 0:01:00
Average standard deviation of split frequencies: 0.020797
90500 -- [-1180.622] (-1184.146) (-1184.858) (-1182.792) * (-1186.735) [-1182.354] (-1182.262) (-1183.979) -- 0:01:00
91000 -- (-1181.597) (-1184.518) [-1182.854] (-1182.790) * (-1182.920) (-1185.051) (-1186.569) [-1183.148] -- 0:00:59
91500 -- (-1182.334) (-1184.842) [-1181.752] (-1181.650) * (-1180.597) (-1186.116) [-1186.434] (-1181.521) -- 0:00:59
92000 -- (-1180.426) (-1182.346) [-1181.292] (-1185.263) * (-1181.647) (-1185.085) (-1183.668) [-1180.988] -- 0:00:59
92500 -- (-1184.430) (-1185.544) [-1182.117] (-1181.714) * (-1182.481) (-1184.222) (-1181.014) [-1180.923] -- 0:00:58
93000 -- [-1182.574] (-1187.883) (-1182.825) (-1182.164) * (-1181.415) (-1181.215) [-1187.121] (-1182.238) -- 0:00:58
93500 -- [-1182.125] (-1187.037) (-1181.985) (-1181.580) * (-1182.737) (-1186.764) [-1182.864] (-1182.536) -- 0:00:58
94000 -- (-1187.478) (-1185.065) [-1181.060] (-1181.201) * (-1182.459) (-1182.875) [-1181.752] (-1188.238) -- 0:00:57
94500 -- (-1183.758) (-1183.084) (-1183.250) [-1182.984] * (-1183.073) [-1184.295] (-1183.535) (-1184.642) -- 0:00:57
95000 -- [-1184.444] (-1183.094) (-1182.940) (-1182.500) * [-1186.507] (-1182.796) (-1182.357) (-1184.334) -- 0:00:57
Average standard deviation of split frequencies: 0.019151
95500 -- (-1182.958) (-1183.256) [-1183.230] (-1184.693) * (-1185.293) (-1183.898) [-1181.715] (-1186.639) -- 0:00:56
96000 -- (-1185.399) (-1185.953) [-1182.619] (-1186.270) * (-1183.210) (-1181.397) [-1182.685] (-1182.979) -- 0:00:56
96500 -- (-1185.533) [-1183.260] (-1184.586) (-1184.411) * (-1180.479) [-1180.895] (-1183.534) (-1184.811) -- 0:00:56
97000 -- [-1184.135] (-1183.548) (-1181.917) (-1183.625) * (-1181.915) (-1180.807) [-1182.083] (-1181.203) -- 0:00:55
97500 -- (-1181.514) [-1183.339] (-1181.769) (-1182.596) * (-1180.598) (-1181.208) [-1181.420] (-1181.437) -- 0:00:55
98000 -- (-1180.620) (-1183.983) [-1182.015] (-1182.218) * (-1185.418) (-1183.460) [-1184.605] (-1184.761) -- 0:00:55
98500 -- (-1187.940) [-1183.758] (-1182.213) (-1184.186) * [-1186.277] (-1186.111) (-1183.059) (-1184.196) -- 0:00:54
99000 -- [-1182.708] (-1182.137) (-1181.556) (-1181.786) * (-1183.423) [-1182.530] (-1184.809) (-1184.052) -- 0:00:54
99500 -- (-1182.512) (-1181.899) (-1182.330) [-1181.071] * (-1184.993) (-1183.591) (-1184.509) [-1185.099] -- 0:00:54
100000 -- (-1182.162) (-1182.505) (-1186.035) [-1181.177] * [-1184.735] (-1181.250) (-1186.840) (-1181.805) -- 0:00:54
Average standard deviation of split frequencies: 0.019668
100500 -- (-1182.504) [-1181.546] (-1183.416) (-1181.706) * (-1181.114) (-1185.955) (-1187.177) [-1185.043] -- 0:00:53
101000 -- (-1180.917) (-1184.372) (-1181.816) [-1182.431] * [-1184.027] (-1183.631) (-1182.835) (-1183.140) -- 0:00:53
101500 -- (-1187.161) (-1183.614) [-1181.843] (-1182.821) * (-1181.121) (-1182.580) [-1181.555] (-1187.030) -- 0:00:53
102000 -- (-1181.993) [-1181.340] (-1181.863) (-1183.437) * (-1181.121) (-1183.170) [-1181.739] (-1182.864) -- 0:00:52
102500 -- (-1184.205) (-1181.277) (-1182.782) [-1181.902] * (-1180.727) (-1184.061) [-1187.659] (-1182.965) -- 0:00:52
103000 -- (-1185.762) (-1182.537) (-1181.181) [-1180.929] * (-1180.825) (-1184.390) (-1181.692) [-1184.297] -- 0:00:52
103500 -- [-1183.613] (-1182.538) (-1182.973) (-1182.941) * (-1180.824) (-1183.731) (-1180.796) [-1182.509] -- 0:01:00
104000 -- (-1183.555) [-1181.137] (-1184.200) (-1184.327) * [-1183.435] (-1181.721) (-1181.389) (-1182.467) -- 0:01:00
104500 -- [-1183.055] (-1181.463) (-1187.305) (-1183.024) * (-1180.848) (-1181.942) [-1182.176] (-1182.736) -- 0:00:59
105000 -- (-1182.162) (-1184.199) [-1182.044] (-1181.934) * (-1181.593) (-1182.041) [-1183.868] (-1186.114) -- 0:00:59
Average standard deviation of split frequencies: 0.017789
105500 -- (-1186.513) (-1182.527) [-1184.166] (-1182.911) * (-1182.752) (-1182.395) (-1185.577) [-1181.656] -- 0:00:59
106000 -- (-1186.359) [-1182.436] (-1184.535) (-1184.096) * (-1184.892) (-1182.631) (-1184.751) [-1181.538] -- 0:00:59
106500 -- [-1185.277] (-1186.923) (-1184.595) (-1184.924) * (-1184.614) (-1180.946) (-1186.177) [-1182.645] -- 0:00:58
107000 -- (-1184.302) (-1187.159) [-1184.998] (-1183.303) * (-1181.849) (-1182.317) [-1183.518] (-1184.584) -- 0:00:58
107500 -- (-1185.728) [-1181.809] (-1181.925) (-1183.233) * (-1182.183) (-1182.348) [-1183.343] (-1186.159) -- 0:00:58
108000 -- [-1186.198] (-1181.807) (-1180.631) (-1184.053) * (-1182.371) (-1182.869) (-1184.991) [-1181.918] -- 0:00:57
108500 -- (-1183.419) [-1181.966] (-1181.830) (-1184.443) * (-1181.310) (-1181.034) [-1181.769] (-1181.622) -- 0:00:57
109000 -- (-1185.818) [-1183.433] (-1183.300) (-1183.986) * (-1182.136) (-1182.912) (-1182.593) [-1181.294] -- 0:00:57
109500 -- (-1184.371) (-1184.124) [-1184.941] (-1182.333) * (-1181.618) (-1184.664) (-1183.992) [-1181.680] -- 0:00:56
110000 -- [-1183.047] (-1187.032) (-1183.105) (-1182.346) * (-1180.769) (-1182.103) (-1182.974) [-1182.642] -- 0:00:56
Average standard deviation of split frequencies: 0.017252
110500 -- [-1183.590] (-1181.922) (-1183.857) (-1184.890) * (-1186.542) (-1184.165) [-1185.255] (-1181.798) -- 0:00:56
111000 -- (-1185.404) [-1181.455] (-1180.980) (-1184.732) * (-1186.881) [-1180.602] (-1184.266) (-1188.038) -- 0:00:56
111500 -- (-1182.566) (-1181.672) (-1183.542) [-1183.932] * (-1185.752) (-1180.581) (-1183.602) [-1187.577] -- 0:00:55
112000 -- (-1185.531) [-1181.144] (-1182.530) (-1181.846) * (-1182.388) [-1181.368] (-1188.479) (-1183.631) -- 0:00:55
112500 -- [-1183.827] (-1183.093) (-1182.178) (-1185.010) * (-1181.423) [-1183.530] (-1185.649) (-1185.404) -- 0:00:55
113000 -- (-1185.643) (-1183.349) [-1181.678] (-1183.925) * [-1182.750] (-1182.146) (-1184.308) (-1184.949) -- 0:00:54
113500 -- (-1182.866) (-1182.958) [-1185.437] (-1180.963) * (-1181.937) (-1181.958) [-1183.983] (-1184.365) -- 0:00:54
114000 -- (-1181.555) [-1182.237] (-1182.405) (-1181.133) * (-1181.290) (-1181.890) (-1185.023) [-1181.830] -- 0:00:54
114500 -- [-1182.153] (-1183.533) (-1182.342) (-1181.786) * [-1181.038] (-1184.529) (-1183.054) (-1182.763) -- 0:00:54
115000 -- (-1182.405) (-1182.396) (-1186.457) [-1181.122] * [-1180.555] (-1183.811) (-1182.603) (-1183.707) -- 0:00:53
Average standard deviation of split frequencies: 0.016707
115500 -- [-1182.775] (-1182.483) (-1185.996) (-1181.762) * (-1180.778) [-1182.000] (-1183.489) (-1181.705) -- 0:00:53
116000 -- (-1183.950) [-1184.643] (-1185.274) (-1181.084) * [-1183.250] (-1183.452) (-1182.521) (-1181.463) -- 0:00:53
116500 -- [-1184.086] (-1183.934) (-1182.497) (-1182.054) * [-1181.912] (-1181.142) (-1182.455) (-1182.448) -- 0:00:53
117000 -- (-1187.468) [-1180.991] (-1182.123) (-1180.918) * (-1183.227) (-1181.150) (-1182.466) [-1182.639] -- 0:00:52
117500 -- (-1186.455) (-1181.540) (-1183.184) [-1181.454] * [-1184.136] (-1182.334) (-1184.222) (-1182.746) -- 0:00:52
118000 -- (-1186.416) [-1181.240] (-1181.681) (-1182.754) * (-1185.359) (-1182.067) (-1183.906) [-1180.905] -- 0:00:52
118500 -- (-1184.434) (-1184.137) [-1182.219] (-1181.566) * (-1184.865) (-1182.499) [-1184.714] (-1184.445) -- 0:00:52
119000 -- [-1186.879] (-1182.932) (-1185.263) (-1182.145) * (-1182.890) (-1183.106) [-1183.321] (-1183.311) -- 0:00:51
119500 -- [-1184.121] (-1181.681) (-1183.149) (-1183.522) * (-1183.219) (-1183.124) (-1181.776) [-1181.232] -- 0:00:58
120000 -- (-1182.241) (-1181.440) [-1182.480] (-1181.123) * (-1182.786) (-1181.510) (-1180.826) [-1181.979] -- 0:00:58
Average standard deviation of split frequencies: 0.015421
120500 -- (-1183.190) [-1181.825] (-1186.068) (-1182.608) * [-1182.037] (-1180.621) (-1184.313) (-1180.627) -- 0:00:58
121000 -- [-1182.551] (-1184.432) (-1182.726) (-1180.937) * (-1183.562) (-1181.487) [-1180.478] (-1181.587) -- 0:00:58
121500 -- (-1182.915) [-1184.882] (-1181.705) (-1181.558) * (-1183.648) (-1181.968) [-1182.472] (-1183.152) -- 0:00:57
122000 -- (-1183.714) (-1186.763) [-1182.156] (-1181.601) * (-1181.663) [-1181.502] (-1183.273) (-1181.442) -- 0:00:57
122500 -- (-1181.602) (-1187.084) [-1181.481] (-1181.013) * (-1185.444) (-1182.016) [-1181.528] (-1186.495) -- 0:00:57
123000 -- [-1180.832] (-1184.690) (-1180.865) (-1183.733) * [-1183.730] (-1182.145) (-1181.688) (-1184.261) -- 0:00:57
123500 -- (-1180.832) (-1183.267) (-1180.792) [-1180.841] * [-1182.631] (-1184.966) (-1184.194) (-1181.807) -- 0:00:56
124000 -- [-1181.918] (-1180.926) (-1182.760) (-1181.402) * (-1185.598) (-1181.996) [-1184.972] (-1183.063) -- 0:00:56
124500 -- (-1181.405) (-1182.188) (-1180.770) [-1189.020] * (-1183.171) (-1181.657) [-1180.929] (-1182.886) -- 0:00:56
125000 -- (-1180.436) (-1184.575) (-1182.614) [-1182.645] * (-1182.551) [-1181.475] (-1183.662) (-1183.579) -- 0:00:56
Average standard deviation of split frequencies: 0.015359
125500 -- (-1182.966) (-1186.012) [-1185.692] (-1182.787) * (-1182.766) [-1184.318] (-1183.654) (-1188.406) -- 0:00:55
126000 -- [-1180.363] (-1183.439) (-1184.860) (-1180.990) * (-1184.505) (-1185.522) (-1184.203) [-1183.915] -- 0:00:55
126500 -- (-1182.132) [-1183.778] (-1183.609) (-1182.613) * (-1184.591) (-1180.888) (-1181.446) [-1185.367] -- 0:00:55
127000 -- (-1182.215) [-1182.152] (-1186.785) (-1185.304) * (-1182.063) [-1181.757] (-1180.694) (-1184.723) -- 0:00:54
127500 -- [-1183.637] (-1183.936) (-1185.920) (-1182.776) * (-1182.271) (-1184.393) (-1183.233) [-1180.438] -- 0:00:54
128000 -- (-1188.483) (-1193.163) [-1182.173] (-1184.755) * (-1181.686) (-1183.336) (-1181.282) [-1181.561] -- 0:00:54
128500 -- (-1181.365) (-1184.855) (-1183.913) [-1183.377] * (-1184.364) (-1185.470) [-1181.651] (-1180.976) -- 0:00:54
129000 -- (-1181.726) [-1182.933] (-1189.011) (-1181.751) * (-1182.194) [-1185.656] (-1182.089) (-1181.861) -- 0:00:54
129500 -- (-1182.083) [-1182.152] (-1182.415) (-1183.018) * (-1183.505) (-1182.829) [-1181.552] (-1181.168) -- 0:00:53
130000 -- (-1181.881) [-1181.496] (-1181.956) (-1182.532) * (-1181.821) (-1182.228) [-1181.552] (-1183.027) -- 0:00:53
Average standard deviation of split frequencies: 0.015000
130500 -- (-1181.840) (-1181.730) (-1182.266) [-1180.954] * [-1184.985] (-1182.386) (-1183.673) (-1184.399) -- 0:00:53
131000 -- (-1181.890) (-1183.707) (-1182.073) [-1181.319] * [-1183.698] (-1182.294) (-1181.777) (-1186.727) -- 0:00:53
131500 -- (-1181.872) (-1183.350) (-1186.380) [-1182.478] * (-1180.989) (-1184.628) [-1183.516] (-1187.964) -- 0:00:52
132000 -- [-1181.832] (-1182.638) (-1183.109) (-1184.002) * (-1182.060) (-1183.211) (-1184.508) [-1183.455] -- 0:00:52
132500 -- (-1182.092) (-1183.340) (-1184.097) [-1183.867] * (-1182.871) (-1186.248) [-1184.263] (-1181.066) -- 0:00:52
133000 -- (-1180.780) (-1185.474) [-1184.258] (-1185.956) * (-1185.216) (-1184.639) (-1184.241) [-1183.313] -- 0:00:52
133500 -- (-1181.566) [-1185.538] (-1183.622) (-1183.465) * (-1182.455) [-1184.730] (-1184.928) (-1182.969) -- 0:00:51
134000 -- [-1181.257] (-1183.284) (-1188.239) (-1184.004) * [-1181.907] (-1183.217) (-1184.298) (-1184.415) -- 0:00:51
134500 -- [-1181.740] (-1181.972) (-1182.661) (-1185.314) * [-1182.703] (-1185.257) (-1182.103) (-1184.654) -- 0:00:51
135000 -- (-1184.710) (-1182.096) [-1180.546] (-1183.570) * (-1183.418) (-1183.943) [-1182.049] (-1184.142) -- 0:00:51
Average standard deviation of split frequencies: 0.015324
135500 -- (-1182.229) [-1184.438] (-1183.851) (-1182.540) * (-1181.645) (-1185.120) [-1185.257] (-1183.805) -- 0:00:57
136000 -- (-1182.425) (-1183.958) [-1181.819] (-1182.811) * (-1180.763) (-1184.375) [-1183.823] (-1183.026) -- 0:00:57
136500 -- (-1181.436) (-1181.743) [-1181.302] (-1183.522) * (-1182.836) [-1187.452] (-1183.656) (-1182.407) -- 0:00:56
137000 -- (-1184.481) [-1180.841] (-1182.415) (-1181.015) * [-1180.386] (-1186.190) (-1182.167) (-1182.267) -- 0:00:56
137500 -- (-1187.218) (-1185.023) [-1183.472] (-1181.432) * [-1184.170] (-1183.760) (-1181.331) (-1182.137) -- 0:00:56
138000 -- (-1188.249) (-1180.848) [-1183.670] (-1181.286) * (-1183.594) (-1181.118) [-1182.131] (-1182.661) -- 0:00:56
138500 -- (-1186.730) [-1181.919] (-1183.249) (-1181.160) * (-1184.189) (-1186.500) (-1183.317) [-1184.548] -- 0:00:55
139000 -- (-1180.713) (-1182.730) [-1183.479] (-1181.965) * (-1183.126) (-1184.995) (-1182.162) [-1182.466] -- 0:00:55
139500 -- (-1185.409) [-1185.396] (-1182.996) (-1185.308) * (-1185.061) (-1184.206) (-1185.699) [-1181.402] -- 0:00:55
140000 -- (-1182.025) [-1183.747] (-1182.132) (-1185.114) * (-1182.888) (-1183.918) (-1182.899) [-1181.856] -- 0:00:55
Average standard deviation of split frequencies: 0.015080
140500 -- (-1183.182) (-1181.337) [-1181.377] (-1182.238) * (-1184.748) [-1183.538] (-1185.772) (-1181.875) -- 0:00:55
141000 -- (-1182.030) (-1180.467) [-1182.522] (-1183.494) * [-1181.553] (-1183.280) (-1183.710) (-1181.890) -- 0:00:54
141500 -- (-1181.157) (-1181.753) [-1183.931] (-1183.984) * (-1180.692) (-1182.506) [-1189.258] (-1181.860) -- 0:00:54
142000 -- (-1181.572) (-1181.057) [-1183.868] (-1183.137) * [-1181.567] (-1184.721) (-1183.521) (-1182.015) -- 0:00:54
142500 -- (-1181.515) (-1181.719) (-1183.893) [-1184.069] * [-1180.859] (-1183.589) (-1180.824) (-1182.344) -- 0:00:54
143000 -- (-1181.303) (-1182.551) (-1187.498) [-1181.814] * (-1181.747) (-1188.059) (-1185.286) [-1182.054] -- 0:00:53
143500 -- [-1182.771] (-1184.132) (-1185.745) (-1183.510) * (-1181.747) [-1182.377] (-1182.623) (-1182.477) -- 0:00:53
144000 -- [-1182.777] (-1182.999) (-1187.763) (-1184.023) * [-1180.900] (-1183.294) (-1181.187) (-1183.358) -- 0:00:53
144500 -- [-1182.333] (-1181.988) (-1184.155) (-1181.442) * (-1182.981) (-1182.803) [-1181.242] (-1182.079) -- 0:00:53
145000 -- [-1185.255] (-1181.944) (-1185.494) (-1181.488) * (-1181.771) [-1182.838] (-1182.898) (-1186.247) -- 0:00:53
Average standard deviation of split frequencies: 0.013453
145500 -- (-1181.575) [-1181.591] (-1182.227) (-1183.851) * (-1184.151) (-1182.480) (-1182.155) [-1182.238] -- 0:00:52
146000 -- [-1181.633] (-1181.158) (-1181.667) (-1182.409) * (-1181.301) (-1182.490) [-1181.976] (-1181.976) -- 0:00:52
146500 -- (-1181.308) (-1183.534) [-1182.688] (-1181.749) * (-1181.212) [-1182.788] (-1183.405) (-1183.032) -- 0:00:52
147000 -- (-1181.044) [-1181.781] (-1185.714) (-1185.035) * (-1180.943) [-1181.542] (-1183.448) (-1184.082) -- 0:00:52
147500 -- (-1181.932) (-1183.253) (-1183.079) [-1182.064] * (-1180.450) (-1186.064) (-1184.367) [-1182.660] -- 0:00:52
148000 -- (-1182.673) (-1183.466) (-1186.085) [-1181.653] * [-1182.139] (-1182.985) (-1181.279) (-1182.487) -- 0:00:51
148500 -- (-1181.575) (-1181.962) (-1183.630) [-1180.799] * (-1182.407) (-1182.293) (-1182.081) [-1181.937] -- 0:00:51
149000 -- (-1182.032) (-1181.398) [-1182.400] (-1182.153) * [-1182.313] (-1181.874) (-1182.597) (-1184.250) -- 0:00:51
149500 -- (-1185.913) (-1181.384) [-1180.875] (-1182.808) * [-1185.145] (-1186.826) (-1183.513) (-1183.723) -- 0:00:51
150000 -- (-1184.726) (-1182.698) (-1182.342) [-1183.059] * (-1183.542) (-1188.812) [-1187.632] (-1181.960) -- 0:00:51
Average standard deviation of split frequencies: 0.011994
150500 -- [-1182.126] (-1181.777) (-1182.548) (-1186.257) * [-1187.116] (-1183.876) (-1182.607) (-1181.687) -- 0:00:50
151000 -- (-1182.880) [-1181.824] (-1181.029) (-1182.430) * (-1188.046) (-1181.511) [-1183.699] (-1181.064) -- 0:00:50
151500 -- (-1182.811) [-1182.363] (-1183.651) (-1181.989) * (-1185.048) [-1181.060] (-1183.254) (-1182.895) -- 0:00:56
152000 -- [-1183.122] (-1183.044) (-1182.340) (-1181.283) * (-1182.993) [-1182.703] (-1182.512) (-1182.390) -- 0:00:55
152500 -- (-1183.371) (-1181.952) (-1182.822) [-1181.548] * (-1184.483) [-1185.623] (-1184.843) (-1180.743) -- 0:00:55
153000 -- (-1182.885) (-1183.795) [-1182.045] (-1183.176) * (-1180.754) (-1184.199) [-1181.626] (-1182.717) -- 0:00:55
153500 -- (-1183.148) (-1181.741) [-1181.413] (-1183.627) * [-1181.813] (-1187.253) (-1181.535) (-1183.398) -- 0:00:55
154000 -- (-1184.536) (-1183.508) (-1181.181) [-1184.447] * (-1181.487) (-1184.716) (-1182.818) [-1182.632] -- 0:00:54
154500 -- [-1183.799] (-1182.136) (-1182.462) (-1183.331) * (-1181.315) (-1187.201) (-1182.413) [-1182.632] -- 0:00:54
155000 -- (-1180.987) (-1181.867) [-1181.316] (-1183.758) * (-1185.982) [-1182.144] (-1185.507) (-1181.112) -- 0:00:54
Average standard deviation of split frequencies: 0.012591
155500 -- (-1183.737) (-1184.426) (-1183.411) [-1182.902] * (-1183.724) (-1182.896) (-1186.124) [-1180.668] -- 0:00:54
156000 -- [-1181.282] (-1183.207) (-1184.323) (-1181.360) * (-1181.446) (-1182.046) [-1181.741] (-1180.915) -- 0:00:54
156500 -- (-1182.531) (-1181.885) (-1185.099) [-1182.263] * (-1181.176) (-1183.306) [-1184.318] (-1183.083) -- 0:00:53
157000 -- (-1182.505) (-1181.998) (-1184.715) [-1182.588] * (-1181.399) (-1183.520) [-1181.594] (-1180.580) -- 0:00:53
157500 -- [-1181.729] (-1182.272) (-1183.036) (-1183.006) * [-1182.498] (-1184.178) (-1182.778) (-1184.554) -- 0:00:53
158000 -- (-1180.936) (-1189.989) (-1186.208) [-1183.907] * (-1182.437) (-1183.248) (-1185.828) [-1183.161] -- 0:00:53
158500 -- (-1182.688) (-1186.576) (-1184.385) [-1181.701] * (-1181.610) (-1183.830) [-1182.654] (-1181.840) -- 0:00:53
159000 -- [-1183.394] (-1182.996) (-1183.413) (-1184.935) * (-1182.780) (-1186.795) [-1182.333] (-1183.214) -- 0:00:52
159500 -- (-1183.266) (-1182.850) [-1185.610] (-1183.377) * (-1182.566) (-1187.292) [-1182.500] (-1181.855) -- 0:00:52
160000 -- (-1181.977) [-1183.855] (-1182.317) (-1183.811) * (-1182.900) (-1187.168) [-1181.738] (-1183.800) -- 0:00:52
Average standard deviation of split frequencies: 0.012045
160500 -- (-1181.310) (-1181.765) (-1185.999) [-1182.450] * [-1182.772] (-1185.564) (-1184.625) (-1181.457) -- 0:00:52
161000 -- (-1183.538) (-1184.620) (-1184.172) [-1181.566] * [-1181.003] (-1191.107) (-1185.652) (-1182.191) -- 0:00:52
161500 -- (-1181.961) (-1181.650) (-1181.740) [-1181.523] * (-1185.240) [-1183.301] (-1186.015) (-1182.453) -- 0:00:51
162000 -- (-1181.436) (-1181.544) (-1184.100) [-1181.785] * (-1180.994) [-1183.006] (-1181.665) (-1185.685) -- 0:00:51
162500 -- (-1181.276) [-1182.156] (-1184.667) (-1181.579) * (-1180.813) (-1183.388) [-1181.107] (-1182.937) -- 0:00:51
163000 -- (-1181.452) [-1182.156] (-1185.683) (-1181.521) * [-1182.331] (-1184.415) (-1182.371) (-1183.641) -- 0:00:51
163500 -- [-1186.815] (-1183.241) (-1182.897) (-1181.536) * (-1180.857) [-1185.043] (-1184.271) (-1182.543) -- 0:00:51
164000 -- (-1188.009) (-1182.270) (-1183.844) [-1183.809] * (-1181.940) [-1184.524] (-1189.618) (-1182.426) -- 0:00:50
164500 -- (-1183.684) (-1181.537) [-1181.309] (-1183.636) * (-1183.284) (-1189.454) (-1182.602) [-1183.853] -- 0:00:50
165000 -- [-1183.767] (-1183.174) (-1181.281) (-1183.571) * (-1181.246) [-1180.643] (-1182.468) (-1181.825) -- 0:00:50
Average standard deviation of split frequencies: 0.012937
165500 -- [-1181.862] (-1183.203) (-1184.718) (-1184.857) * (-1182.004) (-1181.656) [-1182.408] (-1181.534) -- 0:00:50
166000 -- (-1181.865) (-1183.628) (-1183.164) [-1183.699] * (-1184.154) (-1180.782) [-1180.960] (-1183.575) -- 0:00:50
166500 -- [-1180.793] (-1183.918) (-1183.407) (-1182.124) * (-1181.843) (-1181.697) (-1181.209) [-1184.225] -- 0:00:50
167000 -- [-1180.832] (-1183.432) (-1186.120) (-1181.642) * (-1181.434) (-1183.259) (-1181.124) [-1185.347] -- 0:00:49
167500 -- (-1184.134) [-1181.365] (-1184.660) (-1187.300) * (-1183.720) (-1183.307) [-1182.085] (-1182.385) -- 0:00:54
168000 -- (-1182.600) [-1183.248] (-1184.368) (-1182.928) * (-1185.832) (-1181.961) [-1180.899] (-1182.235) -- 0:00:54
168500 -- (-1186.145) (-1183.711) [-1183.551] (-1183.040) * (-1185.677) (-1181.191) [-1180.974] (-1181.953) -- 0:00:54
169000 -- (-1183.074) (-1183.559) (-1182.387) [-1183.640] * (-1185.302) (-1182.016) (-1181.199) [-1182.480] -- 0:00:54
169500 -- (-1183.011) (-1182.915) [-1181.499] (-1181.836) * (-1181.845) [-1181.106] (-1181.329) (-1181.487) -- 0:00:53
170000 -- [-1183.880] (-1184.241) (-1181.349) (-1187.163) * (-1181.799) [-1181.567] (-1181.552) (-1181.760) -- 0:00:53
Average standard deviation of split frequencies: 0.013323
170500 -- (-1182.205) (-1189.346) (-1180.529) [-1183.573] * (-1181.618) (-1181.288) (-1181.698) [-1182.064] -- 0:00:53
171000 -- (-1182.538) (-1186.358) [-1181.003] (-1186.018) * (-1181.881) (-1182.702) (-1182.015) [-1180.975] -- 0:00:53
171500 -- (-1182.917) [-1183.218] (-1181.572) (-1183.399) * [-1181.899] (-1182.117) (-1182.105) (-1182.248) -- 0:00:53
172000 -- (-1181.514) (-1183.021) [-1186.387] (-1183.749) * (-1183.054) (-1182.557) [-1182.029] (-1183.928) -- 0:00:52
172500 -- (-1182.618) (-1180.470) (-1182.218) [-1181.964] * [-1183.321] (-1185.860) (-1185.257) (-1180.886) -- 0:00:52
173000 -- (-1183.223) [-1180.845] (-1185.412) (-1182.640) * [-1181.535] (-1183.162) (-1182.630) (-1183.644) -- 0:00:52
173500 -- (-1183.141) [-1180.890] (-1183.302) (-1183.404) * [-1184.094] (-1182.371) (-1184.600) (-1184.939) -- 0:00:52
174000 -- [-1182.064] (-1180.834) (-1191.302) (-1183.261) * [-1184.549] (-1181.201) (-1181.343) (-1183.930) -- 0:00:52
174500 -- [-1181.926] (-1181.441) (-1183.948) (-1182.937) * (-1183.912) [-1180.917] (-1181.803) (-1181.071) -- 0:00:52
175000 -- (-1182.565) [-1180.470] (-1183.656) (-1181.726) * (-1186.492) (-1181.308) [-1182.306] (-1183.880) -- 0:00:51
Average standard deviation of split frequencies: 0.014583
175500 -- (-1181.982) [-1182.494] (-1184.500) (-1182.634) * [-1182.476] (-1181.131) (-1182.219) (-1184.775) -- 0:00:51
176000 -- (-1183.043) [-1182.185] (-1185.606) (-1182.527) * (-1183.745) (-1180.975) (-1183.388) [-1181.926] -- 0:00:51
176500 -- [-1183.256] (-1181.031) (-1183.363) (-1181.911) * (-1181.429) [-1183.366] (-1182.085) (-1181.148) -- 0:00:51
177000 -- (-1181.985) (-1184.495) [-1183.147] (-1181.663) * (-1181.296) (-1188.006) [-1182.122] (-1181.207) -- 0:00:51
177500 -- (-1182.464) (-1184.082) (-1183.751) [-1183.255] * (-1182.176) (-1184.165) [-1183.703] (-1191.265) -- 0:00:50
178000 -- (-1182.471) (-1186.104) (-1181.223) [-1180.986] * (-1182.701) [-1181.272] (-1181.154) (-1185.691) -- 0:00:50
178500 -- (-1182.317) [-1182.613] (-1184.091) (-1182.386) * (-1184.871) (-1181.982) [-1181.550] (-1185.425) -- 0:00:50
179000 -- (-1182.559) (-1182.958) [-1180.829] (-1181.375) * (-1181.496) (-1182.399) [-1181.418] (-1184.236) -- 0:00:50
179500 -- (-1184.844) (-1183.584) (-1182.307) [-1181.738] * (-1183.038) (-1182.670) (-1180.841) [-1181.345] -- 0:00:50
180000 -- (-1190.408) [-1181.547] (-1183.719) (-1183.453) * (-1183.485) (-1182.596) (-1187.330) [-1181.179] -- 0:00:50
Average standard deviation of split frequencies: 0.015076
180500 -- (-1182.684) [-1181.072] (-1182.290) (-1183.756) * (-1181.179) [-1187.363] (-1189.139) (-1181.841) -- 0:00:49
181000 -- (-1181.020) [-1181.483] (-1185.895) (-1184.722) * (-1184.274) (-1183.888) [-1182.500] (-1186.128) -- 0:00:49
181500 -- (-1181.987) (-1183.435) [-1185.305] (-1184.660) * (-1190.452) (-1182.876) [-1181.030] (-1183.836) -- 0:00:49
182000 -- (-1181.751) (-1181.123) [-1184.126] (-1183.088) * (-1184.440) (-1185.260) (-1181.201) [-1183.511] -- 0:00:49
182500 -- (-1181.691) [-1182.975] (-1181.738) (-1182.880) * (-1182.768) [-1183.523] (-1181.630) (-1185.054) -- 0:00:49
183000 -- (-1181.345) (-1180.908) [-1183.264] (-1182.969) * (-1182.321) (-1182.647) [-1181.558] (-1185.437) -- 0:00:49
183500 -- (-1181.213) [-1183.861] (-1184.120) (-1181.896) * (-1181.225) (-1182.646) [-1181.984] (-1185.095) -- 0:00:48
184000 -- [-1184.055] (-1185.333) (-1186.882) (-1183.926) * [-1182.237] (-1191.820) (-1181.888) (-1184.450) -- 0:00:53
184500 -- (-1185.062) (-1184.037) [-1184.583] (-1188.091) * (-1181.447) (-1184.123) [-1181.075] (-1186.012) -- 0:00:53
185000 -- [-1183.318] (-1182.840) (-1186.359) (-1183.217) * (-1182.001) (-1182.726) [-1181.730] (-1188.070) -- 0:00:52
Average standard deviation of split frequencies: 0.017074
185500 -- (-1184.522) [-1182.843] (-1182.999) (-1184.365) * [-1182.652] (-1182.050) (-1180.968) (-1184.486) -- 0:00:52
186000 -- [-1181.966] (-1181.918) (-1189.829) (-1183.149) * [-1182.291] (-1183.614) (-1182.029) (-1184.099) -- 0:00:52
186500 -- [-1181.422] (-1184.644) (-1186.881) (-1181.156) * (-1181.468) [-1181.353] (-1183.983) (-1182.145) -- 0:00:52
187000 -- [-1180.815] (-1184.580) (-1184.956) (-1181.093) * (-1184.656) [-1181.722] (-1183.280) (-1182.713) -- 0:00:52
187500 -- [-1183.923] (-1184.204) (-1183.673) (-1183.128) * [-1183.377] (-1186.560) (-1185.159) (-1182.788) -- 0:00:52
188000 -- [-1182.447] (-1184.539) (-1187.635) (-1182.917) * [-1182.435] (-1184.233) (-1183.885) (-1180.621) -- 0:00:51
188500 -- (-1180.868) (-1184.152) [-1184.805] (-1181.238) * (-1183.012) (-1184.851) [-1183.482] (-1182.879) -- 0:00:51
189000 -- [-1180.891] (-1185.666) (-1185.750) (-1181.777) * [-1185.000] (-1182.714) (-1185.554) (-1183.086) -- 0:00:51
189500 -- (-1180.896) [-1181.566] (-1186.342) (-1181.508) * (-1186.673) [-1185.114] (-1188.442) (-1184.033) -- 0:00:51
190000 -- (-1181.070) [-1183.807] (-1183.100) (-1182.220) * (-1186.781) (-1182.848) [-1186.399] (-1182.214) -- 0:00:51
Average standard deviation of split frequencies: 0.015796
190500 -- [-1181.846] (-1182.660) (-1183.198) (-1182.494) * [-1183.120] (-1181.825) (-1182.242) (-1181.701) -- 0:00:50
191000 -- (-1192.024) (-1182.450) (-1186.163) [-1182.458] * (-1183.011) [-1182.623] (-1184.809) (-1183.654) -- 0:00:50
191500 -- (-1182.228) [-1181.599] (-1183.601) (-1183.426) * (-1181.522) [-1181.718] (-1180.667) (-1183.785) -- 0:00:50
192000 -- (-1184.416) (-1182.380) (-1183.245) [-1181.402] * (-1181.827) (-1183.083) [-1181.742] (-1181.616) -- 0:00:50
192500 -- (-1184.420) [-1183.047] (-1182.789) (-1181.742) * (-1183.730) [-1180.729] (-1184.331) (-1180.976) -- 0:00:50
193000 -- (-1182.895) [-1186.287] (-1185.197) (-1181.382) * (-1187.957) (-1180.596) [-1181.005] (-1181.409) -- 0:00:50
193500 -- (-1183.448) [-1182.563] (-1182.894) (-1182.165) * (-1185.874) (-1181.196) [-1181.161] (-1182.566) -- 0:00:50
194000 -- (-1185.306) [-1182.659] (-1182.496) (-1182.653) * (-1185.918) (-1183.164) (-1180.952) [-1182.208] -- 0:00:49
194500 -- (-1181.382) (-1182.108) (-1181.013) [-1183.064] * (-1186.597) (-1184.193) [-1180.899] (-1180.942) -- 0:00:49
195000 -- (-1181.539) (-1182.632) (-1181.959) [-1184.775] * (-1180.976) [-1183.088] (-1183.477) (-1180.944) -- 0:00:49
Average standard deviation of split frequencies: 0.017595
195500 -- [-1184.197] (-1182.288) (-1183.208) (-1184.410) * [-1180.842] (-1187.188) (-1186.230) (-1181.794) -- 0:00:49
196000 -- (-1184.163) [-1182.503] (-1183.511) (-1183.512) * (-1183.612) (-1192.886) (-1181.409) [-1183.214] -- 0:00:49
196500 -- (-1181.420) [-1181.242] (-1187.660) (-1183.546) * [-1182.873] (-1181.329) (-1186.263) (-1182.130) -- 0:00:49
197000 -- (-1182.704) [-1181.900] (-1182.628) (-1184.724) * (-1185.806) (-1180.512) [-1184.046] (-1181.024) -- 0:00:48
197500 -- [-1183.312] (-1182.018) (-1182.041) (-1184.942) * (-1182.512) (-1181.394) [-1185.030] (-1181.552) -- 0:00:48
198000 -- (-1182.777) [-1180.573] (-1182.521) (-1186.597) * [-1182.332] (-1181.393) (-1181.923) (-1181.435) -- 0:00:48
198500 -- (-1182.412) [-1180.704] (-1181.268) (-1181.583) * (-1181.435) [-1181.928] (-1181.186) (-1182.929) -- 0:00:48
199000 -- (-1183.606) (-1182.527) [-1181.898] (-1181.556) * (-1184.834) (-1180.969) [-1180.978] (-1183.045) -- 0:00:48
199500 -- (-1181.837) (-1183.833) (-1181.897) [-1182.998] * (-1183.635) (-1181.591) [-1183.637] (-1183.230) -- 0:00:48
200000 -- (-1183.320) (-1184.821) [-1184.680] (-1181.546) * (-1183.929) [-1181.381] (-1181.860) (-1182.702) -- 0:00:51
Average standard deviation of split frequencies: 0.017749
200500 -- (-1182.112) (-1182.817) (-1183.875) [-1183.275] * (-1181.231) (-1180.916) [-1183.112] (-1187.494) -- 0:00:51
201000 -- (-1183.378) (-1181.655) (-1185.329) [-1181.188] * (-1181.314) (-1183.604) [-1184.421] (-1183.194) -- 0:00:51
201500 -- (-1182.521) (-1186.068) (-1184.495) [-1181.396] * (-1188.934) (-1185.688) (-1181.529) [-1182.018] -- 0:00:51
202000 -- [-1181.062] (-1181.539) (-1184.131) (-1181.594) * (-1187.171) (-1185.038) [-1182.877] (-1182.016) -- 0:00:51
202500 -- [-1181.046] (-1181.390) (-1183.896) (-1181.599) * (-1184.639) (-1188.285) [-1180.567] (-1182.839) -- 0:00:51
203000 -- (-1182.920) (-1181.461) [-1181.595] (-1181.473) * (-1183.876) (-1186.306) [-1180.567] (-1185.457) -- 0:00:51
203500 -- [-1181.900] (-1182.240) (-1183.013) (-1185.028) * (-1185.485) (-1183.002) [-1181.987] (-1184.212) -- 0:00:50
204000 -- [-1182.822] (-1181.359) (-1181.123) (-1185.198) * (-1183.536) [-1181.825] (-1183.119) (-1180.550) -- 0:00:50
204500 -- (-1182.379) [-1186.436] (-1182.646) (-1186.245) * (-1183.536) (-1182.043) (-1183.479) [-1182.502] -- 0:00:50
205000 -- (-1181.551) (-1182.349) (-1181.971) [-1181.352] * [-1183.440] (-1183.080) (-1181.629) (-1185.414) -- 0:00:50
Average standard deviation of split frequencies: 0.017825
205500 -- [-1181.551] (-1182.277) (-1181.474) (-1182.389) * (-1183.596) (-1181.426) (-1183.785) [-1185.365] -- 0:00:50
206000 -- (-1182.526) [-1186.651] (-1182.152) (-1182.695) * (-1182.980) [-1180.991] (-1183.805) (-1184.682) -- 0:00:50
206500 -- (-1183.066) [-1184.897] (-1181.743) (-1181.434) * (-1183.651) [-1182.606] (-1185.913) (-1188.819) -- 0:00:49
207000 -- [-1183.025] (-1186.544) (-1181.938) (-1189.583) * (-1183.173) (-1182.477) [-1182.540] (-1181.354) -- 0:00:49
207500 -- (-1183.190) (-1188.939) (-1184.403) [-1183.233] * (-1186.048) (-1182.470) (-1186.311) [-1181.029] -- 0:00:49
208000 -- [-1181.995] (-1187.161) (-1183.831) (-1188.644) * (-1180.364) (-1183.265) (-1184.388) [-1185.457] -- 0:00:49
208500 -- [-1182.616] (-1182.321) (-1185.163) (-1182.632) * (-1184.018) [-1182.662] (-1184.260) (-1184.616) -- 0:00:49
209000 -- (-1181.271) [-1184.845] (-1184.207) (-1182.985) * (-1182.773) (-1185.198) (-1184.225) [-1183.173] -- 0:00:49
209500 -- (-1181.009) [-1182.016] (-1183.788) (-1183.019) * (-1181.308) [-1180.919] (-1183.807) (-1181.961) -- 0:00:49
210000 -- [-1181.007] (-1187.096) (-1184.788) (-1181.840) * (-1184.001) (-1184.845) (-1181.603) [-1181.699] -- 0:00:48
Average standard deviation of split frequencies: 0.018150
210500 -- (-1188.653) [-1185.265] (-1183.404) (-1183.050) * (-1182.835) [-1189.395] (-1181.812) (-1183.294) -- 0:00:48
211000 -- (-1182.767) [-1184.030] (-1183.403) (-1182.400) * (-1181.697) (-1181.631) (-1183.318) [-1181.759] -- 0:00:48
211500 -- (-1182.618) (-1182.134) [-1184.089] (-1182.827) * (-1182.618) (-1191.104) (-1182.351) [-1181.878] -- 0:00:48
212000 -- (-1185.358) [-1182.018] (-1182.737) (-1183.553) * [-1182.396] (-1182.208) (-1182.773) (-1183.127) -- 0:00:48
212500 -- (-1185.316) (-1183.391) (-1181.560) [-1182.833] * [-1181.556] (-1181.337) (-1182.659) (-1182.513) -- 0:00:48
213000 -- [-1183.018] (-1187.074) (-1181.034) (-1182.711) * (-1182.661) (-1181.717) [-1182.924] (-1182.322) -- 0:00:48
213500 -- (-1182.538) (-1187.337) [-1181.330] (-1188.075) * [-1183.725] (-1180.743) (-1182.670) (-1183.515) -- 0:00:47
214000 -- (-1181.732) (-1191.687) [-1182.423] (-1182.843) * [-1181.517] (-1189.912) (-1181.178) (-1186.966) -- 0:00:47
214500 -- [-1181.732] (-1182.633) (-1183.634) (-1183.157) * (-1182.439) [-1182.948] (-1182.525) (-1186.745) -- 0:00:47
215000 -- (-1181.187) [-1181.755] (-1186.185) (-1181.449) * (-1181.271) [-1181.146] (-1185.268) (-1184.650) -- 0:00:47
Average standard deviation of split frequencies: 0.019036
215500 -- (-1181.067) (-1184.595) (-1186.354) [-1183.188] * (-1182.685) (-1182.178) (-1185.466) [-1182.943] -- 0:00:50
216000 -- (-1180.819) (-1183.459) [-1182.244] (-1181.552) * (-1185.486) (-1185.341) (-1185.817) [-1186.195] -- 0:00:50
216500 -- (-1180.945) (-1190.750) (-1182.021) [-1181.986] * [-1184.301] (-1186.099) (-1187.774) (-1183.266) -- 0:00:50
217000 -- (-1182.706) (-1185.429) (-1182.921) [-1181.435] * (-1182.026) [-1183.553] (-1186.071) (-1182.415) -- 0:00:50
217500 -- [-1184.209] (-1181.470) (-1183.577) (-1183.218) * (-1181.688) (-1182.424) [-1183.795] (-1181.705) -- 0:00:50
218000 -- (-1190.201) [-1184.742] (-1180.809) (-1181.034) * (-1181.715) [-1183.947] (-1181.833) (-1182.532) -- 0:00:50
218500 -- (-1185.343) [-1184.448] (-1181.278) (-1185.266) * (-1181.092) [-1186.609] (-1183.193) (-1183.635) -- 0:00:50
219000 -- [-1182.709] (-1182.713) (-1185.113) (-1184.962) * (-1181.755) (-1184.690) [-1181.905] (-1181.879) -- 0:00:49
219500 -- (-1185.926) (-1181.009) (-1183.688) [-1182.657] * (-1182.472) [-1186.300] (-1183.350) (-1186.869) -- 0:00:49
220000 -- (-1188.502) [-1182.083] (-1182.363) (-1181.744) * (-1181.875) (-1183.462) [-1182.375] (-1185.274) -- 0:00:49
Average standard deviation of split frequencies: 0.019820
220500 -- (-1181.452) (-1182.260) (-1181.897) [-1181.224] * (-1182.205) [-1181.201] (-1183.404) (-1185.663) -- 0:00:49
221000 -- (-1181.145) (-1183.197) [-1184.689] (-1184.211) * (-1181.336) (-1182.002) (-1182.054) [-1185.220] -- 0:00:49
221500 -- (-1184.086) [-1183.061] (-1182.900) (-1181.953) * (-1182.540) [-1182.009] (-1184.427) (-1183.751) -- 0:00:49
222000 -- (-1191.401) [-1182.235] (-1182.545) (-1184.137) * (-1182.185) (-1184.730) [-1186.054] (-1182.479) -- 0:00:49
222500 -- [-1182.663] (-1182.740) (-1182.151) (-1186.049) * (-1184.402) [-1181.920] (-1183.964) (-1181.609) -- 0:00:48
223000 -- (-1182.680) [-1183.383] (-1181.876) (-1186.626) * (-1181.118) (-1181.554) [-1181.738] (-1183.602) -- 0:00:48
223500 -- (-1185.096) (-1186.310) [-1182.220] (-1182.676) * (-1181.321) [-1181.783] (-1181.966) (-1183.009) -- 0:00:48
224000 -- (-1180.804) (-1185.198) (-1181.464) [-1182.411] * (-1184.295) (-1183.249) [-1184.162] (-1181.764) -- 0:00:48
224500 -- (-1182.685) (-1181.118) [-1182.582] (-1182.233) * (-1183.540) (-1181.573) [-1183.889] (-1183.903) -- 0:00:48
225000 -- [-1186.847] (-1181.446) (-1181.322) (-1181.115) * [-1182.576] (-1181.472) (-1188.201) (-1182.611) -- 0:00:48
Average standard deviation of split frequencies: 0.019236
225500 -- (-1183.769) (-1181.972) (-1183.470) [-1181.075] * (-1182.609) [-1181.797] (-1184.260) (-1183.727) -- 0:00:48
226000 -- (-1183.284) [-1181.661] (-1181.906) (-1181.958) * [-1182.616] (-1181.570) (-1181.403) (-1180.802) -- 0:00:47
226500 -- (-1185.275) (-1185.187) [-1181.589] (-1183.259) * (-1181.814) (-1182.642) [-1180.842] (-1181.374) -- 0:00:47
227000 -- (-1183.645) [-1182.093] (-1184.185) (-1184.163) * [-1181.390] (-1183.126) (-1184.428) (-1181.433) -- 0:00:47
227500 -- (-1181.554) [-1182.078] (-1186.367) (-1183.236) * [-1183.261] (-1181.147) (-1184.730) (-1181.886) -- 0:00:47
228000 -- (-1183.935) [-1185.322] (-1185.899) (-1181.620) * [-1187.924] (-1181.425) (-1182.906) (-1184.525) -- 0:00:47
228500 -- (-1182.191) (-1185.687) [-1183.903] (-1184.159) * (-1182.536) (-1181.637) (-1184.317) [-1183.990] -- 0:00:47
229000 -- [-1182.382] (-1181.573) (-1182.286) (-1184.149) * (-1183.346) (-1181.237) [-1183.746] (-1183.971) -- 0:00:47
229500 -- (-1180.852) (-1184.046) [-1185.346] (-1185.455) * (-1181.878) [-1181.579] (-1185.178) (-1182.530) -- 0:00:47
230000 -- (-1181.002) [-1182.100] (-1182.253) (-1188.627) * (-1181.843) [-1181.880] (-1180.759) (-1183.570) -- 0:00:46
Average standard deviation of split frequencies: 0.019253
230500 -- (-1181.453) (-1184.304) [-1181.063] (-1185.142) * (-1184.369) (-1182.404) [-1180.969] (-1183.520) -- 0:00:46
231000 -- (-1182.733) (-1183.723) [-1183.756] (-1185.074) * [-1188.407] (-1185.317) (-1183.713) (-1184.121) -- 0:00:46
231500 -- (-1185.017) [-1184.001] (-1181.720) (-1181.406) * (-1182.844) (-1185.640) (-1186.532) [-1184.418] -- 0:00:46
232000 -- (-1185.356) [-1184.602] (-1181.345) (-1182.320) * [-1181.664] (-1185.072) (-1184.659) (-1184.051) -- 0:00:49
232500 -- (-1183.775) (-1182.764) (-1183.383) [-1184.958] * (-1181.975) [-1185.431] (-1182.632) (-1183.353) -- 0:00:49
233000 -- (-1182.445) (-1182.478) [-1181.314] (-1183.270) * (-1186.306) (-1182.658) (-1181.176) [-1182.052] -- 0:00:49
233500 -- (-1182.225) (-1182.348) [-1181.051] (-1181.611) * (-1183.502) (-1180.985) [-1180.328] (-1182.441) -- 0:00:49
234000 -- [-1184.899] (-1181.110) (-1182.167) (-1184.221) * (-1183.403) [-1181.030] (-1182.583) (-1182.246) -- 0:00:49
234500 -- (-1181.062) (-1185.550) [-1181.008] (-1184.992) * (-1183.406) (-1183.605) (-1182.221) [-1181.147] -- 0:00:48
235000 -- (-1184.211) [-1181.748] (-1181.067) (-1185.047) * (-1181.944) [-1182.434] (-1180.633) (-1181.053) -- 0:00:48
Average standard deviation of split frequencies: 0.018713
235500 -- (-1180.980) [-1182.008] (-1181.186) (-1182.073) * [-1181.690] (-1182.788) (-1181.129) (-1183.806) -- 0:00:48
236000 -- (-1185.832) (-1182.357) [-1182.078] (-1182.715) * (-1181.441) (-1185.705) [-1181.273] (-1184.080) -- 0:00:48
236500 -- (-1181.959) (-1184.515) [-1181.581] (-1183.606) * [-1182.580] (-1185.400) (-1181.273) (-1182.823) -- 0:00:48
237000 -- (-1182.243) (-1182.404) [-1180.924] (-1185.396) * [-1184.926] (-1183.830) (-1183.956) (-1186.214) -- 0:00:48
237500 -- (-1182.628) (-1181.404) (-1180.941) [-1181.122] * (-1181.154) [-1182.302] (-1183.065) (-1182.853) -- 0:00:48
238000 -- (-1182.453) (-1183.078) [-1183.143] (-1181.888) * (-1184.549) [-1181.343] (-1181.241) (-1186.841) -- 0:00:48
238500 -- [-1183.147] (-1187.273) (-1182.896) (-1181.505) * (-1187.843) (-1181.324) (-1180.816) [-1183.031] -- 0:00:47
239000 -- [-1182.630] (-1184.041) (-1180.799) (-1183.962) * (-1182.963) [-1181.168] (-1181.834) (-1182.629) -- 0:00:47
239500 -- [-1180.921] (-1183.238) (-1181.135) (-1181.967) * (-1183.617) [-1181.912] (-1185.340) (-1183.347) -- 0:00:47
240000 -- [-1180.772] (-1182.944) (-1181.622) (-1181.994) * [-1182.666] (-1181.801) (-1183.017) (-1181.839) -- 0:00:47
Average standard deviation of split frequencies: 0.018144
240500 -- (-1181.469) [-1185.752] (-1182.345) (-1182.858) * (-1185.272) (-1185.231) [-1181.965] (-1184.255) -- 0:00:47
241000 -- (-1180.913) [-1184.368] (-1182.267) (-1181.341) * (-1184.249) (-1181.272) [-1183.094] (-1182.239) -- 0:00:47
241500 -- (-1183.155) (-1181.290) [-1181.678] (-1182.502) * [-1185.108] (-1186.231) (-1183.556) (-1181.313) -- 0:00:47
242000 -- [-1181.835] (-1183.784) (-1186.234) (-1181.501) * [-1184.773] (-1185.407) (-1183.954) (-1182.096) -- 0:00:46
242500 -- [-1183.412] (-1184.114) (-1186.327) (-1183.946) * (-1184.353) [-1183.370] (-1185.883) (-1182.008) -- 0:00:46
243000 -- (-1182.846) (-1183.121) (-1182.232) [-1183.962] * (-1187.108) [-1185.301] (-1186.838) (-1183.522) -- 0:00:46
243500 -- (-1182.053) (-1183.597) (-1181.995) [-1184.025] * (-1183.142) [-1188.709] (-1184.629) (-1187.724) -- 0:00:46
244000 -- (-1181.538) [-1184.693] (-1182.384) (-1186.237) * (-1184.051) (-1186.898) [-1182.168] (-1183.836) -- 0:00:46
244500 -- [-1180.578] (-1185.378) (-1182.226) (-1183.958) * (-1185.122) (-1180.687) [-1182.439] (-1182.607) -- 0:00:46
245000 -- (-1182.547) [-1184.439] (-1182.047) (-1184.758) * (-1182.718) (-1180.865) (-1181.930) [-1181.751] -- 0:00:46
Average standard deviation of split frequencies: 0.018659
245500 -- (-1183.837) [-1183.332] (-1183.040) (-1184.603) * (-1183.545) [-1181.902] (-1182.207) (-1188.233) -- 0:00:46
246000 -- (-1182.946) [-1183.064] (-1183.787) (-1185.132) * (-1185.162) (-1182.112) [-1182.579] (-1184.577) -- 0:00:45
246500 -- (-1184.476) [-1180.684] (-1181.806) (-1181.795) * (-1187.311) [-1182.047] (-1183.191) (-1184.819) -- 0:00:45
247000 -- (-1180.652) (-1184.623) (-1182.863) [-1180.851] * (-1186.077) (-1180.529) (-1183.151) [-1183.111] -- 0:00:45
247500 -- (-1180.911) [-1182.754] (-1181.645) (-1183.591) * (-1183.728) (-1182.986) (-1184.590) [-1184.552] -- 0:00:45
248000 -- (-1182.504) (-1182.741) [-1184.179] (-1183.610) * (-1180.904) [-1184.187] (-1182.422) (-1183.623) -- 0:00:48
248500 -- (-1183.135) (-1181.630) [-1181.879] (-1183.674) * (-1180.829) (-1181.687) [-1185.859] (-1182.990) -- 0:00:48
249000 -- [-1181.356] (-1182.453) (-1184.946) (-1183.303) * (-1182.728) (-1182.137) [-1186.850] (-1186.796) -- 0:00:48
249500 -- (-1183.265) (-1183.971) [-1185.226] (-1183.012) * (-1183.954) [-1181.519] (-1182.541) (-1182.601) -- 0:00:48
250000 -- (-1182.454) (-1180.540) [-1180.870] (-1181.066) * (-1186.684) (-1182.513) [-1182.170] (-1181.583) -- 0:00:48
Average standard deviation of split frequencies: 0.018806
250500 -- (-1182.121) (-1180.681) [-1180.977] (-1181.654) * [-1182.613] (-1182.290) (-1181.559) (-1182.269) -- 0:00:47
251000 -- (-1182.703) (-1184.068) (-1182.730) [-1189.997] * [-1183.973] (-1181.243) (-1181.522) (-1183.965) -- 0:00:47
251500 -- (-1182.868) (-1184.462) [-1184.415] (-1183.343) * (-1184.287) (-1180.929) [-1183.388] (-1180.526) -- 0:00:47
252000 -- (-1184.814) (-1184.222) [-1183.152] (-1184.443) * (-1180.695) [-1181.347] (-1180.978) (-1180.526) -- 0:00:47
252500 -- (-1182.032) [-1186.909] (-1181.618) (-1184.885) * (-1182.311) [-1181.801] (-1183.101) (-1182.425) -- 0:00:47
253000 -- (-1181.679) (-1182.922) [-1182.120] (-1181.870) * (-1185.356) (-1180.923) [-1182.452] (-1181.536) -- 0:00:47
253500 -- (-1184.167) [-1189.919] (-1182.396) (-1182.032) * (-1182.972) (-1181.211) [-1182.650] (-1181.915) -- 0:00:47
254000 -- [-1181.564] (-1181.923) (-1184.891) (-1183.423) * (-1183.401) (-1183.561) (-1181.466) [-1181.186] -- 0:00:46
254500 -- [-1182.561] (-1180.894) (-1182.312) (-1182.039) * (-1182.327) [-1183.455] (-1185.688) (-1182.191) -- 0:00:46
255000 -- (-1180.898) [-1183.010] (-1184.372) (-1182.596) * (-1181.800) (-1183.260) (-1182.367) [-1182.781] -- 0:00:46
Average standard deviation of split frequencies: 0.020051
255500 -- (-1181.271) [-1183.070] (-1183.561) (-1181.484) * (-1181.820) (-1188.924) (-1182.969) [-1186.093] -- 0:00:46
256000 -- [-1181.062] (-1181.446) (-1183.591) (-1182.450) * [-1183.047] (-1188.863) (-1181.568) (-1185.747) -- 0:00:46
256500 -- (-1181.469) (-1182.226) (-1185.107) [-1185.626] * [-1181.743] (-1190.193) (-1181.116) (-1186.178) -- 0:00:46
257000 -- [-1184.527] (-1181.410) (-1181.489) (-1183.956) * (-1181.674) (-1185.528) [-1181.787] (-1187.701) -- 0:00:46
257500 -- (-1184.087) (-1183.777) [-1182.882] (-1181.455) * (-1184.005) [-1183.608] (-1182.295) (-1183.106) -- 0:00:46
258000 -- [-1187.423] (-1182.891) (-1183.655) (-1184.131) * (-1184.910) [-1182.529] (-1181.139) (-1182.006) -- 0:00:46
258500 -- (-1183.205) (-1183.924) (-1182.669) [-1182.531] * [-1183.471] (-1181.796) (-1182.115) (-1182.011) -- 0:00:45
259000 -- (-1185.350) (-1184.071) (-1186.295) [-1182.061] * (-1181.126) [-1181.775] (-1184.067) (-1182.765) -- 0:00:45
259500 -- (-1183.672) (-1182.706) (-1182.102) [-1181.592] * (-1181.841) (-1181.087) (-1182.237) [-1181.947] -- 0:00:45
260000 -- (-1180.406) (-1181.245) [-1182.478] (-1180.755) * (-1187.820) (-1183.996) [-1182.450] (-1181.100) -- 0:00:45
Average standard deviation of split frequencies: 0.019993
260500 -- (-1182.686) [-1181.842] (-1186.566) (-1181.502) * [-1182.995] (-1182.247) (-1181.793) (-1181.740) -- 0:00:45
261000 -- (-1181.099) (-1186.915) (-1180.973) [-1183.054] * (-1183.241) [-1181.917] (-1183.737) (-1181.419) -- 0:00:45
261500 -- [-1184.270] (-1183.136) (-1182.744) (-1181.976) * (-1181.749) (-1186.394) (-1186.989) [-1181.886] -- 0:00:45
262000 -- (-1182.279) (-1187.355) (-1182.141) [-1180.782] * (-1182.039) (-1184.687) (-1181.336) [-1180.766] -- 0:00:45
262500 -- [-1181.298] (-1184.441) (-1183.302) (-1184.193) * [-1181.990] (-1182.756) (-1183.978) (-1180.766) -- 0:00:44
263000 -- (-1181.256) [-1182.277] (-1181.605) (-1182.543) * (-1181.148) (-1182.157) [-1183.608] (-1181.332) -- 0:00:44
263500 -- [-1181.281] (-1181.982) (-1182.868) (-1182.403) * (-1180.449) (-1182.353) (-1183.276) [-1182.179] -- 0:00:44
264000 -- (-1181.349) (-1181.912) (-1182.450) [-1180.920] * (-1182.326) (-1181.255) [-1183.660] (-1187.321) -- 0:00:44
264500 -- (-1185.133) [-1182.318] (-1182.095) (-1181.308) * (-1182.082) (-1181.977) (-1182.491) [-1182.253] -- 0:00:47
265000 -- (-1182.624) (-1181.268) (-1181.676) [-1183.959] * [-1183.351] (-1183.119) (-1185.051) (-1183.296) -- 0:00:47
Average standard deviation of split frequencies: 0.019986
265500 -- (-1182.452) (-1181.636) (-1182.643) [-1182.426] * (-1185.057) (-1182.281) [-1182.095] (-1183.181) -- 0:00:47
266000 -- (-1181.336) [-1182.270] (-1182.460) (-1183.490) * [-1183.815] (-1183.398) (-1182.356) (-1184.962) -- 0:00:46
266500 -- [-1180.525] (-1184.351) (-1182.516) (-1182.543) * [-1182.050] (-1180.699) (-1183.606) (-1183.726) -- 0:00:46
267000 -- [-1181.168] (-1183.653) (-1182.124) (-1182.373) * [-1183.833] (-1183.893) (-1183.056) (-1182.723) -- 0:00:46
267500 -- (-1181.654) (-1183.499) [-1182.228] (-1181.676) * (-1183.225) (-1185.045) [-1180.801] (-1181.189) -- 0:00:46
268000 -- (-1181.531) (-1185.447) (-1182.525) [-1181.038] * (-1182.112) [-1181.505] (-1180.567) (-1183.667) -- 0:00:46
268500 -- (-1181.907) (-1184.048) (-1183.381) [-1183.089] * (-1183.689) [-1181.113] (-1183.069) (-1183.167) -- 0:00:46
269000 -- (-1183.523) (-1182.253) [-1182.512] (-1190.584) * [-1181.669] (-1180.356) (-1182.640) (-1181.570) -- 0:00:46
269500 -- (-1182.231) (-1181.044) [-1182.374] (-1186.762) * (-1181.798) (-1180.359) (-1181.148) [-1181.461] -- 0:00:46
270000 -- (-1183.190) [-1181.058] (-1183.521) (-1181.423) * [-1181.235] (-1181.676) (-1181.142) (-1183.548) -- 0:00:45
Average standard deviation of split frequencies: 0.020900
270500 -- (-1182.705) [-1183.066] (-1181.828) (-1187.334) * (-1181.328) (-1181.669) [-1182.173] (-1180.490) -- 0:00:45
271000 -- (-1181.154) [-1182.966] (-1181.324) (-1180.958) * (-1182.758) [-1182.672] (-1182.656) (-1184.226) -- 0:00:45
271500 -- (-1181.940) [-1183.901] (-1187.297) (-1183.452) * (-1183.499) (-1183.003) (-1182.409) [-1181.852] -- 0:00:45
272000 -- (-1181.059) [-1181.853] (-1188.439) (-1180.469) * [-1181.984] (-1182.603) (-1181.528) (-1181.164) -- 0:00:45
272500 -- (-1182.539) [-1181.428] (-1184.651) (-1180.851) * (-1181.743) (-1181.375) [-1181.041] (-1185.256) -- 0:00:45
273000 -- (-1181.851) (-1181.584) (-1182.603) [-1180.784] * [-1182.354] (-1186.144) (-1181.398) (-1181.192) -- 0:00:45
273500 -- (-1181.851) (-1185.044) [-1181.845] (-1185.207) * (-1182.597) (-1194.381) [-1183.003] (-1181.160) -- 0:00:45
274000 -- [-1183.714] (-1182.732) (-1180.851) (-1180.721) * (-1183.114) (-1183.485) (-1188.049) [-1184.074] -- 0:00:45
274500 -- (-1183.677) (-1185.473) [-1181.805] (-1182.503) * (-1186.719) [-1181.970] (-1183.651) (-1180.972) -- 0:00:44
275000 -- (-1186.464) [-1183.616] (-1184.193) (-1182.601) * (-1183.695) [-1186.431] (-1182.346) (-1181.446) -- 0:00:44
Average standard deviation of split frequencies: 0.020136
275500 -- (-1183.791) [-1181.293] (-1184.308) (-1182.709) * (-1181.981) [-1182.063] (-1181.061) (-1181.849) -- 0:00:44
276000 -- (-1183.982) (-1183.868) (-1182.907) [-1182.715] * [-1183.256] (-1185.420) (-1181.565) (-1183.349) -- 0:00:44
276500 -- (-1182.075) [-1183.373] (-1188.526) (-1181.148) * (-1182.895) (-1184.212) (-1182.076) [-1180.899] -- 0:00:44
277000 -- (-1182.020) [-1181.710] (-1186.424) (-1182.054) * (-1182.096) [-1184.224] (-1181.095) (-1183.032) -- 0:00:44
277500 -- (-1181.389) (-1182.523) (-1185.173) [-1183.620] * (-1182.557) (-1184.166) [-1181.706] (-1184.165) -- 0:00:44
278000 -- (-1181.267) (-1183.720) [-1181.750] (-1182.044) * (-1184.065) (-1181.564) [-1184.472] (-1182.202) -- 0:00:44
278500 -- (-1183.465) (-1183.377) (-1181.838) [-1182.130] * (-1184.361) (-1183.871) (-1182.573) [-1182.914] -- 0:00:44
279000 -- (-1183.098) (-1184.682) [-1182.410] (-1183.032) * [-1186.668] (-1182.609) (-1182.613) (-1184.103) -- 0:00:43
279500 -- [-1183.125] (-1181.136) (-1186.541) (-1181.044) * (-1183.306) (-1185.640) (-1180.982) [-1181.197] -- 0:00:43
280000 -- (-1184.742) (-1182.130) (-1188.347) [-1185.065] * [-1181.134] (-1182.797) (-1181.037) (-1180.939) -- 0:00:43
Average standard deviation of split frequencies: 0.020509
280500 -- (-1182.104) (-1181.926) [-1184.604] (-1185.765) * (-1183.244) (-1182.339) (-1181.253) [-1182.150] -- 0:00:46
281000 -- [-1180.645] (-1185.430) (-1182.925) (-1184.976) * (-1185.204) (-1181.512) (-1183.904) [-1184.392] -- 0:00:46
281500 -- (-1182.905) [-1185.472] (-1183.368) (-1182.977) * [-1182.564] (-1181.304) (-1186.218) (-1184.402) -- 0:00:45
282000 -- (-1185.658) (-1186.342) (-1182.068) [-1181.354] * (-1181.656) [-1180.649] (-1182.559) (-1181.590) -- 0:00:45
282500 -- (-1181.260) [-1180.648] (-1182.471) (-1181.433) * [-1182.101] (-1182.088) (-1181.282) (-1181.828) -- 0:00:45
283000 -- (-1181.490) [-1180.873] (-1184.724) (-1182.840) * (-1182.693) (-1183.701) (-1180.940) [-1182.617] -- 0:00:45
283500 -- (-1181.158) (-1181.528) [-1181.228] (-1184.502) * (-1182.734) [-1181.360] (-1182.582) (-1181.095) -- 0:00:45
284000 -- (-1180.928) [-1183.263] (-1183.921) (-1186.036) * [-1184.779] (-1184.773) (-1181.455) (-1182.017) -- 0:00:45
284500 -- [-1182.624] (-1183.708) (-1182.588) (-1183.602) * [-1182.121] (-1184.505) (-1181.159) (-1181.221) -- 0:00:45
285000 -- (-1183.376) (-1182.186) (-1183.271) [-1182.195] * (-1181.525) (-1184.765) [-1182.509] (-1182.504) -- 0:00:45
Average standard deviation of split frequencies: 0.019519
285500 -- (-1181.557) (-1181.765) [-1182.936] (-1188.809) * (-1181.601) [-1188.147] (-1184.109) (-1183.058) -- 0:00:45
286000 -- [-1181.070] (-1181.218) (-1187.197) (-1184.300) * [-1181.303] (-1183.902) (-1183.766) (-1183.068) -- 0:00:44
286500 -- (-1182.037) (-1182.712) (-1187.136) [-1181.363] * [-1182.826] (-1185.459) (-1183.421) (-1182.304) -- 0:00:44
287000 -- (-1183.843) (-1182.405) (-1182.299) [-1180.597] * [-1184.227] (-1182.050) (-1184.494) (-1182.168) -- 0:00:44
287500 -- (-1187.460) (-1183.972) (-1181.772) [-1180.476] * (-1181.488) (-1182.577) [-1183.986] (-1184.470) -- 0:00:44
288000 -- (-1186.261) (-1182.676) (-1183.097) [-1186.561] * [-1181.313] (-1183.242) (-1184.081) (-1181.328) -- 0:00:44
288500 -- (-1184.650) (-1182.312) (-1182.568) [-1182.202] * [-1182.174] (-1182.220) (-1182.879) (-1181.775) -- 0:00:44
289000 -- (-1183.573) (-1183.807) [-1182.381] (-1180.674) * (-1181.458) (-1184.601) [-1182.628] (-1184.716) -- 0:00:44
289500 -- (-1181.133) (-1182.909) [-1182.423] (-1181.243) * [-1182.259] (-1182.634) (-1183.277) (-1183.645) -- 0:00:44
290000 -- (-1181.986) (-1186.531) (-1181.619) [-1183.676] * [-1181.710] (-1181.154) (-1182.342) (-1183.636) -- 0:00:44
Average standard deviation of split frequencies: 0.018267
290500 -- (-1182.699) [-1183.349] (-1182.799) (-1180.821) * (-1181.169) (-1181.308) [-1183.061] (-1186.889) -- 0:00:43
291000 -- [-1182.037] (-1184.209) (-1182.015) (-1182.107) * (-1181.629) (-1182.444) [-1181.833] (-1185.027) -- 0:00:43
291500 -- (-1189.597) [-1182.024] (-1181.099) (-1182.806) * [-1181.925] (-1184.485) (-1182.492) (-1181.876) -- 0:00:43
292000 -- (-1182.307) (-1184.765) (-1183.736) [-1183.491] * [-1182.178] (-1181.985) (-1182.067) (-1184.901) -- 0:00:43
292500 -- (-1183.348) (-1183.082) [-1183.816] (-1184.264) * (-1182.183) [-1182.683] (-1181.604) (-1184.807) -- 0:00:43
293000 -- (-1184.137) (-1183.208) [-1182.038] (-1184.452) * (-1182.183) [-1182.248] (-1181.798) (-1184.058) -- 0:00:43
293500 -- [-1183.966] (-1182.687) (-1182.756) (-1181.452) * (-1182.044) (-1181.914) [-1183.214] (-1186.598) -- 0:00:43
294000 -- [-1183.325] (-1183.511) (-1183.853) (-1182.303) * (-1182.450) (-1181.673) [-1184.458] (-1184.266) -- 0:00:43
294500 -- [-1182.698] (-1185.315) (-1183.322) (-1184.037) * [-1181.243] (-1181.662) (-1182.228) (-1185.611) -- 0:00:43
295000 -- [-1185.805] (-1184.957) (-1186.133) (-1180.585) * [-1183.050] (-1180.990) (-1182.287) (-1187.013) -- 0:00:43
Average standard deviation of split frequencies: 0.018155
295500 -- (-1185.317) (-1184.129) (-1181.792) [-1181.478] * (-1185.264) [-1185.333] (-1184.928) (-1182.133) -- 0:00:42
296000 -- (-1182.617) (-1183.386) (-1195.492) [-1181.478] * [-1184.315] (-1182.721) (-1181.105) (-1183.695) -- 0:00:42
296500 -- (-1182.617) (-1186.600) (-1184.998) [-1180.748] * (-1182.070) [-1183.745] (-1180.962) (-1182.603) -- 0:00:45
297000 -- (-1181.348) (-1185.418) (-1183.665) [-1181.080] * (-1186.159) (-1183.570) (-1181.381) [-1182.977] -- 0:00:44
297500 -- [-1181.337] (-1183.326) (-1183.092) (-1181.156) * (-1183.402) (-1181.996) (-1183.606) [-1181.384] -- 0:00:44
298000 -- (-1182.187) (-1185.972) [-1181.962] (-1180.962) * (-1182.324) [-1183.054] (-1183.904) (-1183.265) -- 0:00:44
298500 -- (-1181.430) [-1185.797] (-1180.745) (-1180.755) * (-1180.795) (-1183.117) [-1185.802] (-1182.334) -- 0:00:44
299000 -- (-1182.906) (-1183.749) [-1184.176] (-1182.270) * [-1180.864] (-1184.290) (-1182.377) (-1186.175) -- 0:00:44
299500 -- (-1183.459) [-1181.984] (-1181.503) (-1183.229) * [-1182.070] (-1184.257) (-1183.326) (-1186.113) -- 0:00:44
300000 -- (-1187.275) [-1182.318] (-1182.101) (-1180.726) * (-1182.523) (-1183.335) [-1182.564] (-1181.607) -- 0:00:44
Average standard deviation of split frequencies: 0.018187
300500 -- (-1187.574) (-1183.731) [-1182.644] (-1181.466) * (-1181.994) (-1182.572) [-1181.012] (-1181.003) -- 0:00:44
301000 -- (-1181.814) [-1182.948] (-1181.415) (-1183.975) * (-1182.233) (-1184.182) (-1181.768) [-1181.997] -- 0:00:44
301500 -- [-1183.733] (-1183.915) (-1183.478) (-1182.921) * [-1181.567] (-1184.773) (-1181.458) (-1184.965) -- 0:00:44
302000 -- (-1184.313) [-1181.508] (-1182.206) (-1184.021) * [-1183.143] (-1185.043) (-1182.641) (-1183.655) -- 0:00:43
302500 -- [-1182.556] (-1185.826) (-1182.484) (-1182.096) * (-1181.529) (-1183.879) (-1187.393) [-1181.825] -- 0:00:43
303000 -- [-1183.571] (-1181.771) (-1181.484) (-1183.851) * [-1184.704] (-1185.706) (-1182.282) (-1184.325) -- 0:00:43
303500 -- (-1183.597) (-1182.010) [-1182.776] (-1183.503) * (-1183.553) (-1185.796) [-1185.758] (-1182.682) -- 0:00:43
304000 -- [-1183.335] (-1182.443) (-1184.714) (-1183.578) * [-1182.289] (-1186.688) (-1181.185) (-1181.547) -- 0:00:43
304500 -- [-1180.821] (-1182.951) (-1182.387) (-1184.145) * [-1182.005] (-1191.146) (-1181.930) (-1183.126) -- 0:00:43
305000 -- (-1180.795) [-1183.291] (-1182.549) (-1182.463) * (-1182.495) (-1182.673) [-1182.930] (-1182.899) -- 0:00:43
Average standard deviation of split frequencies: 0.018255
305500 -- [-1180.773] (-1184.589) (-1186.242) (-1182.333) * (-1182.384) [-1182.748] (-1188.661) (-1184.248) -- 0:00:43
306000 -- (-1181.738) (-1184.126) [-1182.337] (-1184.821) * (-1181.423) [-1181.343] (-1184.005) (-1182.661) -- 0:00:43
306500 -- [-1180.868] (-1187.066) (-1184.642) (-1181.377) * (-1183.905) [-1180.740] (-1183.642) (-1182.423) -- 0:00:42
307000 -- [-1182.426] (-1183.510) (-1181.384) (-1184.405) * (-1183.646) (-1181.442) [-1182.726] (-1181.487) -- 0:00:42
307500 -- (-1182.392) (-1184.018) (-1181.138) [-1183.702] * (-1182.224) [-1182.107] (-1180.289) (-1181.414) -- 0:00:42
308000 -- (-1181.924) (-1184.128) (-1181.981) [-1183.335] * (-1182.369) [-1182.107] (-1182.096) (-1182.959) -- 0:00:42
308500 -- (-1182.034) (-1186.185) [-1182.682] (-1183.307) * [-1182.263] (-1183.801) (-1183.576) (-1182.493) -- 0:00:42
309000 -- (-1186.129) [-1184.483] (-1183.688) (-1182.779) * (-1182.487) (-1184.536) [-1185.579] (-1185.969) -- 0:00:42
309500 -- (-1183.891) (-1182.956) [-1181.353] (-1184.241) * [-1181.976] (-1182.057) (-1182.154) (-1182.717) -- 0:00:42
310000 -- (-1180.701) (-1182.820) [-1183.635] (-1185.646) * (-1181.048) (-1183.491) [-1183.736] (-1190.079) -- 0:00:42
Average standard deviation of split frequencies: 0.017602
310500 -- (-1181.049) [-1182.480] (-1183.536) (-1189.991) * (-1180.739) [-1182.069] (-1181.842) (-1185.045) -- 0:00:42
311000 -- (-1181.225) [-1182.149] (-1184.010) (-1182.544) * [-1180.738] (-1181.214) (-1181.521) (-1185.095) -- 0:00:42
311500 -- [-1181.956] (-1181.574) (-1182.573) (-1183.128) * (-1180.749) (-1180.318) (-1182.699) [-1185.364] -- 0:00:44
312000 -- (-1185.122) [-1181.211] (-1182.612) (-1182.406) * [-1182.374] (-1180.694) (-1182.116) (-1185.199) -- 0:00:44
312500 -- (-1183.419) (-1181.123) (-1181.658) [-1184.470] * [-1181.163] (-1181.725) (-1183.969) (-1185.005) -- 0:00:44
313000 -- [-1183.085] (-1181.661) (-1180.954) (-1190.625) * (-1181.544) (-1181.109) [-1185.287] (-1184.896) -- 0:00:43
313500 -- (-1182.706) (-1181.111) [-1188.448] (-1182.383) * [-1180.656] (-1181.508) (-1182.741) (-1184.159) -- 0:00:43
314000 -- [-1181.275] (-1180.811) (-1187.622) (-1182.154) * (-1181.675) [-1182.730] (-1181.513) (-1183.193) -- 0:00:43
314500 -- [-1181.694] (-1186.755) (-1183.912) (-1182.290) * (-1183.224) [-1182.833] (-1182.916) (-1184.131) -- 0:00:43
315000 -- (-1185.464) [-1185.258] (-1184.636) (-1182.425) * (-1181.801) (-1182.317) (-1182.304) [-1182.957] -- 0:00:43
Average standard deviation of split frequencies: 0.016932
315500 -- [-1181.078] (-1186.079) (-1187.097) (-1183.588) * [-1184.362] (-1184.356) (-1181.402) (-1182.979) -- 0:00:43
316000 -- (-1181.399) (-1181.313) (-1181.282) [-1183.248] * (-1183.841) (-1183.277) (-1182.833) [-1180.623] -- 0:00:43
316500 -- (-1187.122) (-1181.560) (-1183.004) [-1183.194] * (-1187.140) (-1187.447) (-1184.652) [-1180.647] -- 0:00:43
317000 -- (-1185.115) (-1182.257) [-1180.441] (-1183.145) * (-1183.917) [-1185.179] (-1183.256) (-1181.964) -- 0:00:43
317500 -- (-1183.851) (-1180.985) (-1181.652) [-1181.391] * (-1183.293) [-1182.681] (-1184.610) (-1184.624) -- 0:00:42
318000 -- (-1181.054) (-1180.512) (-1184.623) [-1180.449] * (-1183.584) (-1186.064) (-1183.092) [-1182.423] -- 0:00:42
318500 -- (-1182.504) (-1183.573) (-1184.379) [-1181.026] * (-1181.350) [-1182.264] (-1190.810) (-1182.532) -- 0:00:42
319000 -- (-1182.573) (-1182.567) [-1180.945] (-1184.435) * [-1181.045] (-1182.063) (-1187.191) (-1185.782) -- 0:00:42
319500 -- (-1185.390) (-1182.084) [-1180.943] (-1185.426) * (-1180.912) (-1182.496) [-1184.654] (-1185.000) -- 0:00:42
320000 -- [-1182.674] (-1182.394) (-1181.007) (-1185.976) * (-1181.349) (-1183.081) (-1185.511) [-1183.184] -- 0:00:42
Average standard deviation of split frequencies: 0.017714
320500 -- [-1184.039] (-1182.768) (-1181.634) (-1182.812) * [-1183.251] (-1180.822) (-1184.143) (-1182.275) -- 0:00:42
321000 -- [-1183.471] (-1184.453) (-1180.910) (-1182.410) * (-1182.365) (-1181.386) [-1182.661] (-1182.831) -- 0:00:42
321500 -- (-1182.739) (-1183.090) [-1183.774] (-1184.798) * (-1187.433) (-1182.215) [-1182.383] (-1182.056) -- 0:00:42
322000 -- (-1182.279) [-1181.856] (-1182.135) (-1180.960) * (-1184.044) (-1181.866) (-1181.927) [-1183.415] -- 0:00:42
322500 -- (-1184.181) (-1183.772) [-1182.118] (-1181.311) * (-1181.991) (-1183.438) [-1180.982] (-1185.662) -- 0:00:42
323000 -- (-1183.050) (-1183.140) (-1181.534) [-1182.542] * (-1183.569) [-1180.867] (-1183.608) (-1184.363) -- 0:00:41
323500 -- [-1181.716] (-1181.682) (-1181.589) (-1181.120) * (-1181.051) (-1181.140) (-1181.284) [-1183.872] -- 0:00:41
324000 -- (-1182.898) (-1181.726) [-1187.525] (-1181.212) * [-1181.810] (-1180.909) (-1181.462) (-1186.277) -- 0:00:41
324500 -- (-1186.306) (-1185.808) [-1183.073] (-1182.792) * (-1182.347) (-1181.143) [-1181.116] (-1181.976) -- 0:00:41
325000 -- (-1186.662) (-1184.815) (-1186.115) [-1183.135] * (-1182.769) [-1181.580] (-1182.222) (-1182.041) -- 0:00:41
Average standard deviation of split frequencies: 0.017221
325500 -- (-1184.778) [-1182.886] (-1183.309) (-1185.644) * (-1180.819) (-1182.425) (-1186.175) [-1182.023] -- 0:00:41
326000 -- [-1183.947] (-1183.766) (-1181.346) (-1182.233) * (-1180.483) [-1182.759] (-1181.856) (-1180.467) -- 0:00:41
326500 -- [-1184.115] (-1181.971) (-1181.955) (-1181.075) * (-1181.238) (-1184.177) (-1181.834) [-1181.511] -- 0:00:41
327000 -- (-1180.862) [-1184.023] (-1184.116) (-1180.609) * (-1186.085) (-1182.461) (-1180.832) [-1181.511] -- 0:00:41
327500 -- [-1182.556] (-1184.768) (-1185.617) (-1181.313) * (-1189.126) (-1182.513) (-1182.118) [-1183.436] -- 0:00:43
328000 -- (-1181.875) [-1182.358] (-1184.068) (-1182.826) * (-1188.843) (-1183.588) (-1181.938) [-1183.847] -- 0:00:43
328500 -- (-1185.011) [-1182.501] (-1182.372) (-1182.804) * (-1184.368) [-1182.967] (-1183.380) (-1182.370) -- 0:00:42
329000 -- (-1184.017) [-1181.279] (-1189.985) (-1185.105) * (-1182.954) (-1181.658) [-1181.208] (-1180.828) -- 0:00:42
329500 -- (-1181.316) (-1182.613) (-1181.539) [-1186.327] * (-1183.773) (-1182.842) [-1181.756] (-1180.627) -- 0:00:42
330000 -- (-1184.070) [-1184.288] (-1182.414) (-1187.124) * (-1184.885) [-1184.332] (-1181.169) (-1183.862) -- 0:00:42
Average standard deviation of split frequencies: 0.017561
330500 -- (-1182.211) (-1182.137) (-1185.008) [-1184.766] * [-1187.753] (-1184.469) (-1182.831) (-1184.224) -- 0:00:42
331000 -- (-1182.009) [-1182.810] (-1184.581) (-1188.272) * (-1185.165) (-1184.501) [-1182.087] (-1184.214) -- 0:00:42
331500 -- [-1182.990] (-1182.793) (-1180.768) (-1185.833) * [-1183.177] (-1184.324) (-1182.839) (-1182.096) -- 0:00:42
332000 -- (-1181.800) (-1184.430) [-1183.960] (-1185.603) * [-1185.159] (-1183.968) (-1183.830) (-1181.323) -- 0:00:42
332500 -- (-1180.364) (-1182.853) [-1182.410] (-1183.180) * [-1183.133] (-1186.348) (-1182.283) (-1182.158) -- 0:00:42
333000 -- (-1181.475) [-1182.600] (-1181.571) (-1186.030) * (-1182.045) (-1182.251) (-1182.850) [-1181.502] -- 0:00:42
333500 -- [-1181.475] (-1184.462) (-1181.487) (-1186.257) * (-1186.571) (-1182.290) [-1184.538] (-1183.245) -- 0:00:41
334000 -- [-1181.453] (-1185.906) (-1181.387) (-1183.907) * [-1183.937] (-1185.058) (-1184.320) (-1183.258) -- 0:00:41
334500 -- (-1181.775) [-1184.339] (-1183.353) (-1182.634) * [-1181.741] (-1181.598) (-1184.593) (-1183.064) -- 0:00:41
335000 -- (-1183.338) (-1184.074) (-1184.762) [-1182.712] * (-1185.177) (-1181.807) [-1182.575] (-1184.871) -- 0:00:41
Average standard deviation of split frequencies: 0.017704
335500 -- (-1183.065) (-1182.906) [-1183.462] (-1183.891) * (-1185.113) [-1181.481] (-1181.509) (-1182.964) -- 0:00:41
336000 -- (-1184.678) (-1181.401) [-1181.627] (-1181.600) * [-1182.277] (-1181.993) (-1183.081) (-1184.414) -- 0:00:41
336500 -- [-1182.104] (-1181.442) (-1181.723) (-1181.301) * (-1183.020) (-1181.800) [-1181.840] (-1185.783) -- 0:00:41
337000 -- [-1181.942] (-1182.424) (-1182.834) (-1184.635) * [-1183.607] (-1183.166) (-1184.576) (-1188.253) -- 0:00:41
337500 -- (-1183.746) [-1182.682] (-1183.169) (-1181.559) * (-1183.381) (-1183.333) (-1184.196) [-1180.685] -- 0:00:41
338000 -- (-1180.828) (-1181.840) [-1190.282] (-1185.169) * (-1182.520) (-1182.285) [-1184.597] (-1181.356) -- 0:00:41
338500 -- (-1181.652) (-1182.313) (-1189.262) [-1186.051] * (-1182.257) (-1184.816) (-1185.800) [-1180.695] -- 0:00:41
339000 -- (-1182.712) (-1181.266) (-1187.323) [-1182.109] * (-1182.225) (-1185.410) (-1192.212) [-1183.019] -- 0:00:40
339500 -- (-1181.284) (-1183.695) (-1183.645) [-1181.847] * (-1182.354) (-1183.216) (-1193.572) [-1183.370] -- 0:00:40
340000 -- (-1182.618) (-1182.231) [-1182.008] (-1184.029) * (-1185.791) (-1184.309) (-1185.193) [-1181.700] -- 0:00:40
Average standard deviation of split frequencies: 0.018058
340500 -- (-1182.498) (-1183.949) [-1181.754] (-1182.168) * [-1184.781] (-1184.626) (-1184.300) (-1181.391) -- 0:00:40
341000 -- [-1182.651] (-1182.684) (-1183.236) (-1181.747) * (-1180.964) (-1181.242) [-1182.231] (-1181.068) -- 0:00:40
341500 -- (-1184.722) (-1181.586) [-1180.834] (-1185.932) * (-1181.434) [-1181.020] (-1181.342) (-1182.801) -- 0:00:40
342000 -- (-1182.740) (-1186.493) [-1180.892] (-1183.046) * (-1184.749) [-1181.968] (-1181.270) (-1183.422) -- 0:00:40
342500 -- (-1181.702) (-1182.692) (-1180.971) [-1184.815] * (-1181.781) [-1183.293] (-1181.574) (-1184.353) -- 0:00:40
343000 -- (-1181.341) [-1184.700] (-1184.679) (-1184.589) * (-1181.780) [-1182.374] (-1185.203) (-1188.050) -- 0:00:40
343500 -- (-1181.356) [-1182.726] (-1180.997) (-1186.510) * (-1182.724) (-1184.235) [-1185.103] (-1187.842) -- 0:00:42
344000 -- (-1183.341) [-1182.850] (-1181.708) (-1182.113) * (-1183.739) (-1183.374) [-1184.979] (-1186.460) -- 0:00:41
344500 -- (-1182.192) (-1181.330) (-1182.718) [-1181.066] * [-1181.545] (-1183.409) (-1184.551) (-1186.096) -- 0:00:41
345000 -- (-1183.215) (-1185.124) (-1182.062) [-1182.445] * (-1184.415) [-1181.989] (-1184.590) (-1181.651) -- 0:00:41
Average standard deviation of split frequencies: 0.017507
345500 -- [-1182.432] (-1184.659) (-1182.691) (-1181.108) * (-1183.122) (-1180.765) (-1182.882) [-1184.131] -- 0:00:41
346000 -- (-1183.825) [-1181.171] (-1183.987) (-1184.234) * [-1181.498] (-1181.458) (-1183.245) (-1182.472) -- 0:00:41
346500 -- [-1180.721] (-1181.177) (-1182.499) (-1182.176) * (-1181.787) (-1182.889) (-1189.198) [-1187.793] -- 0:00:41
347000 -- (-1181.643) (-1184.444) [-1186.039] (-1182.221) * (-1184.949) (-1181.479) (-1182.909) [-1184.225] -- 0:00:41
347500 -- (-1181.322) (-1183.649) [-1184.171] (-1183.783) * (-1184.018) (-1181.534) (-1183.832) [-1181.044] -- 0:00:41
348000 -- (-1181.602) (-1183.008) [-1184.511] (-1190.420) * (-1186.261) (-1184.604) [-1184.562] (-1182.491) -- 0:00:41
348500 -- [-1184.696] (-1182.089) (-1182.866) (-1187.480) * (-1182.592) (-1184.517) (-1181.413) [-1181.351] -- 0:00:41
349000 -- (-1187.340) (-1181.041) [-1181.695] (-1185.804) * (-1182.782) (-1182.074) (-1181.128) [-1181.108] -- 0:00:41
349500 -- [-1184.761] (-1180.911) (-1180.981) (-1185.506) * (-1182.046) [-1182.377] (-1180.707) (-1180.902) -- 0:00:40
350000 -- [-1182.820] (-1182.745) (-1186.643) (-1182.255) * [-1182.206] (-1184.008) (-1181.925) (-1182.047) -- 0:00:40
Average standard deviation of split frequencies: 0.017618
350500 -- (-1183.356) [-1181.835] (-1182.156) (-1183.433) * (-1182.848) (-1186.210) (-1181.530) [-1182.809] -- 0:00:40
351000 -- (-1185.752) (-1186.025) [-1181.714] (-1183.676) * [-1181.857] (-1183.854) (-1181.373) (-1181.587) -- 0:00:40
351500 -- (-1185.385) (-1187.301) (-1182.573) [-1182.489] * [-1183.923] (-1184.460) (-1183.942) (-1181.521) -- 0:00:40
352000 -- (-1182.781) [-1183.550] (-1181.914) (-1181.336) * [-1183.160] (-1184.838) (-1182.925) (-1185.528) -- 0:00:40
352500 -- (-1184.358) (-1184.990) [-1180.678] (-1181.971) * (-1183.110) [-1183.459] (-1186.115) (-1183.394) -- 0:00:40
353000 -- [-1181.056] (-1183.062) (-1181.883) (-1180.990) * [-1183.790] (-1184.045) (-1183.590) (-1182.278) -- 0:00:40
353500 -- [-1181.971] (-1182.856) (-1182.745) (-1182.642) * (-1181.859) (-1186.570) [-1183.249] (-1183.752) -- 0:00:40
354000 -- (-1183.680) [-1186.192] (-1181.657) (-1182.726) * (-1181.461) [-1185.846] (-1183.387) (-1186.477) -- 0:00:40
354500 -- (-1183.928) [-1183.906] (-1181.842) (-1182.815) * [-1183.225] (-1184.017) (-1182.637) (-1186.817) -- 0:00:40
355000 -- (-1181.520) [-1181.910] (-1181.823) (-1183.640) * (-1185.982) (-1181.741) [-1181.322] (-1188.290) -- 0:00:39
Average standard deviation of split frequencies: 0.017354
355500 -- [-1186.046] (-1181.165) (-1181.168) (-1185.263) * (-1182.182) (-1181.698) [-1181.972] (-1183.890) -- 0:00:39
356000 -- (-1185.886) (-1182.156) (-1182.486) [-1182.815] * (-1184.808) (-1180.803) (-1181.954) [-1182.688] -- 0:00:39
356500 -- [-1185.209] (-1183.398) (-1183.382) (-1180.766) * (-1181.532) (-1181.430) [-1180.767] (-1182.835) -- 0:00:39
357000 -- (-1185.057) [-1182.320] (-1181.020) (-1181.077) * (-1182.164) (-1182.287) (-1181.668) [-1182.087] -- 0:00:39
357500 -- (-1187.886) [-1184.142] (-1182.134) (-1181.766) * (-1181.216) [-1183.826] (-1183.484) (-1183.005) -- 0:00:39
358000 -- (-1181.557) (-1182.087) (-1181.019) [-1181.278] * (-1185.369) (-1182.244) [-1186.900] (-1182.987) -- 0:00:39
358500 -- (-1182.823) (-1183.056) [-1181.352] (-1183.249) * (-1180.940) (-1183.154) (-1183.257) [-1182.011] -- 0:00:39
359000 -- (-1182.280) (-1183.979) [-1180.895] (-1187.031) * (-1181.420) (-1182.399) [-1181.883] (-1183.066) -- 0:00:39
359500 -- (-1182.144) [-1186.925] (-1181.587) (-1182.889) * (-1183.305) (-1183.014) [-1181.483] (-1183.068) -- 0:00:40
360000 -- (-1183.914) (-1181.967) (-1184.877) [-1181.424] * [-1181.762] (-1183.415) (-1186.211) (-1182.549) -- 0:00:40
Average standard deviation of split frequencies: 0.017886
360500 -- (-1183.738) (-1180.497) [-1181.555] (-1181.183) * (-1180.716) [-1181.702] (-1185.094) (-1181.767) -- 0:00:40
361000 -- (-1181.132) (-1181.191) [-1181.079] (-1180.884) * [-1181.192] (-1182.076) (-1184.709) (-1182.392) -- 0:00:40
361500 -- (-1181.220) (-1183.838) [-1180.660] (-1180.676) * (-1186.328) [-1181.035] (-1180.891) (-1181.877) -- 0:00:40
362000 -- (-1181.629) (-1182.473) (-1181.402) [-1184.070] * (-1185.312) (-1182.217) (-1184.008) [-1183.366] -- 0:00:40
362500 -- [-1182.239] (-1188.309) (-1181.402) (-1186.591) * (-1182.230) (-1181.638) (-1183.500) [-1183.603] -- 0:00:40
363000 -- (-1182.150) (-1181.904) (-1184.439) [-1183.182] * (-1180.944) [-1182.294] (-1181.491) (-1190.029) -- 0:00:40
363500 -- [-1183.529] (-1181.736) (-1181.300) (-1184.017) * (-1182.088) [-1183.393] (-1181.508) (-1184.211) -- 0:00:40
364000 -- (-1186.429) (-1184.200) [-1181.822] (-1185.502) * [-1184.769] (-1181.781) (-1181.215) (-1182.566) -- 0:00:40
364500 -- (-1181.858) (-1182.664) [-1181.623] (-1185.238) * (-1181.709) (-1187.124) [-1181.159] (-1182.982) -- 0:00:40
365000 -- [-1183.867] (-1185.548) (-1185.758) (-1184.198) * (-1182.542) (-1181.072) [-1183.922] (-1183.459) -- 0:00:40
Average standard deviation of split frequencies: 0.017964
365500 -- [-1181.441] (-1185.811) (-1182.838) (-1184.052) * (-1184.103) [-1181.108] (-1182.231) (-1184.410) -- 0:00:39
366000 -- [-1182.173] (-1184.130) (-1185.169) (-1184.637) * (-1182.420) (-1182.320) [-1182.179] (-1182.134) -- 0:00:39
366500 -- (-1182.111) [-1182.016] (-1187.230) (-1184.429) * (-1182.745) (-1182.744) [-1182.472] (-1180.991) -- 0:00:39
367000 -- (-1183.336) (-1184.391) [-1186.190] (-1182.099) * (-1183.271) [-1182.280] (-1182.205) (-1180.990) -- 0:00:39
367500 -- (-1183.510) [-1184.417] (-1185.455) (-1181.243) * (-1181.726) (-1181.562) (-1182.319) [-1182.062] -- 0:00:39
368000 -- [-1183.126] (-1181.328) (-1181.262) (-1183.008) * (-1186.754) (-1182.444) [-1181.469] (-1181.204) -- 0:00:39
368500 -- (-1183.660) (-1183.876) [-1184.265] (-1185.377) * (-1185.586) (-1181.213) (-1184.326) [-1180.736] -- 0:00:39
369000 -- (-1181.195) (-1181.612) [-1184.559] (-1187.425) * [-1184.392] (-1183.024) (-1182.819) (-1180.770) -- 0:00:39
369500 -- (-1182.200) [-1181.795] (-1184.113) (-1183.700) * (-1185.822) [-1180.746] (-1181.801) (-1181.141) -- 0:00:39
370000 -- [-1187.188] (-1184.380) (-1182.696) (-1182.045) * (-1185.253) (-1181.442) [-1181.719] (-1180.530) -- 0:00:39
Average standard deviation of split frequencies: 0.017738
370500 -- (-1183.497) [-1182.602] (-1185.494) (-1181.321) * (-1182.337) (-1183.125) (-1182.806) [-1181.301] -- 0:00:39
371000 -- (-1183.036) [-1183.020] (-1183.525) (-1182.367) * (-1183.877) (-1183.921) [-1182.447] (-1185.850) -- 0:00:38
371500 -- (-1183.946) (-1183.985) [-1181.119] (-1184.363) * (-1183.031) (-1182.241) [-1181.144] (-1188.348) -- 0:00:38
372000 -- (-1190.884) [-1180.897] (-1181.330) (-1182.343) * [-1182.951] (-1181.261) (-1181.916) (-1187.144) -- 0:00:38
372500 -- [-1181.687] (-1183.936) (-1183.776) (-1183.212) * [-1182.050] (-1184.106) (-1182.913) (-1181.231) -- 0:00:38
373000 -- (-1182.338) (-1181.523) [-1186.951] (-1182.584) * (-1182.456) (-1181.887) [-1180.787] (-1180.975) -- 0:00:38
373500 -- [-1185.018] (-1183.373) (-1185.294) (-1184.093) * (-1180.541) (-1180.397) [-1180.727] (-1183.794) -- 0:00:38
374000 -- (-1182.300) (-1182.886) [-1186.713] (-1183.684) * (-1183.169) (-1180.752) (-1184.459) [-1185.400] -- 0:00:38
374500 -- (-1183.001) [-1182.581] (-1182.254) (-1183.049) * (-1181.539) [-1180.962] (-1182.769) (-1182.302) -- 0:00:38
375000 -- (-1181.081) (-1181.957) (-1184.379) [-1180.715] * (-1185.215) [-1182.456] (-1181.907) (-1182.963) -- 0:00:38
Average standard deviation of split frequencies: 0.016101
375500 -- (-1182.255) (-1181.011) (-1182.709) [-1181.071] * (-1187.755) [-1181.491] (-1183.433) (-1185.168) -- 0:00:38
376000 -- (-1181.850) (-1185.415) [-1183.027] (-1180.594) * (-1188.926) (-1187.694) (-1183.582) [-1182.928] -- 0:00:39
376500 -- (-1180.593) [-1181.084] (-1182.324) (-1183.010) * (-1183.693) (-1183.041) [-1183.406] (-1182.613) -- 0:00:39
377000 -- (-1182.270) (-1181.565) (-1182.509) [-1182.722] * (-1181.982) (-1182.678) (-1180.989) [-1181.946] -- 0:00:39
377500 -- [-1181.699] (-1182.704) (-1183.775) (-1185.493) * (-1181.809) (-1183.453) [-1180.880] (-1182.518) -- 0:00:39
378000 -- (-1184.953) (-1181.583) [-1184.433] (-1181.164) * (-1184.013) (-1186.202) [-1181.554] (-1181.491) -- 0:00:39
378500 -- (-1181.415) (-1180.993) [-1182.575] (-1183.880) * (-1183.880) (-1184.068) [-1181.227] (-1184.527) -- 0:00:39
379000 -- (-1184.311) (-1181.784) [-1182.657] (-1180.632) * (-1184.947) (-1185.850) [-1181.426] (-1184.547) -- 0:00:39
379500 -- (-1185.906) (-1180.655) [-1182.259] (-1185.733) * [-1183.160] (-1185.217) (-1181.260) (-1183.136) -- 0:00:39
380000 -- [-1184.866] (-1185.889) (-1186.975) (-1182.433) * (-1184.122) (-1183.178) [-1181.425] (-1181.819) -- 0:00:39
Average standard deviation of split frequencies: 0.015447
380500 -- [-1187.683] (-1185.624) (-1187.567) (-1185.464) * (-1180.924) (-1185.232) [-1182.397] (-1183.265) -- 0:00:39
381000 -- (-1185.766) (-1184.921) [-1187.766] (-1185.971) * [-1183.488] (-1181.914) (-1181.410) (-1183.511) -- 0:00:38
381500 -- (-1184.937) (-1185.799) (-1187.357) [-1182.176] * (-1182.777) (-1180.782) [-1181.175] (-1182.187) -- 0:00:38
382000 -- (-1183.298) (-1181.504) (-1183.354) [-1181.261] * (-1182.766) (-1181.363) [-1181.497] (-1181.427) -- 0:00:38
382500 -- (-1183.056) [-1183.844] (-1185.685) (-1180.731) * (-1181.441) (-1181.699) [-1181.146] (-1183.881) -- 0:00:38
383000 -- [-1182.699] (-1181.897) (-1188.125) (-1180.947) * (-1181.293) (-1180.593) [-1182.118] (-1185.790) -- 0:00:38
383500 -- (-1184.430) [-1184.471] (-1185.614) (-1187.194) * (-1183.321) (-1182.259) (-1184.014) [-1181.488] -- 0:00:38
384000 -- (-1182.915) (-1182.599) (-1184.184) [-1185.199] * (-1180.486) (-1181.667) (-1183.089) [-1181.436] -- 0:00:38
384500 -- (-1183.843) (-1184.398) (-1181.897) [-1185.586] * [-1181.591] (-1181.921) (-1182.996) (-1182.573) -- 0:00:38
385000 -- (-1184.372) (-1184.146) (-1182.186) [-1183.895] * [-1180.779] (-1181.985) (-1185.098) (-1182.378) -- 0:00:38
Average standard deviation of split frequencies: 0.015362
385500 -- [-1182.456] (-1187.397) (-1183.883) (-1187.968) * (-1182.381) (-1182.080) (-1184.562) [-1183.307] -- 0:00:38
386000 -- [-1180.751] (-1190.875) (-1182.538) (-1182.908) * (-1183.265) (-1182.815) [-1182.242] (-1186.840) -- 0:00:38
386500 -- (-1182.635) (-1183.562) (-1181.741) [-1181.385] * (-1181.215) (-1182.896) [-1182.646] (-1185.502) -- 0:00:38
387000 -- (-1182.248) (-1182.219) (-1181.642) [-1181.225] * (-1183.619) (-1183.764) [-1181.009] (-1184.637) -- 0:00:38
387500 -- [-1183.931] (-1180.999) (-1183.174) (-1181.118) * (-1183.813) (-1181.058) (-1181.775) [-1186.654] -- 0:00:37
388000 -- (-1182.987) (-1181.395) (-1180.911) [-1182.763] * (-1184.415) (-1185.224) [-1180.625] (-1185.873) -- 0:00:37
388500 -- [-1181.978] (-1180.880) (-1183.303) (-1184.737) * (-1183.930) (-1182.632) [-1180.486] (-1183.126) -- 0:00:37
389000 -- (-1182.400) [-1183.709] (-1185.516) (-1184.080) * [-1181.856] (-1183.113) (-1185.313) (-1182.147) -- 0:00:37
389500 -- [-1181.895] (-1183.962) (-1183.198) (-1184.951) * (-1181.859) (-1182.690) (-1183.639) [-1181.348] -- 0:00:37
390000 -- (-1181.522) [-1183.680] (-1181.256) (-1184.615) * (-1182.561) (-1182.338) (-1182.394) [-1183.066] -- 0:00:37
Average standard deviation of split frequencies: 0.016113
390500 -- (-1182.721) [-1182.273] (-1181.256) (-1184.626) * (-1183.120) [-1182.333] (-1182.301) (-1184.073) -- 0:00:37
391000 -- (-1182.586) (-1184.803) [-1182.856] (-1183.075) * (-1182.566) (-1181.946) (-1181.338) [-1181.849] -- 0:00:37
391500 -- (-1182.697) (-1187.012) [-1182.860] (-1183.520) * (-1182.042) [-1180.520] (-1181.232) (-1181.520) -- 0:00:37
392000 -- (-1193.240) [-1185.359] (-1182.656) (-1183.705) * (-1181.047) (-1182.146) [-1181.232] (-1181.758) -- 0:00:38
392500 -- [-1181.602] (-1188.680) (-1182.529) (-1182.536) * [-1184.166] (-1181.777) (-1184.720) (-1184.114) -- 0:00:38
393000 -- (-1187.571) (-1185.240) [-1181.745] (-1181.504) * (-1181.609) (-1181.090) (-1186.083) [-1182.129] -- 0:00:38
393500 -- (-1182.622) [-1183.726] (-1181.846) (-1181.742) * (-1187.532) (-1181.770) (-1180.577) [-1183.883] -- 0:00:38
394000 -- (-1184.043) (-1185.715) [-1181.842] (-1182.293) * (-1185.530) [-1181.049] (-1180.857) (-1182.310) -- 0:00:38
394500 -- (-1182.677) (-1182.568) [-1182.186] (-1185.737) * (-1187.111) [-1181.737] (-1180.903) (-1181.731) -- 0:00:38
395000 -- (-1186.422) [-1181.711] (-1186.495) (-1181.282) * [-1184.297] (-1183.721) (-1184.742) (-1180.745) -- 0:00:38
Average standard deviation of split frequencies: 0.014682
395500 -- (-1182.954) (-1184.589) [-1183.851] (-1187.340) * (-1180.702) (-1183.938) (-1186.547) [-1183.121] -- 0:00:38
396000 -- (-1182.003) [-1182.586] (-1183.090) (-1184.313) * [-1181.595] (-1181.930) (-1183.680) (-1181.804) -- 0:00:38
396500 -- (-1184.307) (-1183.734) (-1182.437) [-1183.111] * (-1180.946) (-1182.370) [-1183.517] (-1181.613) -- 0:00:38
397000 -- (-1183.837) [-1181.284] (-1184.825) (-1183.881) * [-1182.221] (-1184.220) (-1182.872) (-1183.466) -- 0:00:37
397500 -- (-1182.357) (-1181.628) (-1182.573) [-1184.479] * (-1182.245) [-1180.804] (-1182.712) (-1182.206) -- 0:00:37
398000 -- [-1183.675] (-1184.213) (-1186.936) (-1181.015) * (-1182.213) (-1184.246) [-1183.802] (-1183.920) -- 0:00:37
398500 -- [-1184.774] (-1183.697) (-1183.544) (-1180.817) * (-1185.581) [-1185.565] (-1186.262) (-1188.111) -- 0:00:37
399000 -- (-1183.323) (-1181.683) [-1183.496] (-1180.809) * [-1181.124] (-1182.184) (-1181.798) (-1189.942) -- 0:00:37
399500 -- [-1184.017] (-1182.701) (-1183.443) (-1183.493) * (-1181.634) [-1184.915] (-1182.678) (-1181.088) -- 0:00:37
400000 -- (-1183.567) (-1182.918) [-1180.997] (-1181.563) * (-1187.160) (-1181.302) (-1182.362) [-1182.186] -- 0:00:37
Average standard deviation of split frequencies: 0.014119
400500 -- [-1182.491] (-1182.617) (-1181.812) (-1184.808) * (-1184.448) (-1185.705) (-1182.218) [-1181.072] -- 0:00:37
401000 -- [-1182.541] (-1184.214) (-1185.395) (-1186.442) * (-1184.005) (-1182.489) (-1182.985) [-1182.423] -- 0:00:37
401500 -- [-1183.257] (-1188.724) (-1181.944) (-1181.600) * (-1182.446) (-1183.200) (-1182.433) [-1182.330] -- 0:00:37
402000 -- (-1182.345) (-1185.957) [-1184.782] (-1185.789) * (-1182.435) (-1182.130) [-1183.953] (-1181.174) -- 0:00:37
402500 -- (-1181.093) (-1183.958) (-1186.358) [-1183.869] * (-1181.415) [-1182.050] (-1182.389) (-1181.200) -- 0:00:37
403000 -- (-1183.859) (-1182.770) [-1182.926] (-1182.634) * (-1181.151) (-1183.413) (-1182.828) [-1181.318] -- 0:00:37
403500 -- (-1186.685) [-1183.616] (-1182.734) (-1182.889) * (-1189.032) (-1185.098) (-1181.454) [-1183.123] -- 0:00:36
404000 -- (-1184.009) [-1183.313] (-1184.262) (-1182.262) * (-1184.716) (-1182.442) (-1181.041) [-1182.652] -- 0:00:36
404500 -- (-1182.807) [-1183.155] (-1184.542) (-1185.266) * (-1182.246) [-1181.974] (-1186.270) (-1180.898) -- 0:00:36
405000 -- (-1181.119) (-1186.992) (-1181.486) [-1182.286] * (-1181.359) (-1182.982) (-1182.579) [-1182.570] -- 0:00:36
Average standard deviation of split frequencies: 0.013933
405500 -- (-1181.011) (-1182.809) (-1181.396) [-1180.996] * (-1181.655) (-1185.597) [-1181.877] (-1186.202) -- 0:00:36
406000 -- (-1183.213) (-1181.498) [-1181.609] (-1183.756) * [-1181.414] (-1183.381) (-1183.407) (-1186.191) -- 0:00:36
406500 -- (-1182.612) [-1182.390] (-1188.246) (-1184.255) * (-1181.010) [-1185.026] (-1181.139) (-1186.499) -- 0:00:36
407000 -- [-1181.394] (-1183.585) (-1181.989) (-1184.211) * (-1180.989) [-1183.613] (-1182.829) (-1181.367) -- 0:00:36
407500 -- (-1181.453) (-1182.651) [-1181.431] (-1184.058) * [-1181.291] (-1185.655) (-1181.563) (-1187.095) -- 0:00:36
408000 -- [-1180.336] (-1189.141) (-1182.047) (-1183.048) * (-1182.593) [-1186.083] (-1182.061) (-1182.403) -- 0:00:37
408500 -- [-1181.998] (-1182.569) (-1182.878) (-1187.483) * (-1180.794) [-1180.552] (-1181.654) (-1182.054) -- 0:00:37
409000 -- [-1181.831] (-1188.682) (-1184.324) (-1185.561) * (-1182.048) [-1181.800] (-1185.615) (-1182.423) -- 0:00:37
409500 -- [-1181.666] (-1184.588) (-1180.983) (-1187.226) * (-1182.359) (-1181.522) [-1185.456] (-1181.930) -- 0:00:37
410000 -- (-1181.246) [-1180.800] (-1184.173) (-1184.310) * (-1180.731) [-1182.904] (-1187.118) (-1180.342) -- 0:00:37
Average standard deviation of split frequencies: 0.014157
410500 -- (-1182.151) (-1181.829) (-1184.306) [-1182.196] * (-1186.995) [-1182.825] (-1181.764) (-1181.939) -- 0:00:37
411000 -- (-1183.537) (-1182.653) (-1184.488) [-1185.584] * [-1185.757] (-1184.088) (-1182.030) (-1183.798) -- 0:00:37
411500 -- (-1183.021) [-1183.105] (-1181.782) (-1183.598) * [-1183.691] (-1181.723) (-1180.801) (-1182.723) -- 0:00:37
412000 -- (-1181.196) (-1184.334) [-1181.377] (-1181.283) * (-1183.227) (-1184.139) [-1182.215] (-1182.932) -- 0:00:37
412500 -- [-1180.935] (-1184.807) (-1181.474) (-1181.530) * (-1183.746) (-1183.179) [-1188.642] (-1184.448) -- 0:00:37
413000 -- (-1181.244) (-1181.820) [-1181.341] (-1181.997) * (-1182.312) (-1182.172) [-1181.808] (-1183.437) -- 0:00:36
413500 -- (-1182.354) [-1181.985] (-1184.725) (-1183.677) * (-1182.110) (-1184.079) [-1181.865] (-1182.431) -- 0:00:36
414000 -- (-1182.312) [-1181.931] (-1184.247) (-1183.720) * (-1180.795) (-1186.970) [-1182.915] (-1183.395) -- 0:00:36
414500 -- [-1182.169] (-1183.668) (-1181.646) (-1184.243) * (-1180.788) (-1183.349) [-1180.930] (-1181.848) -- 0:00:36
415000 -- (-1187.777) [-1187.483] (-1182.523) (-1181.276) * (-1181.037) [-1181.670] (-1183.123) (-1182.825) -- 0:00:36
Average standard deviation of split frequencies: 0.013850
415500 -- [-1181.667] (-1188.109) (-1181.678) (-1182.993) * [-1181.598] (-1184.083) (-1182.860) (-1183.644) -- 0:00:36
416000 -- (-1182.897) (-1184.514) (-1183.735) [-1181.158] * [-1180.992] (-1184.567) (-1182.760) (-1181.776) -- 0:00:36
416500 -- (-1185.025) (-1181.861) [-1186.064] (-1182.270) * (-1180.992) [-1183.960] (-1182.625) (-1183.192) -- 0:00:36
417000 -- [-1184.682] (-1182.076) (-1182.086) (-1181.944) * [-1181.957] (-1185.767) (-1183.350) (-1181.549) -- 0:00:36
417500 -- [-1181.235] (-1182.747) (-1181.620) (-1183.268) * (-1183.495) (-1184.932) [-1183.223] (-1183.216) -- 0:00:36
418000 -- (-1181.939) [-1181.563] (-1181.451) (-1184.230) * (-1182.343) (-1182.119) (-1187.441) [-1183.742] -- 0:00:36
418500 -- (-1181.454) [-1182.565] (-1183.202) (-1184.688) * (-1182.306) (-1182.705) [-1183.871] (-1183.035) -- 0:00:36
419000 -- (-1181.867) [-1181.090] (-1182.695) (-1183.649) * (-1186.357) [-1182.216] (-1185.349) (-1181.240) -- 0:00:36
419500 -- (-1182.151) [-1183.564] (-1184.502) (-1184.355) * [-1181.697] (-1183.438) (-1184.098) (-1184.673) -- 0:00:35
420000 -- (-1186.895) [-1182.700] (-1185.089) (-1185.617) * (-1180.883) (-1184.326) [-1182.771] (-1183.527) -- 0:00:35
Average standard deviation of split frequencies: 0.013250
420500 -- (-1184.649) (-1183.637) (-1182.790) [-1180.975] * (-1182.384) (-1183.008) (-1183.157) [-1182.141] -- 0:00:35
421000 -- [-1181.595] (-1182.319) (-1184.743) (-1182.637) * (-1181.206) [-1183.741] (-1185.397) (-1181.940) -- 0:00:35
421500 -- (-1181.639) (-1182.740) [-1185.182] (-1185.516) * [-1183.491] (-1181.861) (-1189.328) (-1182.224) -- 0:00:35
422000 -- [-1183.273] (-1183.559) (-1184.500) (-1182.133) * [-1183.509] (-1181.439) (-1185.765) (-1182.167) -- 0:00:35
422500 -- (-1183.723) (-1181.603) (-1181.445) [-1181.111] * (-1184.262) [-1181.594] (-1185.084) (-1182.728) -- 0:00:35
423000 -- (-1184.014) [-1180.817] (-1181.937) (-1182.832) * (-1182.585) [-1181.687] (-1182.281) (-1183.047) -- 0:00:35
423500 -- (-1184.450) (-1181.234) [-1185.511] (-1184.767) * (-1180.830) (-1183.671) [-1182.597] (-1183.357) -- 0:00:35
424000 -- (-1184.481) (-1183.080) (-1181.684) [-1183.690] * (-1181.489) (-1185.208) [-1183.566] (-1182.025) -- 0:00:36
424500 -- [-1181.540] (-1181.663) (-1183.568) (-1182.039) * [-1181.473] (-1184.601) (-1182.890) (-1182.416) -- 0:00:36
425000 -- (-1187.242) (-1186.791) (-1184.769) [-1184.056] * (-1181.802) (-1185.249) (-1184.835) [-1182.191] -- 0:00:36
Average standard deviation of split frequencies: 0.013058
425500 -- [-1184.742] (-1185.446) (-1181.733) (-1181.596) * [-1182.020] (-1184.951) (-1184.355) (-1181.602) -- 0:00:36
426000 -- (-1184.165) (-1183.803) [-1181.733] (-1181.089) * (-1182.020) (-1181.197) (-1188.433) [-1181.963] -- 0:00:36
426500 -- (-1182.337) (-1194.185) [-1183.781] (-1183.177) * (-1181.001) [-1181.199] (-1189.859) (-1186.729) -- 0:00:36
427000 -- (-1182.550) (-1185.059) (-1181.221) [-1183.333] * [-1183.982] (-1181.542) (-1182.996) (-1182.832) -- 0:00:36
427500 -- [-1184.069] (-1181.537) (-1181.188) (-1181.402) * [-1183.706] (-1180.767) (-1181.680) (-1183.409) -- 0:00:36
428000 -- (-1183.223) (-1181.129) [-1181.385] (-1180.730) * (-1183.564) (-1182.546) [-1183.370] (-1186.859) -- 0:00:36
428500 -- (-1185.823) (-1184.325) (-1185.401) [-1180.746] * [-1181.790] (-1182.835) (-1181.232) (-1181.695) -- 0:00:36
429000 -- (-1183.289) [-1183.751] (-1181.618) (-1181.794) * [-1180.523] (-1182.748) (-1184.119) (-1181.844) -- 0:00:35
429500 -- [-1184.635] (-1182.874) (-1182.297) (-1181.604) * (-1185.083) (-1182.946) (-1182.954) [-1181.962] -- 0:00:35
430000 -- (-1182.638) (-1181.873) (-1186.659) [-1181.821] * (-1181.746) [-1185.525] (-1182.366) (-1181.679) -- 0:00:35
Average standard deviation of split frequencies: 0.013884
430500 -- [-1182.865] (-1183.159) (-1183.960) (-1183.512) * [-1182.376] (-1183.629) (-1185.899) (-1182.487) -- 0:00:35
431000 -- [-1183.552] (-1182.100) (-1183.410) (-1186.222) * (-1184.454) (-1182.284) [-1183.082] (-1182.396) -- 0:00:35
431500 -- [-1182.936] (-1185.994) (-1181.080) (-1181.168) * [-1183.374] (-1184.041) (-1184.002) (-1182.741) -- 0:00:35
432000 -- (-1183.837) [-1183.999] (-1182.023) (-1182.592) * (-1184.268) [-1184.401] (-1181.874) (-1182.184) -- 0:00:35
432500 -- (-1182.111) (-1182.874) [-1182.193] (-1180.970) * (-1182.095) (-1181.893) (-1183.431) [-1181.744] -- 0:00:35
433000 -- (-1182.258) (-1181.289) [-1181.233] (-1181.387) * (-1182.108) (-1181.448) [-1180.891] (-1184.710) -- 0:00:35
433500 -- (-1182.628) (-1181.666) (-1187.991) [-1181.941] * (-1181.464) (-1184.411) (-1181.519) [-1183.868] -- 0:00:35
434000 -- (-1182.636) (-1181.821) (-1183.319) [-1182.441] * [-1182.882] (-1182.867) (-1186.257) (-1182.784) -- 0:00:35
434500 -- (-1181.403) [-1181.004] (-1184.777) (-1185.881) * [-1183.527] (-1183.634) (-1185.281) (-1185.342) -- 0:00:35
435000 -- [-1181.218] (-1181.173) (-1182.181) (-1187.209) * [-1181.828] (-1183.142) (-1183.481) (-1183.313) -- 0:00:35
Average standard deviation of split frequencies: 0.013600
435500 -- (-1182.913) [-1182.988] (-1183.249) (-1188.005) * (-1181.557) (-1181.928) [-1181.949] (-1183.196) -- 0:00:34
436000 -- [-1181.251] (-1181.180) (-1181.992) (-1185.795) * [-1183.162] (-1184.025) (-1183.899) (-1183.036) -- 0:00:34
436500 -- (-1182.820) [-1181.893] (-1180.965) (-1183.645) * [-1183.192] (-1182.833) (-1182.473) (-1183.197) -- 0:00:34
437000 -- [-1181.810] (-1181.102) (-1181.402) (-1181.994) * (-1184.701) [-1182.248] (-1182.764) (-1182.063) -- 0:00:34
437500 -- (-1182.447) (-1185.401) (-1185.774) [-1181.914] * [-1184.126] (-1184.513) (-1181.965) (-1181.279) -- 0:00:34
438000 -- (-1181.745) (-1184.475) (-1183.235) [-1183.351] * (-1185.400) (-1182.644) [-1183.000] (-1183.107) -- 0:00:34
438500 -- [-1181.982] (-1184.159) (-1183.295) (-1187.939) * (-1187.986) (-1181.313) (-1187.781) [-1182.191] -- 0:00:34
439000 -- (-1181.557) [-1181.265] (-1183.357) (-1185.273) * (-1182.991) (-1181.484) (-1183.671) [-1181.709] -- 0:00:34
439500 -- [-1182.470] (-1182.201) (-1181.307) (-1185.295) * (-1183.907) [-1181.426] (-1181.128) (-1182.409) -- 0:00:34
440000 -- (-1183.094) [-1183.038] (-1181.341) (-1184.077) * (-1181.410) (-1181.103) [-1183.799] (-1184.494) -- 0:00:35
Average standard deviation of split frequencies: 0.013400
440500 -- (-1183.495) (-1181.628) [-1181.315] (-1185.420) * (-1181.679) [-1181.886] (-1181.957) (-1189.586) -- 0:00:35
441000 -- [-1184.864] (-1182.627) (-1182.198) (-1186.865) * (-1183.703) [-1183.233] (-1183.443) (-1185.455) -- 0:00:35
441500 -- [-1183.859] (-1180.810) (-1185.152) (-1186.576) * (-1185.552) (-1186.688) (-1182.283) [-1185.655] -- 0:00:35
442000 -- (-1181.906) [-1180.684] (-1183.633) (-1186.573) * (-1183.012) [-1184.348] (-1181.684) (-1182.288) -- 0:00:35
442500 -- (-1181.872) (-1183.277) (-1187.627) [-1186.354] * [-1182.889] (-1186.436) (-1181.930) (-1183.568) -- 0:00:35
443000 -- (-1182.293) (-1182.035) (-1182.272) [-1183.081] * (-1183.211) [-1183.396] (-1182.164) (-1185.825) -- 0:00:35
443500 -- (-1183.196) [-1181.100] (-1183.281) (-1181.798) * (-1183.820) (-1180.852) (-1182.276) [-1190.359] -- 0:00:35
444000 -- (-1184.614) (-1180.907) (-1183.223) [-1181.034] * (-1182.526) [-1180.754] (-1193.830) (-1184.815) -- 0:00:35
444500 -- [-1182.473] (-1182.083) (-1183.010) (-1182.689) * (-1184.947) (-1182.350) [-1184.274] (-1185.224) -- 0:00:34
445000 -- (-1181.360) [-1184.447] (-1184.797) (-1182.044) * (-1181.415) [-1181.826] (-1184.843) (-1181.089) -- 0:00:34
Average standard deviation of split frequencies: 0.012850
445500 -- (-1181.225) (-1182.558) (-1186.595) [-1181.754] * [-1182.016] (-1182.115) (-1184.370) (-1184.075) -- 0:00:34
446000 -- (-1183.620) (-1182.407) (-1183.689) [-1182.060] * (-1183.038) [-1181.590] (-1184.653) (-1180.980) -- 0:00:34
446500 -- (-1185.860) (-1180.940) [-1183.951] (-1184.759) * (-1184.487) [-1182.516] (-1183.958) (-1181.511) -- 0:00:34
447000 -- (-1184.458) (-1181.940) (-1182.509) [-1183.637] * (-1184.555) [-1181.209] (-1181.772) (-1181.713) -- 0:00:34
447500 -- (-1181.628) (-1182.637) [-1186.062] (-1181.298) * [-1185.186] (-1183.294) (-1184.617) (-1182.653) -- 0:00:34
448000 -- [-1181.731] (-1181.257) (-1185.534) (-1183.305) * (-1186.299) (-1185.018) [-1183.709] (-1181.988) -- 0:00:34
448500 -- [-1182.782] (-1182.357) (-1182.562) (-1182.380) * (-1182.648) [-1181.355] (-1182.849) (-1187.033) -- 0:00:34
449000 -- [-1186.138] (-1182.775) (-1183.767) (-1183.869) * [-1184.412] (-1181.181) (-1182.534) (-1181.107) -- 0:00:34
449500 -- (-1183.108) (-1183.091) (-1183.721) [-1185.249] * (-1183.915) [-1182.459] (-1180.963) (-1183.679) -- 0:00:34
450000 -- (-1183.142) (-1185.388) (-1182.959) [-1182.969] * (-1182.399) (-1182.526) [-1181.577] (-1184.796) -- 0:00:34
Average standard deviation of split frequencies: 0.012332
450500 -- (-1181.275) (-1181.792) [-1182.158] (-1183.283) * (-1183.371) [-1182.165] (-1181.966) (-1183.406) -- 0:00:34
451000 -- (-1180.942) [-1180.519] (-1182.822) (-1182.958) * (-1183.391) (-1181.726) [-1181.073] (-1182.542) -- 0:00:34
451500 -- (-1181.459) (-1180.938) [-1182.324] (-1182.360) * (-1186.131) [-1181.725] (-1181.378) (-1183.722) -- 0:00:34
452000 -- (-1180.835) [-1180.901] (-1182.962) (-1182.973) * (-1186.397) (-1183.953) [-1183.247] (-1181.851) -- 0:00:33
452500 -- (-1186.325) (-1183.050) [-1183.199] (-1183.317) * (-1180.892) [-1182.151] (-1182.722) (-1181.843) -- 0:00:33
453000 -- [-1185.461] (-1189.492) (-1183.856) (-1184.602) * (-1181.778) [-1184.188] (-1185.791) (-1183.121) -- 0:00:33
453500 -- (-1185.664) (-1181.806) (-1183.087) [-1182.216] * [-1182.971] (-1182.742) (-1181.622) (-1181.784) -- 0:00:33
454000 -- (-1184.724) (-1184.695) (-1181.659) [-1181.932] * [-1182.815] (-1184.215) (-1181.003) (-1181.451) -- 0:00:33
454500 -- (-1183.095) (-1182.057) (-1182.921) [-1182.624] * (-1182.929) (-1188.179) [-1182.668] (-1183.556) -- 0:00:33
455000 -- (-1181.506) (-1182.499) (-1184.880) [-1185.814] * (-1185.360) (-1185.003) (-1184.458) [-1182.170] -- 0:00:33
Average standard deviation of split frequencies: 0.011752
455500 -- (-1182.407) (-1187.774) (-1185.685) [-1180.849] * (-1182.675) (-1185.605) [-1183.145] (-1180.801) -- 0:00:33
456000 -- [-1182.953] (-1184.702) (-1180.764) (-1183.594) * (-1181.436) (-1182.841) (-1182.088) [-1180.898] -- 0:00:34
456500 -- (-1185.511) (-1183.975) (-1182.535) [-1182.532] * (-1187.604) (-1184.951) [-1182.309] (-1180.948) -- 0:00:34
457000 -- (-1185.911) [-1181.542] (-1182.314) (-1184.431) * [-1184.634] (-1186.910) (-1182.602) (-1182.395) -- 0:00:34
457500 -- (-1185.621) [-1182.329] (-1182.317) (-1182.025) * (-1184.906) (-1183.016) (-1184.921) [-1182.398] -- 0:00:34
458000 -- [-1182.091] (-1182.150) (-1183.764) (-1182.023) * (-1182.301) (-1184.263) [-1184.018] (-1182.146) -- 0:00:34
458500 -- (-1183.248) (-1184.400) (-1182.235) [-1183.651] * (-1182.642) (-1181.919) (-1180.859) [-1183.766] -- 0:00:34
459000 -- (-1182.633) (-1183.475) (-1185.809) [-1180.672] * (-1184.185) (-1180.874) [-1184.056] (-1185.959) -- 0:00:34
459500 -- (-1183.344) (-1181.787) (-1181.729) [-1180.675] * (-1182.696) [-1181.035] (-1188.858) (-1182.797) -- 0:00:34
460000 -- (-1183.941) (-1181.381) (-1182.140) [-1180.485] * (-1181.374) (-1184.562) (-1183.959) [-1183.459] -- 0:00:34
Average standard deviation of split frequencies: 0.012334
460500 -- (-1183.074) [-1183.972] (-1181.718) (-1183.795) * (-1181.856) (-1181.983) (-1182.772) [-1183.744] -- 0:00:33
461000 -- (-1182.847) (-1184.331) (-1183.591) [-1181.459] * (-1182.683) (-1181.964) [-1182.896] (-1185.902) -- 0:00:33
461500 -- (-1181.546) [-1184.664] (-1185.708) (-1185.076) * (-1180.716) [-1184.189] (-1182.262) (-1184.020) -- 0:00:33
462000 -- (-1181.776) [-1185.671] (-1185.884) (-1184.010) * (-1184.755) (-1181.192) [-1184.091] (-1184.728) -- 0:00:33
462500 -- (-1181.976) [-1185.882] (-1186.879) (-1181.958) * (-1184.024) (-1182.382) (-1183.466) [-1185.091] -- 0:00:33
463000 -- (-1183.840) (-1184.238) (-1185.984) [-1184.110] * [-1183.657] (-1184.731) (-1186.916) (-1183.829) -- 0:00:33
463500 -- [-1184.822] (-1183.979) (-1187.479) (-1186.224) * [-1182.716] (-1183.529) (-1183.020) (-1184.052) -- 0:00:33
464000 -- [-1183.236] (-1183.587) (-1182.084) (-1183.605) * (-1181.406) (-1181.815) (-1181.676) [-1181.087] -- 0:00:33
464500 -- [-1183.079] (-1181.379) (-1181.945) (-1183.830) * (-1184.244) [-1181.418] (-1181.098) (-1183.643) -- 0:00:33
465000 -- [-1181.720] (-1181.488) (-1186.598) (-1186.287) * (-1183.230) [-1181.127] (-1185.404) (-1181.631) -- 0:00:33
Average standard deviation of split frequencies: 0.012033
465500 -- (-1182.970) [-1181.384] (-1184.776) (-1183.087) * (-1182.341) (-1186.834) [-1184.597] (-1183.718) -- 0:00:33
466000 -- (-1182.668) (-1181.971) [-1185.646] (-1182.919) * (-1181.965) [-1184.917] (-1181.426) (-1183.350) -- 0:00:33
466500 -- [-1182.186] (-1181.807) (-1184.464) (-1181.198) * [-1181.965] (-1184.450) (-1184.303) (-1185.691) -- 0:00:33
467000 -- (-1186.435) [-1182.618] (-1182.209) (-1181.273) * (-1183.315) [-1182.483] (-1187.418) (-1181.427) -- 0:00:33
467500 -- (-1184.503) (-1183.782) [-1181.438] (-1182.506) * (-1187.159) (-1181.324) (-1185.602) [-1187.077] -- 0:00:33
468000 -- (-1186.418) [-1182.263] (-1183.370) (-1182.351) * (-1182.446) (-1182.591) (-1182.127) [-1183.223] -- 0:00:32
468500 -- [-1182.024] (-1183.720) (-1184.375) (-1182.908) * (-1182.683) [-1182.169] (-1184.145) (-1181.584) -- 0:00:32
469000 -- [-1180.961] (-1183.480) (-1185.505) (-1185.066) * (-1182.937) (-1184.546) (-1185.168) [-1182.250] -- 0:00:32
469500 -- (-1181.091) [-1181.335] (-1184.280) (-1184.412) * (-1181.443) (-1186.027) [-1181.851] (-1182.271) -- 0:00:32
470000 -- (-1183.728) (-1186.424) [-1181.340] (-1185.693) * [-1184.913] (-1184.995) (-1182.649) (-1182.794) -- 0:00:32
Average standard deviation of split frequencies: 0.011544
470500 -- (-1182.490) (-1185.069) (-1185.128) [-1180.805] * (-1182.513) (-1183.509) (-1187.099) [-1184.342] -- 0:00:32
471000 -- (-1181.368) (-1182.624) (-1188.254) [-1181.393] * (-1186.236) (-1181.356) [-1181.850] (-1182.077) -- 0:00:32
471500 -- (-1180.957) (-1182.443) [-1186.407] (-1181.382) * [-1180.945] (-1181.884) (-1183.610) (-1182.528) -- 0:00:32
472000 -- (-1180.788) [-1182.233] (-1183.894) (-1181.411) * (-1183.715) (-1181.157) (-1183.064) [-1182.267] -- 0:00:33
472500 -- [-1182.480] (-1184.159) (-1185.933) (-1184.774) * (-1183.214) (-1183.375) (-1185.449) [-1181.643] -- 0:00:33
473000 -- [-1182.049] (-1181.109) (-1183.407) (-1183.382) * (-1188.103) (-1182.427) (-1185.511) [-1181.410] -- 0:00:33
473500 -- (-1182.024) (-1181.194) [-1181.149] (-1183.301) * (-1184.673) (-1184.858) [-1181.758] (-1182.888) -- 0:00:33
474000 -- [-1183.061] (-1182.723) (-1182.151) (-1180.893) * (-1181.998) (-1184.098) (-1182.911) [-1182.388] -- 0:00:33
474500 -- [-1181.839] (-1186.474) (-1182.098) (-1181.501) * (-1180.799) [-1181.647] (-1182.916) (-1181.735) -- 0:00:33
475000 -- (-1182.097) (-1181.135) [-1180.815] (-1184.306) * (-1180.780) (-1181.710) (-1185.946) [-1182.292] -- 0:00:33
Average standard deviation of split frequencies: 0.010839
475500 -- (-1184.853) (-1180.589) [-1182.647] (-1184.871) * (-1180.689) [-1182.303] (-1181.103) (-1184.351) -- 0:00:33
476000 -- (-1181.222) [-1180.406] (-1184.653) (-1184.740) * (-1186.250) (-1184.298) (-1180.702) [-1181.633] -- 0:00:33
476500 -- (-1182.469) (-1180.478) (-1185.181) [-1182.300] * [-1184.815] (-1185.289) (-1180.494) (-1181.348) -- 0:00:32
477000 -- (-1180.687) (-1181.096) (-1184.381) [-1184.326] * (-1183.564) [-1184.445] (-1183.789) (-1181.189) -- 0:00:32
477500 -- [-1181.394] (-1183.805) (-1180.782) (-1184.793) * (-1186.243) [-1183.249] (-1183.597) (-1184.369) -- 0:00:32
478000 -- (-1181.716) (-1183.335) (-1183.049) [-1181.826] * (-1181.601) (-1186.308) [-1182.658] (-1182.026) -- 0:00:32
478500 -- (-1184.796) (-1180.909) (-1184.783) [-1182.461] * [-1181.588] (-1183.834) (-1181.322) (-1184.411) -- 0:00:32
479000 -- (-1185.589) (-1181.668) (-1183.284) [-1182.217] * [-1182.919] (-1187.196) (-1181.209) (-1182.939) -- 0:00:32
479500 -- [-1181.390] (-1187.641) (-1184.486) (-1182.808) * (-1183.521) (-1184.431) (-1182.801) [-1182.508] -- 0:00:32
480000 -- [-1184.686] (-1183.174) (-1186.707) (-1186.087) * [-1181.957] (-1182.334) (-1183.453) (-1181.582) -- 0:00:32
Average standard deviation of split frequencies: 0.010846
480500 -- (-1181.720) [-1182.337] (-1185.808) (-1183.093) * (-1180.574) (-1181.471) (-1182.816) [-1181.014] -- 0:00:32
481000 -- [-1182.596] (-1181.905) (-1189.711) (-1181.906) * (-1181.040) (-1184.520) [-1184.773] (-1182.414) -- 0:00:32
481500 -- [-1182.402] (-1185.354) (-1187.462) (-1184.930) * (-1182.284) (-1186.166) (-1182.028) [-1182.821] -- 0:00:32
482000 -- [-1182.721] (-1184.186) (-1182.468) (-1181.217) * (-1185.671) (-1183.599) [-1187.786] (-1185.082) -- 0:00:32
482500 -- (-1186.138) [-1181.650] (-1186.572) (-1182.630) * (-1183.510) [-1185.761] (-1184.490) (-1182.965) -- 0:00:32
483000 -- (-1185.160) [-1182.897] (-1185.174) (-1186.451) * (-1183.452) (-1181.695) [-1182.527] (-1181.592) -- 0:00:32
483500 -- (-1183.964) [-1182.661] (-1183.437) (-1182.492) * [-1182.991] (-1181.038) (-1189.506) (-1184.359) -- 0:00:32
484000 -- [-1182.288] (-1182.492) (-1184.825) (-1182.660) * [-1184.177] (-1181.570) (-1184.634) (-1183.127) -- 0:00:31
484500 -- (-1184.351) [-1184.353] (-1181.670) (-1192.246) * (-1181.680) [-1184.444] (-1191.361) (-1184.119) -- 0:00:31
485000 -- (-1182.933) [-1180.680] (-1183.516) (-1183.260) * (-1183.727) (-1182.304) [-1182.604] (-1184.279) -- 0:00:31
Average standard deviation of split frequencies: 0.010498
485500 -- (-1184.684) [-1183.872] (-1184.275) (-1183.699) * (-1181.347) (-1182.256) [-1182.757] (-1182.371) -- 0:00:31
486000 -- (-1181.754) (-1181.412) (-1186.089) [-1183.799] * (-1180.376) (-1183.284) (-1182.171) [-1181.832] -- 0:00:31
486500 -- (-1182.405) [-1180.762] (-1182.188) (-1183.751) * (-1180.895) [-1181.551] (-1183.243) (-1183.290) -- 0:00:31
487000 -- (-1186.708) (-1182.062) (-1182.733) [-1182.303] * (-1181.269) (-1181.035) (-1183.130) [-1182.166] -- 0:00:31
487500 -- (-1183.530) [-1181.885] (-1183.080) (-1182.236) * (-1181.169) (-1188.650) (-1181.930) [-1183.604] -- 0:00:31
488000 -- [-1181.299] (-1186.550) (-1182.071) (-1180.401) * (-1182.704) (-1181.825) [-1181.962] (-1180.840) -- 0:00:32
488500 -- [-1183.241] (-1182.714) (-1183.847) (-1182.251) * [-1183.314] (-1181.897) (-1181.966) (-1185.080) -- 0:00:32
489000 -- (-1183.407) (-1182.470) (-1186.095) [-1181.704] * (-1181.184) [-1180.984] (-1181.358) (-1183.111) -- 0:00:32
489500 -- (-1184.808) (-1182.614) (-1183.898) [-1181.508] * (-1183.132) (-1183.268) (-1181.665) [-1182.312] -- 0:00:32
490000 -- (-1185.670) [-1180.991] (-1182.533) (-1181.784) * [-1187.862] (-1183.529) (-1182.433) (-1185.638) -- 0:00:32
Average standard deviation of split frequencies: 0.010060
490500 -- (-1182.810) [-1182.616] (-1182.811) (-1181.646) * (-1183.468) (-1182.570) (-1181.770) [-1184.157] -- 0:00:32
491000 -- [-1186.893] (-1182.693) (-1182.081) (-1181.027) * [-1184.803] (-1181.736) (-1181.093) (-1184.001) -- 0:00:32
491500 -- (-1182.571) [-1182.077] (-1182.693) (-1181.097) * (-1186.174) (-1181.984) (-1181.609) [-1183.366] -- 0:00:32
492000 -- (-1185.459) [-1181.234] (-1184.166) (-1184.010) * (-1183.676) (-1181.925) (-1182.067) [-1183.177] -- 0:00:32
492500 -- (-1186.944) [-1181.138] (-1182.509) (-1180.836) * (-1181.405) (-1189.382) [-1181.437] (-1184.163) -- 0:00:31
493000 -- [-1180.737] (-1183.959) (-1182.287) (-1182.081) * (-1182.069) [-1187.815] (-1182.888) (-1183.881) -- 0:00:31
493500 -- (-1182.448) (-1182.228) [-1183.779] (-1182.386) * (-1182.027) (-1184.238) (-1182.743) [-1182.961] -- 0:00:31
494000 -- (-1181.262) (-1181.482) (-1183.479) [-1186.442] * (-1182.834) [-1181.427] (-1183.502) (-1182.566) -- 0:00:31
494500 -- (-1185.151) [-1181.976] (-1186.847) (-1181.552) * (-1186.972) (-1183.036) (-1181.320) [-1180.620] -- 0:00:31
495000 -- [-1182.363] (-1181.405) (-1188.705) (-1184.607) * (-1184.290) (-1183.626) [-1181.312] (-1182.376) -- 0:00:31
Average standard deviation of split frequencies: 0.010231
495500 -- (-1181.404) [-1181.116] (-1181.756) (-1186.496) * [-1185.196] (-1185.184) (-1181.200) (-1183.303) -- 0:00:31
496000 -- (-1183.566) (-1182.141) (-1181.893) [-1181.814] * [-1182.565] (-1183.096) (-1184.380) (-1182.724) -- 0:00:31
496500 -- (-1182.445) [-1181.680] (-1183.345) (-1181.020) * (-1180.711) (-1181.671) [-1184.523] (-1181.390) -- 0:00:31
497000 -- [-1183.030] (-1182.875) (-1184.709) (-1184.725) * (-1181.059) [-1183.156] (-1181.829) (-1180.988) -- 0:00:31
497500 -- (-1183.352) (-1184.498) (-1181.999) [-1181.852] * (-1181.126) (-1182.220) [-1181.870] (-1181.467) -- 0:00:31
498000 -- [-1183.137] (-1182.503) (-1183.370) (-1181.664) * (-1182.541) [-1181.809] (-1187.150) (-1183.152) -- 0:00:31
498500 -- (-1181.499) (-1186.119) (-1183.231) [-1181.920] * [-1181.732] (-1181.542) (-1181.804) (-1182.366) -- 0:00:31
499000 -- (-1186.951) [-1180.631] (-1182.715) (-1181.817) * [-1180.912] (-1181.807) (-1181.967) (-1180.667) -- 0:00:31
499500 -- [-1181.190] (-1181.345) (-1182.926) (-1181.748) * (-1180.718) [-1183.163] (-1181.320) (-1186.615) -- 0:00:31
500000 -- (-1185.314) (-1186.722) [-1182.230] (-1181.240) * (-1181.841) [-1183.816] (-1184.999) (-1182.337) -- 0:00:31
Average standard deviation of split frequencies: 0.010357
500500 -- [-1184.167] (-1185.355) (-1185.654) (-1185.274) * (-1186.978) (-1181.146) [-1182.777] (-1182.221) -- 0:00:30
501000 -- (-1184.508) (-1187.723) [-1187.194] (-1183.571) * (-1185.679) [-1180.772] (-1180.664) (-1182.595) -- 0:00:30
501500 -- (-1184.435) (-1186.008) [-1181.265] (-1184.218) * (-1182.583) [-1181.427] (-1181.143) (-1181.524) -- 0:00:30
502000 -- [-1184.316] (-1181.495) (-1181.156) (-1181.795) * (-1182.885) (-1181.650) [-1181.789] (-1184.777) -- 0:00:30
502500 -- (-1185.032) [-1181.665] (-1183.463) (-1180.748) * (-1184.608) (-1181.159) [-1182.332] (-1180.895) -- 0:00:30
503000 -- [-1182.311] (-1186.224) (-1182.919) (-1180.748) * (-1183.069) [-1182.352] (-1182.378) (-1182.374) -- 0:00:30
503500 -- (-1182.276) [-1184.070] (-1181.052) (-1181.463) * (-1183.690) [-1183.347] (-1182.499) (-1182.924) -- 0:00:30
504000 -- (-1182.587) (-1184.054) (-1183.073) [-1180.459] * (-1180.665) (-1189.669) (-1182.455) [-1181.773] -- 0:00:31
504500 -- (-1184.175) [-1183.139] (-1181.774) (-1182.884) * (-1182.293) (-1183.487) (-1180.512) [-1183.033] -- 0:00:31
505000 -- (-1183.077) (-1182.582) [-1182.423] (-1182.603) * (-1184.783) (-1182.195) (-1184.805) [-1182.743] -- 0:00:31
Average standard deviation of split frequencies: 0.010196
505500 -- [-1185.404] (-1181.858) (-1185.284) (-1182.005) * (-1183.548) [-1181.928] (-1185.152) (-1183.900) -- 0:00:31
506000 -- (-1185.034) (-1183.502) [-1183.492] (-1185.742) * (-1181.294) [-1182.356] (-1182.258) (-1184.031) -- 0:00:31
506500 -- (-1181.440) [-1181.941] (-1180.980) (-1182.813) * (-1182.066) (-1183.890) (-1182.462) [-1181.960] -- 0:00:31
507000 -- (-1181.084) (-1182.606) [-1181.565] (-1182.168) * (-1182.771) (-1181.040) (-1182.291) [-1182.400] -- 0:00:31
507500 -- (-1183.036) (-1181.454) [-1181.848] (-1181.600) * (-1181.657) [-1180.677] (-1183.277) (-1186.460) -- 0:00:31
508000 -- [-1181.490] (-1181.934) (-1187.353) (-1182.129) * (-1182.300) [-1182.337] (-1183.719) (-1187.768) -- 0:00:30
508500 -- (-1182.897) (-1180.664) [-1183.186] (-1181.986) * (-1180.625) (-1184.160) [-1183.147] (-1184.042) -- 0:00:30
509000 -- [-1182.602] (-1181.830) (-1186.621) (-1182.744) * [-1180.877] (-1184.405) (-1183.293) (-1185.317) -- 0:00:30
509500 -- (-1186.173) [-1182.222] (-1182.436) (-1184.143) * (-1183.627) [-1181.399] (-1182.352) (-1182.607) -- 0:00:30
510000 -- [-1187.074] (-1182.286) (-1180.735) (-1182.273) * (-1183.240) [-1181.381] (-1181.874) (-1181.619) -- 0:00:30
Average standard deviation of split frequencies: 0.010643
510500 -- (-1190.901) (-1184.602) (-1183.958) [-1185.503] * [-1180.857] (-1181.414) (-1182.030) (-1182.293) -- 0:00:30
511000 -- (-1182.409) (-1183.659) [-1181.724] (-1188.839) * (-1183.328) [-1181.366] (-1191.790) (-1182.369) -- 0:00:30
511500 -- (-1183.299) (-1187.131) (-1181.141) [-1181.425] * (-1182.077) (-1181.452) [-1184.770] (-1185.481) -- 0:00:30
512000 -- (-1181.038) [-1184.387] (-1183.721) (-1181.547) * (-1181.846) (-1181.163) (-1189.867) [-1184.843] -- 0:00:30
512500 -- (-1181.669) (-1180.643) [-1182.212] (-1180.881) * (-1182.199) [-1182.787] (-1185.704) (-1181.232) -- 0:00:30
513000 -- (-1184.141) [-1181.923] (-1183.077) (-1181.768) * [-1182.245] (-1184.198) (-1184.689) (-1182.985) -- 0:00:30
513500 -- (-1185.515) (-1181.497) [-1183.378] (-1183.819) * (-1181.092) (-1183.717) (-1181.690) [-1184.098] -- 0:00:30
514000 -- [-1182.273] (-1181.286) (-1184.126) (-1185.656) * (-1181.020) (-1183.024) (-1184.217) [-1182.366] -- 0:00:30
514500 -- (-1181.036) (-1184.817) [-1182.362] (-1181.093) * [-1183.865] (-1181.747) (-1183.416) (-1190.104) -- 0:00:30
515000 -- (-1181.541) [-1182.428] (-1182.736) (-1181.090) * (-1184.457) [-1181.205] (-1182.006) (-1185.413) -- 0:00:30
Average standard deviation of split frequencies: 0.010049
515500 -- (-1182.176) (-1183.267) [-1182.693] (-1181.090) * (-1188.219) (-1180.365) (-1181.427) [-1183.744] -- 0:00:30
516000 -- (-1183.771) (-1182.969) (-1181.883) [-1182.023] * (-1182.560) [-1181.676] (-1181.779) (-1181.839) -- 0:00:30
516500 -- (-1184.348) [-1186.431] (-1183.171) (-1181.005) * (-1184.895) [-1180.756] (-1188.059) (-1183.443) -- 0:00:29
517000 -- (-1182.775) (-1185.554) (-1186.738) [-1180.655] * (-1181.055) (-1181.407) [-1183.191] (-1184.392) -- 0:00:29
517500 -- [-1184.006] (-1182.298) (-1185.691) (-1180.793) * (-1182.985) [-1184.458] (-1181.733) (-1185.672) -- 0:00:29
518000 -- (-1183.711) (-1183.685) [-1182.972] (-1180.642) * (-1181.500) (-1183.163) (-1181.502) [-1189.813] -- 0:00:29
518500 -- (-1183.869) (-1183.685) [-1182.029] (-1182.127) * (-1182.684) (-1183.838) [-1182.485] (-1187.081) -- 0:00:29
519000 -- (-1183.260) (-1184.847) (-1184.167) [-1183.710] * (-1182.597) [-1181.515] (-1181.451) (-1181.227) -- 0:00:29
519500 -- (-1184.542) (-1184.332) (-1183.086) [-1183.800] * (-1185.356) [-1186.820] (-1181.356) (-1182.076) -- 0:00:29
520000 -- (-1184.200) [-1185.656] (-1185.246) (-1184.797) * (-1184.190) (-1183.056) [-1181.274] (-1182.633) -- 0:00:29
Average standard deviation of split frequencies: 0.010545
520500 -- (-1183.873) (-1183.101) [-1182.133] (-1185.395) * [-1182.283] (-1181.033) (-1184.829) (-1184.000) -- 0:00:30
521000 -- (-1184.641) (-1182.504) [-1181.091] (-1183.361) * (-1181.336) (-1183.453) [-1181.531] (-1184.622) -- 0:00:30
521500 -- (-1186.004) (-1184.721) [-1181.479] (-1183.970) * (-1181.620) (-1184.486) (-1184.335) [-1183.746] -- 0:00:30
522000 -- (-1182.342) (-1181.887) (-1180.980) [-1181.437] * (-1183.668) (-1182.667) (-1186.889) [-1182.791] -- 0:00:30
522500 -- (-1183.512) (-1183.010) [-1184.907] (-1182.808) * (-1181.562) (-1183.098) (-1181.833) [-1181.806] -- 0:00:30
523000 -- (-1181.193) [-1183.330] (-1187.088) (-1186.924) * (-1186.583) (-1183.491) [-1182.868] (-1183.367) -- 0:00:30
523500 -- (-1185.210) (-1182.947) [-1183.807] (-1184.916) * (-1180.585) (-1184.038) [-1181.983] (-1182.773) -- 0:00:30
524000 -- (-1185.516) (-1183.476) (-1185.223) [-1183.788] * (-1182.460) (-1181.697) (-1183.134) [-1182.694] -- 0:00:29
524500 -- (-1183.170) [-1182.134] (-1182.384) (-1183.979) * (-1187.126) (-1184.879) (-1184.120) [-1184.100] -- 0:00:29
525000 -- (-1181.323) (-1182.171) (-1180.952) [-1186.970] * (-1182.225) (-1183.229) [-1181.760] (-1182.521) -- 0:00:29
Average standard deviation of split frequencies: 0.009808
525500 -- [-1181.995] (-1182.637) (-1181.388) (-1186.032) * (-1183.633) (-1181.572) [-1185.263] (-1182.751) -- 0:00:29
526000 -- (-1180.590) (-1181.923) [-1182.189] (-1185.209) * (-1191.236) (-1182.031) (-1181.948) [-1182.877] -- 0:00:29
526500 -- (-1180.998) (-1181.984) (-1183.105) [-1181.340] * [-1182.023] (-1184.261) (-1184.972) (-1182.267) -- 0:00:29
527000 -- (-1180.491) (-1182.226) (-1182.008) [-1186.638] * [-1181.377] (-1181.437) (-1184.830) (-1186.039) -- 0:00:29
527500 -- (-1181.286) (-1182.082) [-1182.007] (-1183.672) * (-1185.457) (-1182.023) (-1185.459) [-1181.760] -- 0:00:29
528000 -- (-1182.074) (-1182.917) (-1180.965) [-1181.214] * (-1182.492) (-1182.700) [-1182.430] (-1181.454) -- 0:00:29
528500 -- (-1182.631) (-1183.188) (-1181.794) [-1182.123] * (-1184.184) [-1182.112] (-1184.665) (-1181.893) -- 0:00:29
529000 -- (-1186.220) [-1181.587] (-1181.153) (-1183.097) * (-1181.441) (-1182.408) (-1182.037) [-1181.790] -- 0:00:29
529500 -- [-1181.804] (-1181.067) (-1181.077) (-1181.843) * (-1180.975) [-1181.052] (-1182.935) (-1182.188) -- 0:00:29
530000 -- (-1184.193) (-1181.962) [-1183.014] (-1182.622) * [-1183.896] (-1181.316) (-1183.291) (-1181.828) -- 0:00:29
Average standard deviation of split frequencies: 0.009624
530500 -- (-1181.503) [-1182.580] (-1182.486) (-1184.061) * (-1182.670) (-1184.662) [-1187.544] (-1182.194) -- 0:00:29
531000 -- [-1182.607] (-1181.802) (-1183.798) (-1185.109) * [-1183.875] (-1181.313) (-1182.460) (-1184.998) -- 0:00:29
531500 -- (-1182.854) (-1182.672) (-1183.277) [-1186.046] * (-1185.954) (-1184.155) [-1180.417] (-1186.528) -- 0:00:29
532000 -- (-1183.772) (-1182.036) [-1181.044] (-1181.119) * (-1185.641) (-1181.429) [-1180.714] (-1184.184) -- 0:00:29
532500 -- (-1185.795) (-1182.847) [-1181.131] (-1181.138) * (-1185.819) [-1183.982] (-1181.645) (-1182.143) -- 0:00:28
533000 -- [-1182.739] (-1183.784) (-1182.284) (-1182.654) * (-1186.325) [-1182.780] (-1181.539) (-1182.394) -- 0:00:28
533500 -- [-1183.102] (-1183.161) (-1188.060) (-1182.654) * (-1181.656) (-1184.395) (-1181.237) [-1182.503] -- 0:00:28
534000 -- (-1185.358) (-1183.994) [-1183.622] (-1182.388) * (-1183.708) (-1182.726) (-1182.070) [-1185.887] -- 0:00:28
534500 -- (-1182.562) [-1182.806] (-1182.761) (-1181.841) * (-1182.057) (-1182.832) (-1181.878) [-1184.061] -- 0:00:28
535000 -- (-1189.179) (-1186.769) [-1183.508] (-1181.432) * (-1182.216) (-1182.847) [-1181.093] (-1185.383) -- 0:00:28
Average standard deviation of split frequencies: 0.009528
535500 -- (-1181.698) (-1184.713) [-1181.650] (-1183.589) * (-1181.666) [-1182.841] (-1182.126) (-1186.283) -- 0:00:28
536000 -- (-1182.826) (-1181.634) [-1182.469] (-1185.318) * (-1181.757) [-1182.505] (-1180.998) (-1184.163) -- 0:00:28
536500 -- (-1185.723) [-1180.997] (-1182.025) (-1182.432) * (-1181.574) (-1182.814) (-1186.258) [-1183.457] -- 0:00:29
537000 -- [-1184.886] (-1182.686) (-1182.246) (-1182.773) * (-1181.485) (-1180.513) [-1185.417] (-1183.296) -- 0:00:29
537500 -- (-1185.445) [-1182.595] (-1188.005) (-1183.059) * (-1181.275) (-1183.537) (-1184.103) [-1185.918] -- 0:00:29
538000 -- (-1186.106) (-1182.876) (-1185.104) [-1183.656] * (-1181.796) (-1181.691) (-1181.939) [-1186.651] -- 0:00:29
538500 -- (-1183.151) (-1188.219) (-1182.838) [-1181.806] * [-1182.874] (-1185.151) (-1183.845) (-1183.263) -- 0:00:29
539000 -- (-1183.909) (-1186.873) [-1181.919] (-1182.179) * (-1183.319) (-1182.166) [-1183.108] (-1184.480) -- 0:00:29
539500 -- (-1181.265) [-1184.692] (-1183.058) (-1181.736) * (-1183.666) (-1181.777) [-1181.046] (-1182.582) -- 0:00:29
540000 -- (-1180.803) [-1182.452] (-1183.472) (-1182.936) * (-1187.467) (-1180.709) [-1181.575] (-1185.704) -- 0:00:28
Average standard deviation of split frequencies: 0.009334
540500 -- (-1187.875) (-1182.308) (-1182.672) [-1181.019] * (-1182.550) (-1181.758) (-1181.875) [-1185.828] -- 0:00:28
541000 -- (-1183.167) (-1181.468) (-1181.735) [-1182.053] * (-1186.824) (-1182.837) [-1182.183] (-1184.448) -- 0:00:28
541500 -- [-1184.389] (-1181.272) (-1181.246) (-1188.236) * (-1182.241) (-1185.147) [-1182.207] (-1184.917) -- 0:00:28
542000 -- [-1184.696] (-1181.546) (-1183.722) (-1188.392) * (-1181.233) (-1185.019) [-1183.559] (-1182.744) -- 0:00:28
542500 -- (-1182.935) [-1183.629] (-1183.812) (-1186.032) * (-1181.330) [-1184.779] (-1182.649) (-1180.913) -- 0:00:28
543000 -- [-1182.656] (-1184.953) (-1184.155) (-1189.797) * (-1185.351) [-1182.211] (-1185.636) (-1180.467) -- 0:00:28
543500 -- [-1181.808] (-1183.923) (-1184.591) (-1185.648) * [-1182.595] (-1184.646) (-1183.509) (-1180.767) -- 0:00:28
544000 -- (-1183.155) (-1183.197) (-1181.365) [-1182.348] * (-1181.417) (-1183.324) (-1183.060) [-1183.920] -- 0:00:28
544500 -- (-1182.891) (-1182.773) (-1181.392) [-1183.566] * (-1185.527) (-1182.014) (-1185.261) [-1186.181] -- 0:00:28
545000 -- [-1185.527] (-1187.218) (-1183.034) (-1181.643) * (-1181.494) [-1181.361] (-1183.729) (-1187.076) -- 0:00:28
Average standard deviation of split frequencies: 0.010208
545500 -- [-1181.960] (-1183.991) (-1180.977) (-1184.135) * (-1182.772) (-1185.035) (-1183.703) [-1183.864] -- 0:00:28
546000 -- (-1185.442) (-1182.473) [-1180.888] (-1183.018) * (-1185.864) [-1182.778] (-1180.794) (-1182.134) -- 0:00:28
546500 -- (-1182.521) [-1186.933] (-1182.835) (-1184.679) * (-1185.989) (-1181.188) [-1181.167] (-1182.740) -- 0:00:28
547000 -- [-1180.792] (-1188.192) (-1183.333) (-1181.048) * (-1182.679) [-1182.552] (-1183.096) (-1183.724) -- 0:00:28
547500 -- [-1183.753] (-1185.819) (-1183.310) (-1184.282) * (-1181.380) (-1182.389) (-1181.639) [-1183.619] -- 0:00:28
548000 -- (-1181.976) (-1182.987) [-1180.919] (-1184.713) * (-1183.422) [-1181.978] (-1183.076) (-1182.157) -- 0:00:28
548500 -- (-1188.266) (-1182.419) (-1182.503) [-1183.197] * (-1181.126) (-1181.746) [-1186.197] (-1183.166) -- 0:00:27
549000 -- [-1182.815] (-1187.101) (-1185.393) (-1181.659) * [-1184.518] (-1183.072) (-1182.040) (-1183.792) -- 0:00:27
549500 -- (-1182.247) [-1180.887] (-1181.196) (-1183.262) * (-1182.564) (-1182.255) [-1181.030] (-1185.123) -- 0:00:27
550000 -- (-1184.125) (-1183.599) (-1184.282) [-1182.246] * (-1182.061) (-1184.739) (-1184.184) [-1184.963] -- 0:00:27
Average standard deviation of split frequencies: 0.009971
550500 -- (-1186.068) (-1183.378) (-1181.628) [-1182.538] * (-1188.717) (-1181.544) [-1183.692] (-1184.065) -- 0:00:27
551000 -- (-1182.593) (-1181.809) (-1181.784) [-1181.118] * [-1186.732] (-1180.647) (-1182.818) (-1186.481) -- 0:00:27
551500 -- (-1186.757) (-1183.219) [-1183.422] (-1182.850) * (-1183.604) (-1182.767) [-1180.434] (-1185.313) -- 0:00:27
552000 -- (-1184.620) [-1181.843] (-1182.701) (-1182.785) * (-1182.610) [-1181.219] (-1180.883) (-1184.239) -- 0:00:27
552500 -- (-1182.050) [-1180.777] (-1183.352) (-1182.196) * (-1182.401) (-1181.069) (-1180.883) [-1181.144] -- 0:00:28
553000 -- (-1182.854) (-1182.031) (-1183.548) [-1180.462] * (-1183.758) (-1182.011) [-1180.759] (-1184.379) -- 0:00:28
553500 -- (-1183.824) (-1180.877) (-1184.008) [-1181.463] * (-1182.366) (-1181.361) (-1181.095) [-1187.656] -- 0:00:28
554000 -- (-1182.259) (-1181.401) (-1182.408) [-1181.108] * (-1181.446) (-1185.252) (-1182.505) [-1183.177] -- 0:00:28
554500 -- (-1182.251) [-1182.827] (-1182.270) (-1181.758) * (-1183.294) (-1182.995) [-1182.520] (-1183.116) -- 0:00:28
555000 -- (-1186.711) [-1183.359] (-1183.776) (-1182.611) * (-1184.718) (-1182.129) [-1186.809] (-1182.817) -- 0:00:28
Average standard deviation of split frequencies: 0.010773
555500 -- (-1183.488) (-1183.050) (-1183.950) [-1185.133] * [-1182.858] (-1185.511) (-1182.508) (-1183.712) -- 0:00:28
556000 -- (-1181.197) (-1185.050) (-1181.541) [-1181.789] * (-1182.666) (-1184.280) [-1182.054] (-1185.005) -- 0:00:27
556500 -- (-1181.934) (-1181.986) (-1181.426) [-1180.864] * (-1182.924) [-1182.428] (-1181.934) (-1185.096) -- 0:00:27
557000 -- (-1182.433) [-1182.107] (-1182.604) (-1183.327) * (-1182.645) [-1183.229] (-1182.190) (-1181.910) -- 0:00:27
557500 -- (-1180.393) [-1181.395] (-1183.332) (-1182.637) * (-1181.710) [-1182.132] (-1183.405) (-1187.021) -- 0:00:27
558000 -- [-1180.336] (-1182.232) (-1181.603) (-1184.360) * (-1184.555) (-1187.512) (-1182.226) [-1183.806] -- 0:00:27
558500 -- [-1181.320] (-1184.169) (-1185.137) (-1183.230) * (-1182.994) [-1183.026] (-1183.620) (-1182.790) -- 0:00:27
559000 -- [-1181.312] (-1187.379) (-1188.011) (-1190.893) * [-1183.802] (-1183.723) (-1180.465) (-1187.530) -- 0:00:27
559500 -- (-1180.909) (-1185.199) [-1183.419] (-1183.055) * (-1182.869) (-1185.612) (-1184.404) [-1183.271] -- 0:00:27
560000 -- (-1181.455) (-1186.634) (-1184.518) [-1182.314] * [-1181.633] (-1182.599) (-1184.376) (-1185.688) -- 0:00:27
Average standard deviation of split frequencies: 0.010584
560500 -- [-1183.864] (-1188.687) (-1183.273) (-1181.518) * [-1183.239] (-1184.425) (-1182.781) (-1180.771) -- 0:00:27
561000 -- (-1185.420) (-1183.339) [-1182.645] (-1183.603) * (-1180.625) (-1185.116) [-1182.068] (-1180.563) -- 0:00:27
561500 -- (-1182.605) (-1184.856) (-1183.262) [-1181.830] * (-1180.941) (-1183.549) (-1186.321) [-1181.585] -- 0:00:27
562000 -- [-1182.685] (-1183.935) (-1182.351) (-1183.439) * [-1182.509] (-1183.701) (-1186.096) (-1182.958) -- 0:00:27
562500 -- (-1182.525) (-1183.705) [-1184.035] (-1183.533) * (-1181.017) (-1182.385) [-1182.215] (-1183.361) -- 0:00:27
563000 -- (-1183.003) [-1183.774] (-1181.904) (-1183.298) * (-1181.991) (-1183.041) (-1185.195) [-1182.194] -- 0:00:27
563500 -- (-1184.163) (-1183.314) [-1184.155] (-1182.317) * [-1182.350] (-1182.504) (-1183.995) (-1183.364) -- 0:00:27
564000 -- (-1185.746) [-1183.485] (-1184.363) (-1182.379) * (-1181.097) (-1182.296) [-1183.352] (-1183.621) -- 0:00:27
564500 -- (-1181.371) (-1183.170) (-1181.898) [-1181.061] * (-1186.954) (-1181.309) (-1184.993) [-1185.868] -- 0:00:27
565000 -- (-1180.785) (-1181.104) (-1185.018) [-1182.717] * [-1181.975] (-1181.750) (-1183.781) (-1186.907) -- 0:00:26
Average standard deviation of split frequencies: 0.010533
565500 -- [-1184.177] (-1181.023) (-1181.537) (-1183.055) * (-1184.270) (-1182.477) (-1183.804) [-1181.778] -- 0:00:26
566000 -- [-1181.050] (-1181.599) (-1181.854) (-1182.544) * (-1184.559) (-1184.218) (-1182.630) [-1183.280] -- 0:00:26
566500 -- [-1181.809] (-1181.810) (-1183.662) (-1181.776) * (-1183.125) (-1183.044) [-1182.651] (-1181.201) -- 0:00:26
567000 -- (-1182.478) (-1180.738) (-1188.685) [-1181.318] * (-1181.071) [-1182.913] (-1184.507) (-1181.476) -- 0:00:26
567500 -- (-1181.358) (-1183.628) (-1183.507) [-1183.460] * (-1183.917) (-1182.659) (-1185.719) [-1182.937] -- 0:00:26
568000 -- (-1183.336) (-1183.383) [-1182.932] (-1180.972) * (-1185.827) (-1183.797) (-1183.065) [-1185.223] -- 0:00:26
568500 -- (-1185.459) (-1183.533) (-1184.781) [-1182.759] * (-1184.148) (-1181.538) (-1186.792) [-1183.858] -- 0:00:26
569000 -- (-1187.191) (-1188.733) [-1183.707] (-1181.278) * [-1182.521] (-1180.717) (-1183.942) (-1182.603) -- 0:00:27
569500 -- (-1182.437) (-1185.909) (-1189.142) [-1180.811] * (-1183.304) [-1183.256] (-1183.771) (-1182.147) -- 0:00:27
570000 -- [-1180.571] (-1181.852) (-1186.332) (-1184.979) * [-1184.274] (-1180.476) (-1182.566) (-1180.901) -- 0:00:27
Average standard deviation of split frequencies: 0.010280
570500 -- [-1181.677] (-1181.095) (-1184.535) (-1182.840) * (-1182.820) [-1182.343] (-1182.390) (-1184.904) -- 0:00:27
571000 -- [-1181.781] (-1185.252) (-1181.867) (-1182.286) * (-1181.404) (-1183.361) (-1182.243) [-1183.844] -- 0:00:27
571500 -- (-1181.589) (-1182.884) [-1182.205] (-1180.933) * (-1194.816) (-1182.396) [-1181.093] (-1181.902) -- 0:00:26
572000 -- (-1185.373) [-1184.930] (-1182.277) (-1183.290) * (-1180.984) [-1182.222] (-1181.991) (-1181.702) -- 0:00:26
572500 -- [-1183.007] (-1185.471) (-1183.158) (-1185.155) * (-1182.645) (-1183.714) [-1182.421] (-1181.227) -- 0:00:26
573000 -- (-1181.611) (-1181.645) [-1182.029] (-1180.983) * (-1182.658) (-1187.068) [-1180.671] (-1183.631) -- 0:00:26
573500 -- (-1182.223) (-1183.463) [-1183.872] (-1180.943) * (-1184.482) (-1184.291) (-1181.248) [-1182.434] -- 0:00:26
574000 -- (-1181.710) (-1183.022) (-1181.155) [-1182.242] * (-1183.515) [-1182.059] (-1182.722) (-1186.724) -- 0:00:26
574500 -- (-1181.831) [-1181.819] (-1181.706) (-1184.259) * [-1183.407] (-1182.709) (-1182.260) (-1182.843) -- 0:00:26
575000 -- (-1180.708) [-1182.223] (-1181.479) (-1182.541) * (-1182.530) (-1190.874) [-1182.145] (-1181.971) -- 0:00:26
Average standard deviation of split frequencies: 0.009866
575500 -- (-1183.834) (-1182.894) (-1183.230) [-1181.227] * [-1181.696] (-1191.177) (-1183.804) (-1180.673) -- 0:00:26
576000 -- (-1184.864) (-1181.021) (-1185.386) [-1184.410] * [-1182.096] (-1182.194) (-1186.146) (-1180.747) -- 0:00:26
576500 -- (-1184.251) (-1181.537) (-1185.742) [-1189.073] * (-1184.442) (-1181.167) (-1183.242) [-1181.889] -- 0:00:26
577000 -- (-1182.810) (-1182.201) [-1186.730] (-1190.333) * (-1181.256) [-1181.274] (-1181.786) (-1181.678) -- 0:00:26
577500 -- [-1181.789] (-1182.266) (-1181.120) (-1183.311) * (-1183.024) (-1181.283) (-1187.578) [-1183.694] -- 0:00:26
578000 -- (-1182.054) (-1184.204) (-1183.376) [-1181.499] * (-1183.651) [-1181.856] (-1183.933) (-1182.749) -- 0:00:26
578500 -- (-1181.574) (-1182.352) [-1182.843] (-1181.017) * [-1184.316] (-1182.141) (-1182.543) (-1182.623) -- 0:00:26
579000 -- [-1180.895] (-1183.183) (-1183.891) (-1181.726) * (-1182.359) (-1186.913) (-1184.359) [-1184.882] -- 0:00:26
579500 -- (-1181.040) (-1183.336) [-1182.866] (-1182.772) * [-1180.993] (-1186.120) (-1182.893) (-1180.618) -- 0:00:26
580000 -- (-1182.426) (-1183.882) (-1182.500) [-1181.477] * [-1180.817] (-1183.417) (-1180.932) (-1180.667) -- 0:00:26
Average standard deviation of split frequencies: 0.009516
580500 -- (-1182.330) (-1182.176) (-1183.854) [-1182.619] * (-1183.811) (-1181.193) (-1183.344) [-1183.306] -- 0:00:26
581000 -- (-1182.099) [-1182.621] (-1183.197) (-1183.049) * [-1182.400] (-1186.102) (-1182.911) (-1186.152) -- 0:00:25
581500 -- (-1182.408) (-1182.491) [-1183.737] (-1181.976) * (-1181.912) (-1181.892) [-1182.007] (-1185.940) -- 0:00:25
582000 -- [-1182.988] (-1183.925) (-1181.374) (-1182.015) * (-1180.967) [-1183.007] (-1183.872) (-1185.741) -- 0:00:25
582500 -- [-1183.091] (-1182.111) (-1181.547) (-1182.829) * (-1181.400) (-1183.470) [-1183.103] (-1187.865) -- 0:00:25
583000 -- (-1184.905) [-1186.220] (-1183.623) (-1182.651) * (-1182.401) (-1183.231) [-1185.817] (-1184.226) -- 0:00:25
583500 -- [-1184.896] (-1184.312) (-1187.087) (-1185.105) * (-1180.739) [-1180.923] (-1182.642) (-1184.275) -- 0:00:25
584000 -- [-1182.400] (-1183.686) (-1184.579) (-1184.785) * (-1183.130) (-1181.288) [-1181.231] (-1185.628) -- 0:00:25
584500 -- [-1181.881] (-1184.358) (-1186.591) (-1182.588) * (-1182.756) (-1183.288) (-1182.243) [-1189.117] -- 0:00:25
585000 -- [-1182.682] (-1183.530) (-1182.583) (-1184.077) * (-1185.004) [-1182.373] (-1182.554) (-1182.475) -- 0:00:26
Average standard deviation of split frequencies: 0.008983
585500 -- (-1185.332) (-1182.763) [-1181.948] (-1184.187) * (-1182.373) (-1183.949) (-1182.632) [-1182.890] -- 0:00:26
586000 -- (-1182.639) (-1183.992) [-1181.907] (-1183.945) * (-1186.970) [-1182.956] (-1181.183) (-1186.909) -- 0:00:26
586500 -- (-1185.518) (-1183.083) (-1190.448) [-1186.574] * (-1182.014) (-1185.225) (-1181.770) [-1183.414] -- 0:00:26
587000 -- (-1183.359) [-1183.579] (-1182.085) (-1182.192) * (-1182.804) (-1181.376) [-1181.412] (-1180.997) -- 0:00:26
587500 -- (-1181.401) (-1182.118) (-1183.266) [-1183.220] * (-1180.939) [-1182.365] (-1183.103) (-1181.680) -- 0:00:25
588000 -- [-1181.527] (-1181.561) (-1183.044) (-1182.266) * (-1182.947) (-1183.900) [-1183.237] (-1182.062) -- 0:00:25
588500 -- (-1182.026) (-1182.643) (-1184.696) [-1182.782] * (-1182.013) (-1185.080) [-1181.148] (-1182.249) -- 0:00:25
589000 -- (-1182.159) [-1181.785] (-1187.399) (-1182.362) * (-1181.801) (-1182.075) (-1181.228) [-1183.255] -- 0:00:25
589500 -- (-1181.769) [-1185.488] (-1187.428) (-1186.194) * (-1181.524) (-1183.366) [-1182.634] (-1182.900) -- 0:00:25
590000 -- (-1182.132) (-1182.436) [-1183.079] (-1183.121) * (-1180.797) (-1181.136) (-1182.689) [-1182.287] -- 0:00:25
Average standard deviation of split frequencies: 0.008868
590500 -- (-1181.473) [-1181.910] (-1183.079) (-1181.931) * [-1181.096] (-1181.642) (-1183.572) (-1181.025) -- 0:00:25
591000 -- (-1181.768) (-1181.837) (-1180.815) [-1182.030] * (-1183.557) [-1184.056] (-1182.177) (-1182.376) -- 0:00:25
591500 -- (-1181.030) (-1180.979) (-1182.951) [-1184.033] * (-1181.995) (-1180.805) (-1184.192) [-1183.956] -- 0:00:25
592000 -- (-1182.986) [-1180.747] (-1182.111) (-1181.832) * (-1182.902) (-1188.318) (-1183.989) [-1181.092] -- 0:00:25
592500 -- (-1184.494) (-1180.469) [-1181.883] (-1182.713) * (-1183.916) (-1184.288) [-1181.346] (-1182.130) -- 0:00:25
593000 -- (-1183.806) (-1181.478) [-1181.638] (-1183.960) * (-1182.134) (-1185.353) (-1188.090) [-1182.346] -- 0:00:25
593500 -- (-1181.125) (-1186.107) [-1181.506] (-1183.819) * (-1183.070) (-1185.863) (-1184.881) [-1182.118] -- 0:00:25
594000 -- (-1181.755) (-1181.747) [-1181.545] (-1184.666) * (-1183.999) [-1183.163] (-1184.495) (-1182.023) -- 0:00:25
594500 -- (-1180.912) (-1183.154) (-1182.438) [-1182.653] * (-1182.647) (-1182.904) (-1182.149) [-1183.297] -- 0:00:25
595000 -- [-1181.057] (-1183.266) (-1181.171) (-1185.525) * (-1180.893) (-1181.725) [-1181.908] (-1181.480) -- 0:00:25
Average standard deviation of split frequencies: 0.009008
595500 -- (-1181.036) [-1182.325] (-1181.839) (-1182.975) * (-1180.855) (-1180.807) (-1181.864) [-1181.452] -- 0:00:25
596000 -- (-1184.850) [-1182.740] (-1181.337) (-1181.858) * [-1181.410] (-1180.795) (-1182.358) (-1187.311) -- 0:00:25
596500 -- (-1182.329) (-1181.552) (-1184.666) [-1182.176] * (-1181.048) (-1181.946) [-1181.761] (-1181.521) -- 0:00:25
597000 -- (-1184.966) (-1181.653) (-1183.879) [-1181.922] * (-1184.116) (-1182.176) (-1182.684) [-1182.488] -- 0:00:24
597500 -- [-1181.625] (-1182.685) (-1181.539) (-1182.146) * [-1182.053] (-1184.569) (-1181.447) (-1183.447) -- 0:00:24
598000 -- [-1181.541] (-1183.486) (-1181.235) (-1183.543) * (-1182.306) (-1184.649) [-1182.142] (-1180.880) -- 0:00:24
598500 -- (-1182.181) (-1182.731) (-1185.888) [-1181.823] * (-1183.916) (-1186.228) (-1180.961) [-1181.183] -- 0:00:24
599000 -- (-1183.948) [-1184.508] (-1183.076) (-1182.927) * (-1187.120) (-1184.473) (-1182.326) [-1182.748] -- 0:00:24
599500 -- (-1184.541) [-1181.947] (-1184.694) (-1181.938) * (-1182.139) (-1183.362) [-1183.827] (-1180.598) -- 0:00:24
600000 -- (-1182.974) (-1182.186) [-1182.035] (-1182.389) * (-1182.508) (-1181.189) (-1181.066) [-1181.429] -- 0:00:24
Average standard deviation of split frequencies: 0.009025
600500 -- (-1195.081) (-1182.145) (-1182.079) [-1182.214] * (-1183.989) [-1182.563] (-1182.935) (-1181.903) -- 0:00:24
601000 -- (-1182.662) (-1182.353) [-1181.802] (-1181.468) * (-1185.511) (-1184.170) (-1183.374) [-1182.482] -- 0:00:25
601500 -- [-1183.677] (-1180.889) (-1182.778) (-1180.962) * (-1180.817) (-1183.657) (-1186.239) [-1181.806] -- 0:00:25
602000 -- [-1183.401] (-1182.534) (-1181.442) (-1182.027) * (-1181.776) [-1182.873] (-1182.659) (-1182.955) -- 0:00:25
602500 -- [-1183.102] (-1181.609) (-1185.582) (-1184.275) * (-1185.156) (-1181.297) (-1185.336) [-1182.667] -- 0:00:25
603000 -- [-1180.932] (-1182.576) (-1183.047) (-1184.835) * (-1183.087) [-1180.486] (-1181.093) (-1181.922) -- 0:00:25
603500 -- (-1183.393) (-1181.906) [-1181.704] (-1182.374) * [-1184.313] (-1181.759) (-1180.802) (-1183.039) -- 0:00:24
604000 -- (-1182.524) (-1184.763) (-1182.464) [-1184.721] * (-1181.199) (-1181.424) [-1186.442] (-1182.384) -- 0:00:24
604500 -- [-1181.212] (-1183.060) (-1184.204) (-1184.233) * [-1185.034] (-1181.077) (-1182.123) (-1181.240) -- 0:00:24
605000 -- (-1181.357) (-1182.780) (-1182.418) [-1183.545] * (-1183.036) (-1180.804) [-1183.233] (-1181.211) -- 0:00:24
Average standard deviation of split frequencies: 0.008903
605500 -- (-1184.027) (-1183.474) (-1182.591) [-1182.193] * (-1183.936) [-1181.719] (-1181.710) (-1183.895) -- 0:00:24
606000 -- (-1182.365) (-1185.250) [-1181.673] (-1183.071) * [-1182.202] (-1181.133) (-1183.336) (-1183.387) -- 0:00:24
606500 -- [-1181.833] (-1185.811) (-1180.600) (-1182.676) * (-1182.686) (-1185.964) [-1182.356] (-1182.595) -- 0:00:24
607000 -- (-1180.705) (-1184.987) [-1181.410] (-1182.034) * [-1181.419] (-1185.465) (-1183.058) (-1180.730) -- 0:00:24
607500 -- (-1181.650) (-1184.443) [-1183.013] (-1180.694) * [-1181.921] (-1183.313) (-1183.755) (-1181.936) -- 0:00:24
608000 -- (-1181.182) (-1182.245) [-1180.815] (-1181.683) * (-1181.281) [-1181.158] (-1183.134) (-1185.126) -- 0:00:24
608500 -- (-1181.381) [-1181.951] (-1180.381) (-1181.233) * (-1183.939) [-1181.956] (-1182.110) (-1182.188) -- 0:00:24
609000 -- (-1182.764) (-1182.063) (-1181.451) [-1182.844] * [-1180.872] (-1182.301) (-1183.980) (-1182.067) -- 0:00:24
609500 -- (-1181.630) (-1180.513) (-1183.959) [-1183.150] * (-1180.929) (-1182.889) [-1180.620] (-1181.578) -- 0:00:24
610000 -- (-1182.377) (-1182.070) [-1184.010] (-1183.507) * (-1183.369) (-1182.724) [-1180.634] (-1181.798) -- 0:00:24
Average standard deviation of split frequencies: 0.008363
610500 -- (-1182.171) (-1181.388) (-1184.984) [-1181.523] * (-1182.285) (-1182.173) (-1181.814) [-1181.492] -- 0:00:24
611000 -- (-1181.785) (-1182.192) (-1182.646) [-1181.866] * (-1181.588) [-1181.119] (-1183.042) (-1181.273) -- 0:00:24
611500 -- (-1181.868) (-1181.364) (-1181.163) [-1181.378] * (-1181.213) (-1181.705) [-1182.356] (-1187.194) -- 0:00:24
612000 -- (-1184.772) (-1181.385) [-1183.572] (-1182.573) * (-1181.148) (-1181.337) [-1181.243] (-1183.842) -- 0:00:24
612500 -- [-1183.795] (-1183.522) (-1184.851) (-1184.104) * (-1181.621) [-1181.742] (-1183.755) (-1182.025) -- 0:00:24
613000 -- [-1184.153] (-1182.022) (-1185.386) (-1182.220) * [-1180.648] (-1185.028) (-1182.462) (-1188.059) -- 0:00:23
613500 -- (-1183.744) (-1184.482) [-1184.269] (-1182.500) * (-1181.497) (-1181.564) (-1182.715) [-1183.511] -- 0:00:23
614000 -- (-1180.764) (-1186.141) [-1183.046] (-1182.144) * [-1181.755] (-1183.176) (-1183.590) (-1184.219) -- 0:00:23
614500 -- [-1186.689] (-1186.529) (-1186.053) (-1192.026) * (-1181.384) (-1182.992) [-1183.650] (-1181.292) -- 0:00:23
615000 -- (-1185.275) (-1194.072) [-1183.526] (-1187.633) * (-1186.219) (-1182.203) (-1181.825) [-1181.808] -- 0:00:23
Average standard deviation of split frequencies: 0.008248
615500 -- (-1184.601) (-1182.123) [-1181.806] (-1185.054) * (-1181.216) [-1182.472] (-1181.729) (-1182.195) -- 0:00:23
616000 -- (-1180.612) (-1183.304) [-1183.584] (-1183.216) * (-1183.900) (-1181.940) (-1183.832) [-1183.886] -- 0:00:23
616500 -- (-1181.136) (-1182.030) (-1183.194) [-1182.491] * (-1182.072) (-1184.908) [-1181.657] (-1183.017) -- 0:00:23
617000 -- (-1183.022) (-1182.622) (-1183.306) [-1181.371] * [-1183.268] (-1186.221) (-1181.548) (-1183.950) -- 0:00:24
617500 -- (-1180.965) (-1184.869) [-1183.184] (-1185.435) * (-1181.197) [-1186.353] (-1189.309) (-1185.596) -- 0:00:24
618000 -- (-1182.712) (-1184.214) (-1183.086) [-1185.930] * [-1185.577] (-1182.588) (-1182.373) (-1184.615) -- 0:00:24
618500 -- (-1183.296) (-1182.227) (-1184.021) [-1188.106] * (-1185.949) (-1182.013) (-1181.196) [-1183.807] -- 0:00:24
619000 -- (-1184.725) (-1183.463) [-1183.278] (-1185.386) * [-1183.393] (-1184.735) (-1184.139) (-1182.377) -- 0:00:24
619500 -- [-1182.971] (-1185.161) (-1183.181) (-1182.860) * [-1181.726] (-1185.829) (-1183.895) (-1183.140) -- 0:00:23
620000 -- (-1184.105) (-1184.081) [-1183.571] (-1182.703) * (-1181.527) (-1185.006) [-1182.211] (-1180.928) -- 0:00:23
Average standard deviation of split frequencies: 0.008101
620500 -- (-1181.625) (-1185.356) [-1181.305] (-1182.955) * (-1182.685) (-1181.669) [-1182.347] (-1184.924) -- 0:00:23
621000 -- (-1183.113) [-1185.350] (-1185.216) (-1181.702) * (-1183.394) [-1182.194] (-1180.958) (-1183.079) -- 0:00:23
621500 -- [-1183.366] (-1182.540) (-1181.631) (-1187.970) * (-1183.499) [-1182.213] (-1180.685) (-1182.498) -- 0:00:23
622000 -- (-1182.815) (-1183.802) (-1183.972) [-1181.333] * (-1188.099) (-1183.268) (-1180.573) [-1183.948] -- 0:00:23
622500 -- (-1182.991) [-1181.151] (-1182.860) (-1182.660) * [-1182.893] (-1187.232) (-1180.974) (-1185.458) -- 0:00:23
623000 -- (-1180.984) (-1181.663) (-1182.570) [-1182.031] * [-1181.038] (-1188.638) (-1180.935) (-1185.168) -- 0:00:23
623500 -- [-1182.812] (-1182.236) (-1183.113) (-1182.737) * [-1182.381] (-1184.984) (-1183.324) (-1181.812) -- 0:00:23
624000 -- (-1186.211) (-1181.953) [-1182.093] (-1182.854) * (-1182.077) (-1182.559) [-1181.746] (-1184.181) -- 0:00:23
624500 -- (-1184.014) (-1182.944) (-1181.763) [-1181.316] * [-1182.110] (-1182.502) (-1183.106) (-1182.256) -- 0:00:23
625000 -- [-1184.158] (-1190.417) (-1184.582) (-1182.548) * (-1180.681) [-1182.619] (-1182.039) (-1183.118) -- 0:00:23
Average standard deviation of split frequencies: 0.008032
625500 -- (-1183.159) (-1189.575) [-1185.450] (-1184.928) * [-1182.821] (-1185.371) (-1181.347) (-1185.355) -- 0:00:23
626000 -- (-1182.343) [-1182.094] (-1180.962) (-1184.607) * (-1182.595) (-1180.842) (-1181.836) [-1188.800] -- 0:00:23
626500 -- (-1184.310) (-1184.061) [-1184.631] (-1185.916) * (-1184.365) (-1184.027) [-1180.871] (-1182.529) -- 0:00:23
627000 -- [-1181.193] (-1182.170) (-1184.162) (-1185.163) * (-1182.158) (-1182.396) (-1182.423) [-1181.739] -- 0:00:23
627500 -- (-1183.967) [-1181.127] (-1186.459) (-1180.709) * (-1182.147) (-1185.348) (-1186.378) [-1183.365] -- 0:00:23
628000 -- (-1186.802) (-1182.222) (-1182.102) [-1180.584] * (-1186.344) [-1180.997] (-1181.753) (-1183.445) -- 0:00:23
628500 -- [-1183.796] (-1181.646) (-1183.553) (-1181.433) * (-1199.463) [-1181.890] (-1181.755) (-1184.632) -- 0:00:23
629000 -- (-1182.796) (-1182.327) [-1182.013] (-1182.261) * (-1192.180) (-1182.699) (-1181.296) [-1181.585] -- 0:00:23
629500 -- (-1182.728) (-1183.373) (-1182.432) [-1181.326] * (-1190.785) [-1182.667] (-1181.941) (-1181.175) -- 0:00:22
630000 -- [-1181.996] (-1185.418) (-1182.015) (-1180.857) * (-1186.380) (-1181.380) (-1182.444) [-1181.199] -- 0:00:22
Average standard deviation of split frequencies: 0.007641
630500 -- (-1183.421) [-1182.658] (-1181.856) (-1183.339) * (-1182.049) (-1183.513) [-1183.945] (-1181.045) -- 0:00:22
631000 -- (-1184.127) (-1182.199) (-1181.254) [-1181.111] * (-1184.267) (-1183.463) (-1181.460) [-1182.604] -- 0:00:22
631500 -- [-1185.158] (-1183.566) (-1185.475) (-1180.877) * (-1185.445) [-1182.598] (-1180.959) (-1182.445) -- 0:00:22
632000 -- (-1181.048) [-1183.738] (-1182.754) (-1181.976) * (-1182.545) [-1181.894] (-1182.392) (-1182.119) -- 0:00:22
632500 -- (-1180.972) (-1187.129) (-1181.999) [-1183.032] * [-1186.374] (-1181.713) (-1184.799) (-1182.789) -- 0:00:22
633000 -- (-1182.652) [-1181.783] (-1181.899) (-1181.110) * (-1188.064) [-1182.121] (-1181.623) (-1185.870) -- 0:00:23
633500 -- [-1185.438] (-1183.481) (-1182.509) (-1180.814) * [-1183.764] (-1182.684) (-1181.512) (-1181.858) -- 0:00:23
634000 -- [-1182.615] (-1180.921) (-1181.127) (-1180.803) * (-1188.885) [-1182.765] (-1181.320) (-1183.161) -- 0:00:23
634500 -- (-1182.352) (-1181.017) [-1183.122] (-1180.960) * (-1183.233) (-1182.156) [-1181.136] (-1183.819) -- 0:00:23
635000 -- [-1181.247] (-1182.471) (-1183.123) (-1182.190) * (-1182.292) (-1182.889) (-1182.485) [-1184.384] -- 0:00:22
Average standard deviation of split frequencies: 0.007494
635500 -- (-1184.981) (-1185.142) [-1182.069] (-1181.468) * (-1182.839) (-1184.352) (-1180.426) [-1183.308] -- 0:00:22
636000 -- (-1186.715) (-1183.883) [-1182.761] (-1186.382) * (-1182.451) (-1182.409) [-1181.125] (-1186.053) -- 0:00:22
636500 -- (-1182.544) (-1185.862) [-1181.134] (-1183.073) * (-1185.324) (-1183.961) (-1180.779) [-1183.687] -- 0:00:22
637000 -- (-1181.797) (-1185.537) (-1182.178) [-1182.145] * (-1182.431) [-1183.523] (-1181.230) (-1182.812) -- 0:00:22
637500 -- (-1185.448) (-1182.426) [-1181.296] (-1184.710) * [-1180.901] (-1182.357) (-1181.683) (-1183.539) -- 0:00:22
638000 -- (-1180.578) (-1181.022) (-1181.560) [-1186.616] * [-1181.510] (-1183.737) (-1181.253) (-1183.974) -- 0:00:22
638500 -- (-1183.168) (-1181.171) [-1183.358] (-1186.493) * (-1182.730) [-1183.090] (-1183.749) (-1183.040) -- 0:00:22
639000 -- (-1182.199) (-1181.207) (-1181.469) [-1183.608] * [-1181.358] (-1184.419) (-1181.375) (-1181.600) -- 0:00:22
639500 -- (-1181.706) (-1183.701) [-1183.874] (-1181.484) * (-1180.755) [-1180.912] (-1181.397) (-1183.505) -- 0:00:22
640000 -- [-1180.883] (-1183.576) (-1186.017) (-1182.044) * (-1181.537) (-1180.770) (-1181.439) [-1181.309] -- 0:00:22
Average standard deviation of split frequencies: 0.007726
640500 -- (-1185.103) (-1181.608) [-1181.770] (-1184.053) * [-1180.926] (-1181.591) (-1181.280) (-1182.411) -- 0:00:22
641000 -- (-1187.460) (-1183.874) (-1183.439) [-1181.428] * (-1188.353) [-1181.618] (-1184.656) (-1185.426) -- 0:00:22
641500 -- (-1185.587) (-1183.634) (-1183.658) [-1182.320] * [-1184.780] (-1182.892) (-1182.663) (-1183.111) -- 0:00:22
642000 -- (-1191.685) (-1181.052) (-1180.899) [-1181.700] * (-1183.349) (-1187.525) [-1182.270] (-1182.353) -- 0:00:22
642500 -- (-1181.394) (-1180.808) [-1180.899] (-1183.953) * (-1183.084) (-1190.098) (-1181.245) [-1182.280] -- 0:00:22
643000 -- (-1183.151) (-1181.116) (-1181.606) [-1181.283] * (-1181.978) (-1185.315) (-1181.483) [-1181.994] -- 0:00:22
643500 -- [-1181.255] (-1185.805) (-1181.181) (-1180.892) * [-1182.010] (-1184.985) (-1181.757) (-1183.172) -- 0:00:22
644000 -- (-1181.434) (-1182.308) [-1181.443] (-1181.930) * [-1182.135] (-1181.880) (-1180.699) (-1182.495) -- 0:00:22
644500 -- (-1181.686) [-1182.794] (-1183.394) (-1182.886) * [-1182.311] (-1182.919) (-1180.503) (-1182.220) -- 0:00:22
645000 -- [-1182.577] (-1184.334) (-1186.110) (-1182.933) * (-1184.571) (-1182.532) (-1180.503) [-1183.714] -- 0:00:22
Average standard deviation of split frequencies: 0.007758
645500 -- (-1182.156) [-1181.519] (-1184.235) (-1182.361) * (-1181.062) (-1181.851) (-1181.338) [-1186.426] -- 0:00:21
646000 -- (-1183.083) (-1184.780) (-1186.173) [-1181.765] * (-1181.393) (-1183.599) [-1181.043] (-1184.787) -- 0:00:21
646500 -- (-1182.998) (-1181.481) (-1186.595) [-1181.879] * [-1184.515] (-1184.915) (-1181.871) (-1184.214) -- 0:00:21
647000 -- (-1182.025) (-1183.201) [-1185.214] (-1181.984) * [-1182.118] (-1189.799) (-1184.002) (-1182.936) -- 0:00:21
647500 -- (-1182.034) (-1183.386) (-1182.576) [-1185.044] * [-1182.513] (-1183.963) (-1186.589) (-1187.756) -- 0:00:21
648000 -- (-1181.319) (-1183.677) (-1182.104) [-1181.262] * (-1180.869) (-1183.471) (-1187.126) [-1187.856] -- 0:00:21
648500 -- (-1186.347) [-1182.391] (-1180.795) (-1182.001) * (-1180.892) (-1183.746) [-1183.927] (-1181.115) -- 0:00:21
649000 -- (-1185.765) (-1182.795) (-1182.424) [-1184.082] * (-1182.085) [-1181.661] (-1189.449) (-1181.123) -- 0:00:21
649500 -- (-1182.497) [-1184.750] (-1182.363) (-1181.999) * (-1182.900) (-1183.718) (-1182.270) [-1181.652] -- 0:00:22
650000 -- (-1181.384) (-1186.740) [-1182.220] (-1180.829) * [-1183.268] (-1184.805) (-1185.299) (-1180.923) -- 0:00:22
Average standard deviation of split frequencies: 0.007889
650500 -- (-1182.808) (-1182.520) (-1182.748) [-1181.627] * [-1186.581] (-1186.568) (-1181.459) (-1182.928) -- 0:00:22
651000 -- (-1183.647) (-1185.363) (-1184.665) [-1181.989] * (-1181.534) (-1185.452) (-1182.027) [-1181.001] -- 0:00:21
651500 -- [-1183.110] (-1181.446) (-1180.771) (-1181.093) * (-1181.118) (-1181.773) (-1184.293) [-1184.218] -- 0:00:21
652000 -- (-1181.887) [-1182.215] (-1182.956) (-1182.136) * (-1180.667) [-1182.348] (-1181.794) (-1191.685) -- 0:00:21
652500 -- [-1181.137] (-1187.374) (-1182.391) (-1187.712) * (-1182.385) [-1184.045] (-1181.412) (-1183.400) -- 0:00:21
653000 -- (-1181.032) (-1182.397) (-1181.561) [-1189.217] * (-1182.183) [-1181.469] (-1180.642) (-1183.543) -- 0:00:21
653500 -- (-1181.786) (-1183.158) [-1181.591] (-1186.276) * [-1180.508] (-1186.054) (-1181.559) (-1182.658) -- 0:00:21
654000 -- [-1183.120] (-1183.695) (-1180.853) (-1182.479) * (-1180.509) (-1181.610) [-1182.253] (-1182.972) -- 0:00:21
654500 -- [-1182.292] (-1186.341) (-1182.298) (-1182.304) * (-1185.170) (-1181.991) [-1180.710] (-1182.901) -- 0:00:21
655000 -- [-1181.141] (-1180.987) (-1186.920) (-1185.502) * [-1184.973] (-1182.356) (-1181.149) (-1180.902) -- 0:00:21
Average standard deviation of split frequencies: 0.007905
655500 -- (-1183.146) [-1188.325] (-1183.619) (-1183.558) * [-1182.835] (-1184.275) (-1181.712) (-1182.100) -- 0:00:21
656000 -- (-1181.120) [-1182.201] (-1181.536) (-1181.768) * (-1189.513) [-1180.525] (-1181.350) (-1182.776) -- 0:00:21
656500 -- (-1182.416) [-1181.858] (-1181.532) (-1181.978) * [-1183.230] (-1182.778) (-1182.784) (-1181.385) -- 0:00:21
657000 -- (-1183.174) [-1184.272] (-1183.892) (-1183.430) * (-1180.720) (-1182.595) (-1181.436) [-1182.087] -- 0:00:21
657500 -- (-1184.665) (-1182.641) (-1185.498) [-1181.147] * (-1181.724) (-1182.077) (-1187.008) [-1181.791] -- 0:00:21
658000 -- (-1181.366) (-1181.866) (-1182.619) [-1180.969] * [-1181.530] (-1183.622) (-1185.008) (-1182.027) -- 0:00:21
658500 -- (-1182.261) (-1187.304) (-1185.419) [-1182.410] * [-1180.486] (-1181.175) (-1183.765) (-1181.943) -- 0:00:21
659000 -- (-1182.054) (-1185.338) [-1181.039] (-1181.037) * (-1184.112) (-1181.246) (-1183.299) [-1183.674] -- 0:00:21
659500 -- (-1183.148) (-1186.117) (-1181.529) [-1184.743] * (-1184.801) (-1181.566) (-1182.231) [-1180.896] -- 0:00:21
660000 -- [-1183.512] (-1183.484) (-1181.831) (-1186.362) * [-1182.415] (-1181.051) (-1181.521) (-1180.516) -- 0:00:21
Average standard deviation of split frequencies: 0.008087
660500 -- (-1181.375) [-1184.768] (-1182.692) (-1181.754) * (-1183.071) (-1183.498) (-1183.422) [-1184.219] -- 0:00:21
661000 -- (-1182.783) (-1182.783) (-1183.274) [-1182.559] * (-1181.218) (-1182.816) (-1182.681) [-1185.335] -- 0:00:21
661500 -- (-1187.606) (-1181.931) (-1181.886) [-1181.254] * (-1181.819) (-1185.207) (-1183.521) [-1185.532] -- 0:00:20
662000 -- (-1181.342) (-1181.540) (-1182.444) [-1184.888] * (-1182.300) [-1183.338] (-1183.364) (-1183.756) -- 0:00:20
662500 -- (-1184.278) (-1183.964) (-1181.886) [-1185.445] * (-1182.720) (-1183.879) [-1183.115] (-1180.649) -- 0:00:20
663000 -- [-1181.431] (-1184.180) (-1182.066) (-1183.334) * (-1181.405) (-1181.178) (-1182.795) [-1181.150] -- 0:00:20
663500 -- (-1182.327) (-1182.210) (-1186.126) [-1183.514] * [-1186.144] (-1181.825) (-1182.898) (-1180.937) -- 0:00:20
664000 -- (-1184.189) [-1181.517] (-1185.081) (-1183.543) * (-1184.835) [-1183.751] (-1183.221) (-1184.808) -- 0:00:20
664500 -- (-1184.038) (-1182.737) (-1182.477) [-1182.491] * [-1183.362] (-1184.278) (-1182.780) (-1181.838) -- 0:00:20
665000 -- (-1182.240) (-1185.717) (-1184.118) [-1183.182] * (-1185.403) (-1184.885) [-1180.582] (-1186.203) -- 0:00:20
Average standard deviation of split frequencies: 0.008345
665500 -- (-1181.941) (-1181.080) [-1181.505] (-1181.515) * (-1185.284) (-1181.767) [-1184.267] (-1183.491) -- 0:00:21
666000 -- (-1182.424) (-1182.222) (-1187.424) [-1183.517] * [-1182.145] (-1184.598) (-1191.421) (-1181.815) -- 0:00:21
666500 -- (-1180.660) (-1183.941) [-1183.474] (-1182.126) * [-1181.458] (-1182.865) (-1188.449) (-1182.383) -- 0:00:21
667000 -- (-1182.135) (-1183.227) (-1181.725) [-1182.221] * (-1182.115) [-1182.726] (-1184.104) (-1181.780) -- 0:00:20
667500 -- (-1180.803) [-1181.166] (-1180.862) (-1182.792) * (-1182.424) (-1184.714) [-1181.093] (-1185.020) -- 0:00:20
668000 -- (-1185.311) [-1181.204] (-1181.591) (-1189.804) * [-1182.387] (-1183.885) (-1180.743) (-1183.246) -- 0:00:20
668500 -- (-1184.014) (-1182.909) [-1181.264] (-1187.136) * [-1181.244] (-1180.731) (-1183.482) (-1185.309) -- 0:00:20
669000 -- (-1181.773) (-1183.576) (-1181.990) [-1183.784] * (-1181.203) [-1181.734] (-1184.699) (-1185.175) -- 0:00:20
669500 -- [-1181.333] (-1186.867) (-1183.546) (-1183.840) * [-1180.875] (-1181.733) (-1181.229) (-1182.951) -- 0:00:20
670000 -- [-1181.426] (-1186.309) (-1182.386) (-1183.823) * (-1180.925) (-1181.256) [-1181.160] (-1181.806) -- 0:00:20
Average standard deviation of split frequencies: 0.009099
670500 -- (-1182.592) (-1184.124) [-1181.605] (-1181.689) * (-1181.516) (-1183.847) (-1180.763) [-1183.012] -- 0:00:20
671000 -- (-1188.719) (-1185.169) (-1184.562) [-1180.695] * (-1184.777) (-1187.820) [-1180.617] (-1184.367) -- 0:00:20
671500 -- (-1183.933) [-1182.695] (-1182.064) (-1180.517) * (-1183.082) [-1184.192] (-1180.787) (-1180.475) -- 0:00:20
672000 -- (-1181.624) (-1181.917) [-1182.399] (-1180.855) * (-1184.870) (-1185.459) [-1181.781] (-1183.505) -- 0:00:20
672500 -- (-1184.449) (-1181.321) (-1186.452) [-1187.281] * (-1185.477) (-1181.767) [-1182.624] (-1181.664) -- 0:00:20
673000 -- [-1181.695] (-1183.639) (-1190.481) (-1182.235) * (-1183.882) [-1181.876] (-1180.706) (-1188.795) -- 0:00:20
673500 -- [-1185.621] (-1185.216) (-1190.858) (-1189.336) * (-1183.534) (-1184.419) [-1181.812] (-1182.633) -- 0:00:20
674000 -- [-1185.457] (-1189.319) (-1186.495) (-1183.561) * [-1184.527] (-1188.173) (-1185.390) (-1183.238) -- 0:00:20
674500 -- [-1183.713] (-1184.605) (-1186.222) (-1183.756) * (-1183.785) [-1181.865] (-1182.613) (-1183.664) -- 0:00:20
675000 -- (-1181.703) (-1182.122) [-1182.197] (-1183.926) * (-1184.687) [-1182.488] (-1181.791) (-1183.205) -- 0:00:20
Average standard deviation of split frequencies: 0.008949
675500 -- [-1182.837] (-1181.471) (-1182.015) (-1181.559) * (-1185.423) [-1182.083] (-1185.762) (-1183.799) -- 0:00:20
676000 -- (-1181.520) (-1183.794) [-1183.584] (-1184.019) * (-1182.236) (-1184.174) (-1182.718) [-1182.669] -- 0:00:20
676500 -- (-1182.163) (-1181.808) [-1184.770] (-1184.333) * (-1182.672) (-1188.009) (-1182.502) [-1183.407] -- 0:00:20
677000 -- [-1182.959] (-1180.535) (-1186.900) (-1185.560) * [-1183.329] (-1185.509) (-1183.007) (-1182.828) -- 0:00:20
677500 -- (-1180.483) (-1181.399) [-1183.021] (-1183.376) * (-1183.675) [-1181.849] (-1184.549) (-1183.184) -- 0:00:19
678000 -- (-1180.918) (-1181.059) (-1182.209) [-1182.689] * [-1184.469] (-1182.278) (-1181.093) (-1182.275) -- 0:00:19
678500 -- (-1181.332) (-1182.558) [-1181.860] (-1181.962) * (-1183.421) (-1186.630) (-1183.578) [-1184.064] -- 0:00:19
679000 -- [-1182.709] (-1181.575) (-1182.949) (-1181.953) * (-1184.644) [-1185.698] (-1185.074) (-1182.669) -- 0:00:19
679500 -- (-1182.655) (-1181.568) [-1182.828] (-1183.195) * (-1184.900) [-1181.494] (-1181.071) (-1186.183) -- 0:00:19
680000 -- (-1184.189) (-1181.649) (-1182.724) [-1185.525] * (-1185.735) (-1180.781) (-1185.003) [-1182.449] -- 0:00:19
Average standard deviation of split frequencies: 0.009085
680500 -- (-1184.048) (-1183.246) [-1181.359] (-1182.292) * [-1184.693] (-1180.791) (-1180.898) (-1185.113) -- 0:00:19
681000 -- (-1182.396) (-1185.897) [-1180.582] (-1183.320) * (-1183.968) (-1182.693) (-1183.164) [-1181.471] -- 0:00:19
681500 -- (-1181.488) (-1185.576) [-1180.724] (-1182.360) * (-1181.295) (-1182.693) [-1182.859] (-1181.910) -- 0:00:20
682000 -- (-1185.305) [-1182.384] (-1184.991) (-1182.147) * (-1181.188) [-1184.053] (-1183.667) (-1181.244) -- 0:00:20
682500 -- (-1183.353) [-1183.161] (-1184.554) (-1183.323) * (-1181.188) (-1186.796) (-1182.678) [-1180.470] -- 0:00:20
683000 -- (-1182.051) (-1180.888) (-1182.733) [-1181.341] * (-1181.685) [-1183.301] (-1181.786) (-1181.623) -- 0:00:19
683500 -- [-1182.789] (-1181.872) (-1183.221) (-1182.316) * (-1181.731) (-1182.126) [-1182.683] (-1182.976) -- 0:00:19
684000 -- (-1181.877) [-1181.997] (-1182.858) (-1182.596) * (-1183.697) (-1182.786) (-1183.314) [-1181.756] -- 0:00:19
684500 -- [-1185.002] (-1181.039) (-1182.690) (-1186.291) * [-1182.217] (-1183.006) (-1182.066) (-1181.192) -- 0:00:19
685000 -- (-1184.205) (-1182.171) (-1184.239) [-1183.647] * (-1183.261) (-1185.007) [-1182.493] (-1181.192) -- 0:00:19
Average standard deviation of split frequencies: 0.009055
685500 -- (-1182.943) (-1180.851) [-1186.094] (-1182.221) * [-1182.956] (-1189.354) (-1183.745) (-1183.853) -- 0:00:19
686000 -- (-1182.211) (-1181.135) [-1182.434] (-1181.523) * (-1184.191) (-1187.624) [-1181.294] (-1184.033) -- 0:00:19
686500 -- (-1186.534) (-1181.897) [-1181.358] (-1184.446) * (-1182.627) (-1185.245) [-1180.899] (-1181.822) -- 0:00:19
687000 -- [-1181.014] (-1182.029) (-1183.600) (-1182.576) * (-1180.836) (-1184.932) [-1182.028] (-1182.404) -- 0:00:19
687500 -- [-1181.468] (-1183.701) (-1182.594) (-1182.767) * (-1181.760) (-1182.059) (-1183.035) [-1184.436] -- 0:00:19
688000 -- (-1182.379) (-1182.828) [-1181.547] (-1185.891) * (-1183.712) [-1181.511] (-1182.497) (-1186.595) -- 0:00:19
688500 -- [-1183.660] (-1185.387) (-1183.399) (-1183.291) * (-1185.026) [-1182.179] (-1185.358) (-1185.302) -- 0:00:19
689000 -- (-1184.549) (-1181.439) [-1182.608] (-1182.423) * (-1183.943) (-1184.923) (-1183.341) [-1181.967] -- 0:00:19
689500 -- (-1185.434) (-1181.826) [-1182.626] (-1183.047) * (-1181.309) (-1181.221) (-1183.507) [-1182.758] -- 0:00:19
690000 -- (-1182.251) [-1181.285] (-1181.587) (-1183.013) * [-1181.741] (-1181.376) (-1184.952) (-1188.109) -- 0:00:19
Average standard deviation of split frequencies: 0.008833
690500 -- [-1184.700] (-1184.694) (-1182.427) (-1185.570) * (-1182.249) (-1185.201) (-1181.466) [-1188.334] -- 0:00:19
691000 -- (-1185.850) [-1182.801] (-1184.841) (-1182.934) * (-1180.486) [-1182.057] (-1182.367) (-1185.283) -- 0:00:19
691500 -- (-1183.653) (-1182.557) (-1182.629) [-1180.933] * (-1183.823) [-1183.412] (-1185.601) (-1183.872) -- 0:00:19
692000 -- [-1184.861] (-1183.162) (-1180.947) (-1181.439) * (-1188.330) (-1185.682) [-1184.426] (-1181.131) -- 0:00:19
692500 -- (-1182.362) [-1181.438] (-1183.886) (-1183.577) * (-1184.149) [-1185.748] (-1185.563) (-1183.234) -- 0:00:19
693000 -- (-1185.010) (-1181.723) [-1181.459] (-1183.979) * (-1183.054) (-1181.866) (-1184.679) [-1182.623] -- 0:00:19
693500 -- (-1181.708) (-1185.245) (-1182.297) [-1183.142] * (-1181.650) [-1184.654] (-1181.405) (-1184.292) -- 0:00:19
694000 -- [-1185.164] (-1186.302) (-1181.785) (-1184.573) * (-1182.790) (-1181.591) [-1181.924] (-1180.497) -- 0:00:18
694500 -- (-1183.454) (-1182.728) (-1186.377) [-1182.299] * [-1181.912] (-1183.615) (-1183.504) (-1180.525) -- 0:00:18
695000 -- [-1186.350] (-1182.723) (-1182.433) (-1184.732) * [-1180.742] (-1184.313) (-1183.390) (-1181.315) -- 0:00:18
Average standard deviation of split frequencies: 0.008606
695500 -- (-1181.686) (-1181.786) [-1181.138] (-1181.816) * (-1181.050) [-1181.818] (-1185.410) (-1181.176) -- 0:00:18
696000 -- (-1181.772) (-1183.660) [-1181.773] (-1181.541) * (-1181.967) [-1181.573] (-1183.477) (-1184.896) -- 0:00:18
696500 -- (-1183.837) (-1184.299) [-1181.779] (-1184.392) * (-1182.469) (-1181.496) [-1183.362] (-1180.462) -- 0:00:18
697000 -- (-1181.342) (-1184.813) [-1182.054] (-1182.232) * (-1182.679) (-1181.692) [-1183.706] (-1184.049) -- 0:00:19
697500 -- [-1182.807] (-1184.140) (-1181.514) (-1181.264) * [-1183.992] (-1182.994) (-1182.691) (-1181.471) -- 0:00:19
698000 -- (-1187.979) (-1184.926) (-1183.048) [-1180.766] * (-1181.955) (-1182.752) (-1180.812) [-1183.198] -- 0:00:19
698500 -- (-1183.974) [-1181.738] (-1183.561) (-1183.387) * (-1182.289) (-1182.222) [-1180.812] (-1183.640) -- 0:00:18
699000 -- (-1183.992) [-1182.225] (-1182.982) (-1184.687) * (-1182.039) (-1180.977) [-1185.043] (-1184.459) -- 0:00:18
699500 -- (-1180.644) (-1183.415) (-1181.842) [-1182.107] * (-1182.068) (-1180.965) (-1184.643) [-1181.912] -- 0:00:18
700000 -- (-1184.930) (-1183.254) (-1183.019) [-1182.854] * (-1182.359) (-1183.009) [-1183.787] (-1186.295) -- 0:00:18
Average standard deviation of split frequencies: 0.009023
700500 -- (-1182.144) [-1182.651] (-1182.116) (-1184.482) * (-1183.986) (-1183.734) [-1182.373] (-1184.782) -- 0:00:18
701000 -- (-1183.203) [-1185.065] (-1181.244) (-1182.637) * (-1182.104) (-1188.243) [-1181.055] (-1195.504) -- 0:00:18
701500 -- (-1182.526) (-1182.532) [-1186.426] (-1183.675) * [-1182.959] (-1184.001) (-1185.591) (-1192.686) -- 0:00:18
702000 -- (-1182.496) (-1183.926) (-1183.672) [-1183.747] * (-1181.390) [-1183.590] (-1187.937) (-1186.948) -- 0:00:18
702500 -- (-1185.585) (-1181.876) (-1181.845) [-1183.628] * (-1186.993) [-1181.949] (-1188.159) (-1181.730) -- 0:00:18
703000 -- [-1182.810] (-1181.080) (-1180.883) (-1184.459) * [-1190.560] (-1180.701) (-1181.178) (-1181.831) -- 0:00:18
703500 -- (-1183.664) [-1181.652] (-1182.499) (-1181.873) * (-1185.608) (-1182.602) [-1181.119] (-1181.960) -- 0:00:18
704000 -- (-1187.607) (-1184.957) [-1180.888] (-1180.541) * (-1185.075) [-1182.704] (-1182.950) (-1181.780) -- 0:00:18
704500 -- (-1185.223) (-1182.802) (-1184.480) [-1182.893] * [-1183.665] (-1184.578) (-1187.348) (-1184.562) -- 0:00:18
705000 -- (-1182.291) (-1182.356) [-1182.849] (-1188.662) * (-1181.968) (-1182.286) [-1181.085] (-1181.699) -- 0:00:18
Average standard deviation of split frequencies: 0.008540
705500 -- (-1183.145) (-1182.636) [-1181.402] (-1183.504) * [-1181.452] (-1183.668) (-1182.165) (-1180.988) -- 0:00:18
706000 -- [-1180.741] (-1182.113) (-1185.519) (-1183.528) * (-1183.612) [-1183.271] (-1181.436) (-1182.206) -- 0:00:18
706500 -- (-1181.281) (-1183.632) [-1183.658] (-1182.824) * (-1181.093) (-1184.409) [-1182.731] (-1184.110) -- 0:00:18
707000 -- (-1183.564) (-1183.760) (-1183.057) [-1184.016] * (-1182.499) (-1183.355) [-1181.297] (-1183.101) -- 0:00:18
707500 -- (-1182.202) [-1182.281] (-1182.676) (-1181.240) * (-1184.311) (-1182.630) (-1183.325) [-1182.443] -- 0:00:18
708000 -- (-1182.748) [-1182.642] (-1183.697) (-1183.411) * (-1182.611) (-1183.994) [-1182.104] (-1183.496) -- 0:00:18
708500 -- (-1181.230) (-1181.798) (-1183.943) [-1184.518] * [-1181.252] (-1183.005) (-1184.226) (-1182.234) -- 0:00:18
709000 -- (-1182.208) (-1180.876) (-1182.159) [-1181.517] * (-1180.683) [-1182.574] (-1180.641) (-1181.099) -- 0:00:18
709500 -- (-1182.534) [-1181.943] (-1181.069) (-1181.517) * [-1182.174] (-1182.559) (-1181.031) (-1183.619) -- 0:00:18
710000 -- (-1182.808) [-1180.602] (-1181.513) (-1184.177) * (-1182.629) (-1182.310) [-1180.896] (-1183.174) -- 0:00:17
Average standard deviation of split frequencies: 0.008233
710500 -- (-1181.919) (-1180.903) (-1182.213) [-1185.183] * [-1181.062] (-1183.120) (-1184.222) (-1184.229) -- 0:00:17
711000 -- (-1181.596) (-1181.798) (-1180.645) [-1183.616] * (-1184.842) (-1183.537) [-1185.625] (-1184.270) -- 0:00:17
711500 -- [-1182.824] (-1183.666) (-1181.249) (-1182.666) * [-1184.946] (-1182.889) (-1180.606) (-1185.428) -- 0:00:17
712000 -- (-1182.111) (-1182.675) [-1185.510] (-1183.341) * (-1189.416) (-1181.965) [-1182.094] (-1185.291) -- 0:00:17
712500 -- (-1181.601) [-1184.039] (-1184.403) (-1183.605) * (-1184.117) (-1185.448) [-1182.389] (-1183.393) -- 0:00:17
713000 -- (-1181.856) (-1183.151) [-1182.545] (-1185.122) * [-1182.978] (-1186.632) (-1182.924) (-1182.700) -- 0:00:18
713500 -- (-1181.998) [-1186.615] (-1181.630) (-1185.824) * (-1182.302) [-1180.649] (-1181.873) (-1185.852) -- 0:00:18
714000 -- (-1181.955) [-1180.718] (-1182.921) (-1183.348) * [-1184.028] (-1182.489) (-1183.715) (-1186.191) -- 0:00:18
714500 -- (-1182.701) (-1186.387) [-1180.548] (-1184.725) * (-1184.088) [-1182.454] (-1186.281) (-1182.081) -- 0:00:17
715000 -- (-1184.006) (-1183.694) (-1181.651) [-1182.035] * [-1184.737] (-1181.902) (-1189.166) (-1183.625) -- 0:00:17
Average standard deviation of split frequencies: 0.007718
715500 -- [-1182.273] (-1184.541) (-1181.357) (-1182.453) * (-1183.320) (-1182.343) (-1180.727) [-1184.544] -- 0:00:17
716000 -- (-1181.022) [-1183.725] (-1181.994) (-1182.588) * [-1186.471] (-1182.212) (-1184.902) (-1183.318) -- 0:00:17
716500 -- (-1181.879) [-1183.398] (-1184.600) (-1186.496) * (-1182.727) [-1181.967] (-1184.031) (-1188.347) -- 0:00:17
717000 -- (-1181.440) [-1184.622] (-1187.136) (-1184.022) * (-1184.297) (-1183.256) [-1182.433] (-1185.415) -- 0:00:17
717500 -- (-1182.755) [-1184.501] (-1182.417) (-1182.094) * [-1182.603] (-1186.680) (-1181.363) (-1184.097) -- 0:00:17
718000 -- (-1181.981) (-1183.379) (-1182.199) [-1181.051] * (-1180.654) [-1181.954] (-1181.688) (-1181.423) -- 0:00:17
718500 -- (-1181.195) [-1182.147] (-1183.266) (-1182.799) * (-1184.152) [-1180.633] (-1182.509) (-1183.766) -- 0:00:17
719000 -- [-1181.892] (-1182.884) (-1181.745) (-1182.847) * (-1184.945) [-1182.270] (-1182.052) (-1185.374) -- 0:00:17
719500 -- [-1180.502] (-1182.832) (-1186.975) (-1183.888) * (-1185.790) [-1184.366] (-1181.849) (-1183.940) -- 0:00:17
720000 -- (-1185.944) (-1185.483) [-1183.197] (-1181.317) * (-1184.781) [-1184.399] (-1185.556) (-1183.443) -- 0:00:17
Average standard deviation of split frequencies: 0.007965
720500 -- (-1182.823) (-1183.856) [-1182.745] (-1180.922) * (-1184.722) [-1181.194] (-1184.551) (-1184.135) -- 0:00:17
721000 -- (-1182.767) [-1182.163] (-1182.066) (-1180.922) * (-1182.307) [-1181.243] (-1184.478) (-1187.052) -- 0:00:17
721500 -- (-1183.424) (-1184.378) [-1182.972] (-1185.603) * [-1183.148] (-1181.644) (-1180.769) (-1185.007) -- 0:00:17
722000 -- (-1182.090) (-1182.008) [-1181.018] (-1184.330) * [-1182.134] (-1182.956) (-1181.342) (-1180.455) -- 0:00:17
722500 -- [-1181.951] (-1181.121) (-1181.675) (-1185.242) * (-1182.071) [-1180.334] (-1183.560) (-1182.488) -- 0:00:17
723000 -- (-1185.705) [-1181.221] (-1181.953) (-1184.641) * [-1182.092] (-1181.925) (-1182.186) (-1183.728) -- 0:00:17
723500 -- (-1181.337) (-1186.350) (-1181.568) [-1184.675] * (-1182.521) (-1183.380) (-1182.832) [-1181.559] -- 0:00:17
724000 -- [-1184.510] (-1183.248) (-1182.420) (-1187.875) * (-1182.891) (-1181.296) [-1182.042] (-1182.987) -- 0:00:17
724500 -- [-1181.318] (-1182.082) (-1182.897) (-1186.903) * (-1184.825) [-1187.250] (-1184.023) (-1182.927) -- 0:00:17
725000 -- [-1181.811] (-1183.507) (-1183.598) (-1181.196) * [-1182.326] (-1182.087) (-1185.421) (-1182.928) -- 0:00:17
Average standard deviation of split frequencies: 0.007720
725500 -- [-1182.062] (-1182.819) (-1182.119) (-1180.761) * (-1182.978) [-1183.543] (-1184.792) (-1182.497) -- 0:00:17
726000 -- (-1182.631) [-1182.697] (-1181.797) (-1183.829) * [-1181.641] (-1183.706) (-1182.403) (-1184.107) -- 0:00:16
726500 -- (-1183.293) (-1184.110) [-1183.487] (-1182.240) * (-1181.718) [-1183.132] (-1183.108) (-1184.104) -- 0:00:16
727000 -- [-1181.324] (-1182.668) (-1180.845) (-1181.914) * (-1182.091) (-1183.225) [-1183.223] (-1183.010) -- 0:00:16
727500 -- [-1181.775] (-1181.302) (-1184.138) (-1183.111) * [-1182.766] (-1183.592) (-1183.127) (-1184.135) -- 0:00:16
728000 -- [-1182.445] (-1185.180) (-1183.160) (-1184.363) * (-1182.202) (-1182.515) [-1182.172] (-1181.612) -- 0:00:16
728500 -- (-1181.545) [-1185.225] (-1182.600) (-1187.455) * (-1185.054) (-1180.623) [-1184.583] (-1180.927) -- 0:00:16
729000 -- (-1181.466) (-1186.477) [-1182.521] (-1183.936) * [-1185.718] (-1181.160) (-1182.111) (-1185.669) -- 0:00:16
729500 -- (-1181.163) (-1185.577) [-1182.647] (-1183.729) * (-1185.999) [-1181.935] (-1183.866) (-1185.297) -- 0:00:17
730000 -- (-1182.462) (-1183.400) (-1184.407) [-1181.577] * (-1182.259) [-1182.452] (-1184.218) (-1185.123) -- 0:00:17
Average standard deviation of split frequencies: 0.007661
730500 -- (-1182.869) (-1181.146) (-1182.641) [-1181.710] * (-1181.379) (-1181.132) (-1183.426) [-1181.021] -- 0:00:16
731000 -- (-1184.953) (-1181.225) (-1182.681) [-1183.072] * [-1182.113] (-1181.124) (-1182.593) (-1185.910) -- 0:00:16
731500 -- [-1186.428] (-1186.232) (-1181.607) (-1182.224) * (-1183.810) (-1181.481) [-1180.291] (-1186.395) -- 0:00:16
732000 -- (-1187.291) (-1180.696) [-1183.699] (-1183.374) * (-1180.850) (-1182.494) (-1181.427) [-1184.971] -- 0:00:16
732500 -- (-1183.318) (-1181.676) [-1182.389] (-1189.286) * (-1181.233) (-1182.558) [-1185.278] (-1184.042) -- 0:00:16
733000 -- (-1184.689) (-1182.373) [-1184.063] (-1185.828) * (-1180.927) (-1181.209) (-1183.262) [-1184.170] -- 0:00:16
733500 -- [-1180.872] (-1181.830) (-1183.921) (-1184.918) * (-1183.752) (-1181.630) [-1187.806] (-1186.941) -- 0:00:16
734000 -- (-1184.021) (-1181.982) (-1183.064) [-1186.268] * (-1183.632) (-1182.810) (-1183.734) [-1180.838] -- 0:00:16
734500 -- (-1184.089) (-1182.063) (-1183.143) [-1186.268] * (-1182.308) (-1183.333) (-1182.644) [-1181.454] -- 0:00:16
735000 -- (-1182.562) [-1183.506] (-1185.229) (-1181.324) * [-1181.540] (-1193.279) (-1181.104) (-1181.296) -- 0:00:16
Average standard deviation of split frequencies: 0.007406
735500 -- (-1182.413) (-1183.047) (-1181.969) [-1182.432] * [-1181.675] (-1181.726) (-1181.798) (-1181.809) -- 0:00:16
736000 -- (-1183.262) (-1182.617) (-1182.872) [-1182.143] * (-1182.513) [-1182.816] (-1182.568) (-1183.774) -- 0:00:16
736500 -- (-1184.887) (-1182.987) [-1182.386] (-1182.660) * [-1182.228] (-1180.652) (-1186.265) (-1182.260) -- 0:00:16
737000 -- (-1182.787) (-1186.049) [-1182.427] (-1182.438) * (-1183.277) (-1184.101) (-1185.067) [-1181.861] -- 0:00:16
737500 -- (-1184.875) (-1185.502) (-1184.507) [-1184.066] * [-1181.493] (-1182.552) (-1180.707) (-1182.301) -- 0:00:16
738000 -- (-1182.053) (-1188.704) (-1183.833) [-1181.423] * (-1183.645) (-1184.077) (-1182.204) [-1180.939] -- 0:00:16
738500 -- [-1181.903] (-1186.892) (-1183.588) (-1182.599) * (-1183.344) [-1182.297] (-1183.979) (-1182.770) -- 0:00:16
739000 -- (-1184.278) [-1183.467] (-1185.378) (-1188.942) * (-1181.367) (-1181.976) (-1183.128) [-1181.817] -- 0:00:16
739500 -- (-1185.409) (-1182.981) (-1186.764) [-1182.303] * (-1185.223) (-1181.616) [-1185.348] (-1182.668) -- 0:00:16
740000 -- (-1181.636) (-1184.317) (-1184.065) [-1180.980] * (-1183.289) [-1184.147] (-1186.673) (-1186.448) -- 0:00:16
Average standard deviation of split frequencies: 0.006961
740500 -- (-1181.817) [-1180.947] (-1182.673) (-1182.025) * (-1183.064) (-1186.507) (-1187.025) [-1182.304] -- 0:00:16
741000 -- (-1183.370) (-1182.064) [-1182.729] (-1186.182) * (-1183.984) [-1186.677] (-1180.794) (-1182.599) -- 0:00:16
741500 -- (-1182.550) [-1182.921] (-1185.088) (-1185.012) * (-1182.258) (-1183.111) [-1182.328] (-1182.913) -- 0:00:16
742000 -- (-1181.459) [-1181.475] (-1185.993) (-1183.438) * [-1185.129] (-1180.768) (-1184.003) (-1181.327) -- 0:00:15
742500 -- (-1186.876) (-1188.356) [-1188.794] (-1183.303) * (-1180.928) (-1180.792) (-1183.504) [-1180.917] -- 0:00:15
743000 -- (-1181.014) (-1185.379) [-1183.584] (-1186.465) * (-1181.652) (-1183.099) (-1181.979) [-1181.915] -- 0:00:15
743500 -- [-1183.853] (-1186.906) (-1181.761) (-1184.972) * (-1181.976) (-1183.872) (-1183.337) [-1183.811] -- 0:00:15
744000 -- [-1183.126] (-1185.460) (-1182.380) (-1182.934) * (-1182.373) (-1184.706) [-1182.278] (-1187.126) -- 0:00:15
744500 -- (-1182.625) (-1181.995) (-1183.893) [-1182.850] * [-1182.163] (-1181.358) (-1181.201) (-1181.582) -- 0:00:15
745000 -- (-1181.512) (-1182.046) (-1183.529) [-1182.708] * (-1182.001) (-1182.211) [-1191.916] (-1185.421) -- 0:00:15
Average standard deviation of split frequencies: 0.007346
745500 -- [-1182.357] (-1182.777) (-1184.198) (-1184.123) * (-1182.059) [-1182.856] (-1183.094) (-1182.903) -- 0:00:16
746000 -- (-1181.136) [-1182.016] (-1182.732) (-1183.380) * (-1183.867) [-1180.994] (-1181.508) (-1182.262) -- 0:00:16
746500 -- (-1184.264) (-1181.626) [-1182.777] (-1181.524) * (-1182.895) [-1183.715] (-1184.424) (-1180.941) -- 0:00:15
747000 -- (-1185.006) [-1181.871] (-1181.947) (-1181.539) * (-1181.642) (-1182.119) (-1186.241) [-1187.214] -- 0:00:15
747500 -- [-1186.594] (-1182.727) (-1183.991) (-1183.994) * (-1182.645) [-1182.926] (-1187.023) (-1182.627) -- 0:00:15
748000 -- [-1182.143] (-1186.028) (-1182.390) (-1181.252) * (-1181.317) (-1181.566) (-1186.602) [-1184.128] -- 0:00:15
748500 -- [-1181.057] (-1182.405) (-1183.333) (-1181.777) * (-1180.524) (-1182.211) [-1183.841] (-1183.457) -- 0:00:15
749000 -- (-1187.333) [-1182.618] (-1190.210) (-1182.698) * (-1181.913) (-1184.890) (-1183.097) [-1181.697] -- 0:00:15
749500 -- [-1185.144] (-1184.557) (-1185.774) (-1183.047) * [-1180.426] (-1183.139) (-1184.739) (-1185.596) -- 0:00:15
750000 -- (-1183.613) (-1181.735) (-1180.464) [-1181.278] * (-1181.406) [-1181.507] (-1183.251) (-1181.639) -- 0:00:15
Average standard deviation of split frequencies: 0.006947
750500 -- (-1184.965) [-1182.702] (-1184.212) (-1182.542) * [-1182.095] (-1185.515) (-1183.498) (-1183.243) -- 0:00:15
751000 -- (-1182.604) [-1183.336] (-1182.365) (-1185.243) * (-1181.789) (-1182.363) [-1182.890] (-1184.187) -- 0:00:15
751500 -- (-1186.663) (-1181.122) [-1184.195] (-1182.461) * (-1182.022) (-1182.779) (-1183.417) [-1182.641] -- 0:00:15
752000 -- [-1182.086] (-1181.012) (-1183.940) (-1186.482) * [-1181.501] (-1181.370) (-1185.491) (-1183.584) -- 0:00:15
752500 -- (-1183.216) [-1182.383] (-1184.877) (-1180.769) * [-1180.646] (-1183.841) (-1182.864) (-1181.238) -- 0:00:15
753000 -- [-1186.747] (-1183.050) (-1181.227) (-1182.115) * (-1181.938) [-1181.463] (-1182.227) (-1183.004) -- 0:00:15
753500 -- (-1182.830) [-1183.433] (-1181.444) (-1182.288) * (-1181.506) [-1180.460] (-1181.566) (-1183.092) -- 0:00:15
754000 -- (-1182.086) [-1180.549] (-1184.318) (-1182.804) * (-1181.701) (-1180.953) (-1184.214) [-1183.000] -- 0:00:15
754500 -- [-1183.020] (-1181.188) (-1182.142) (-1182.828) * (-1182.129) (-1182.043) [-1184.567] (-1181.256) -- 0:00:15
755000 -- (-1182.456) (-1182.032) [-1182.488] (-1184.889) * (-1182.974) (-1187.255) [-1181.463] (-1182.986) -- 0:00:15
Average standard deviation of split frequencies: 0.006859
755500 -- (-1182.372) (-1183.502) [-1182.588] (-1182.870) * (-1182.160) (-1185.815) (-1182.796) [-1181.480] -- 0:00:15
756000 -- (-1182.389) [-1181.962] (-1183.755) (-1183.471) * (-1186.339) (-1185.007) (-1185.431) [-1181.589] -- 0:00:15
756500 -- (-1183.106) [-1184.125] (-1182.397) (-1182.390) * [-1181.006] (-1183.844) (-1181.237) (-1180.578) -- 0:00:15
757000 -- (-1184.662) [-1184.142] (-1183.811) (-1184.182) * (-1182.976) (-1185.803) (-1184.475) [-1182.376] -- 0:00:15
757500 -- (-1182.897) (-1181.501) (-1183.119) [-1182.512] * (-1182.303) (-1185.433) [-1184.561] (-1181.031) -- 0:00:15
758000 -- (-1184.165) (-1182.079) (-1183.986) [-1181.319] * [-1183.168] (-1182.142) (-1185.901) (-1183.418) -- 0:00:15
758500 -- (-1183.347) [-1183.079] (-1183.514) (-1183.256) * (-1180.648) [-1183.142] (-1183.737) (-1184.097) -- 0:00:14
759000 -- (-1182.490) (-1181.079) (-1182.153) [-1184.005] * (-1186.756) (-1181.941) (-1181.785) [-1183.100] -- 0:00:14
759500 -- (-1182.467) [-1181.251] (-1183.426) (-1186.355) * [-1181.231] (-1185.298) (-1181.427) (-1184.243) -- 0:00:14
760000 -- (-1184.220) [-1182.028] (-1182.360) (-1182.564) * (-1182.116) [-1182.142] (-1180.442) (-1183.056) -- 0:00:14
Average standard deviation of split frequencies: 0.006701
760500 -- (-1185.188) (-1184.277) (-1184.548) [-1181.572] * (-1181.891) [-1182.375] (-1183.892) (-1182.536) -- 0:00:14
761000 -- [-1181.811] (-1182.583) (-1185.540) (-1182.720) * (-1181.879) [-1184.256] (-1182.024) (-1184.369) -- 0:00:14
761500 -- (-1183.399) [-1181.802] (-1182.556) (-1185.655) * (-1188.183) (-1183.053) (-1181.743) [-1184.065] -- 0:00:15
762000 -- [-1181.589] (-1183.450) (-1183.441) (-1185.867) * (-1185.770) (-1184.579) (-1184.980) [-1181.113] -- 0:00:14
762500 -- (-1182.082) (-1182.039) [-1184.081] (-1183.065) * (-1185.181) (-1183.551) (-1180.941) [-1181.190] -- 0:00:14
763000 -- (-1182.318) (-1182.541) [-1180.829] (-1183.158) * (-1185.514) [-1185.450] (-1181.248) (-1182.878) -- 0:00:14
763500 -- (-1184.954) (-1181.694) (-1182.281) [-1180.823] * (-1183.559) (-1186.259) (-1183.511) [-1180.770] -- 0:00:14
764000 -- (-1181.145) (-1183.669) (-1181.069) [-1180.579] * [-1185.875] (-1187.254) (-1186.944) (-1181.234) -- 0:00:14
764500 -- [-1180.775] (-1185.017) (-1180.389) (-1180.959) * (-1186.472) (-1181.589) (-1183.843) [-1182.443] -- 0:00:14
765000 -- (-1181.918) [-1184.401] (-1183.520) (-1184.259) * (-1182.182) [-1185.859] (-1183.387) (-1183.964) -- 0:00:14
Average standard deviation of split frequencies: 0.006552
765500 -- (-1183.648) (-1183.836) [-1184.546] (-1189.872) * [-1181.916] (-1185.223) (-1181.053) (-1183.229) -- 0:00:14
766000 -- (-1184.060) (-1181.401) (-1186.256) [-1185.154] * [-1182.397] (-1185.121) (-1183.035) (-1182.874) -- 0:00:14
766500 -- (-1184.095) (-1183.131) (-1182.558) [-1181.886] * [-1181.506] (-1182.554) (-1180.930) (-1181.151) -- 0:00:14
767000 -- (-1181.939) (-1182.208) (-1183.969) [-1182.623] * (-1182.957) (-1181.937) [-1181.983] (-1181.333) -- 0:00:14
767500 -- (-1182.579) (-1182.159) (-1181.246) [-1181.496] * (-1184.438) (-1187.233) (-1183.271) [-1184.772] -- 0:00:14
768000 -- (-1182.096) (-1183.356) (-1184.067) [-1183.576] * [-1184.271] (-1184.055) (-1184.853) (-1184.070) -- 0:00:14
768500 -- (-1183.371) (-1182.265) [-1183.734] (-1180.765) * (-1182.758) (-1186.412) [-1181.388] (-1185.919) -- 0:00:14
769000 -- (-1181.941) (-1182.660) (-1186.674) [-1181.246] * (-1182.727) [-1185.946] (-1182.651) (-1184.929) -- 0:00:14
769500 -- [-1181.655] (-1181.821) (-1183.360) (-1180.915) * [-1183.444] (-1185.667) (-1183.285) (-1183.890) -- 0:00:14
770000 -- (-1181.539) (-1181.345) (-1182.739) [-1181.726] * (-1182.593) (-1182.902) [-1182.031] (-1182.462) -- 0:00:14
Average standard deviation of split frequencies: 0.006980
770500 -- [-1181.249] (-1182.543) (-1181.400) (-1183.417) * (-1181.892) [-1191.358] (-1180.998) (-1183.232) -- 0:00:14
771000 -- (-1184.804) (-1183.467) (-1181.129) [-1182.362] * (-1182.518) [-1184.574] (-1184.717) (-1183.544) -- 0:00:14
771500 -- (-1181.746) [-1182.442] (-1182.011) (-1182.231) * (-1180.632) (-1182.875) [-1182.795] (-1182.416) -- 0:00:14
772000 -- [-1183.500] (-1183.949) (-1182.856) (-1183.396) * (-1183.425) [-1182.128] (-1186.013) (-1183.745) -- 0:00:14
772500 -- (-1183.815) (-1183.368) [-1186.873] (-1183.610) * (-1183.390) [-1182.594] (-1183.449) (-1186.788) -- 0:00:14
773000 -- [-1184.939] (-1181.524) (-1182.992) (-1182.958) * (-1182.146) (-1181.397) (-1183.940) [-1186.625] -- 0:00:14
773500 -- [-1182.086] (-1183.776) (-1181.565) (-1180.363) * [-1182.744] (-1184.998) (-1181.973) (-1184.098) -- 0:00:14
774000 -- (-1184.496) [-1183.246] (-1181.528) (-1181.327) * [-1180.345] (-1184.623) (-1182.441) (-1187.767) -- 0:00:14
774500 -- (-1181.997) [-1182.133] (-1181.714) (-1183.782) * [-1180.974] (-1185.600) (-1181.820) (-1187.661) -- 0:00:13
775000 -- (-1180.839) (-1186.268) (-1180.879) [-1181.950] * (-1182.624) (-1182.679) [-1183.093] (-1183.310) -- 0:00:13
Average standard deviation of split frequencies: 0.006754
775500 -- (-1180.933) [-1181.950] (-1181.037) (-1182.720) * [-1183.943] (-1184.611) (-1183.949) (-1182.067) -- 0:00:13
776000 -- (-1181.164) [-1180.841] (-1181.523) (-1181.659) * (-1191.012) (-1189.041) [-1182.455] (-1182.163) -- 0:00:13
776500 -- (-1181.306) (-1185.242) [-1182.081] (-1180.509) * (-1181.713) (-1189.358) [-1184.494] (-1182.416) -- 0:00:13
777000 -- (-1182.114) [-1184.962] (-1180.722) (-1181.133) * (-1181.865) (-1186.182) [-1182.014] (-1182.463) -- 0:00:13
777500 -- (-1185.499) [-1185.331] (-1180.680) (-1183.227) * (-1180.940) [-1185.013] (-1182.525) (-1182.634) -- 0:00:13
778000 -- (-1182.086) (-1181.722) [-1182.284] (-1183.897) * (-1180.323) (-1183.577) [-1182.943] (-1185.711) -- 0:00:13
778500 -- (-1182.850) [-1180.636] (-1182.789) (-1185.357) * [-1181.329] (-1180.883) (-1184.844) (-1183.197) -- 0:00:13
779000 -- [-1183.051] (-1180.815) (-1183.607) (-1181.454) * (-1184.748) (-1184.839) [-1181.415] (-1183.810) -- 0:00:13
779500 -- (-1182.145) [-1182.383] (-1184.744) (-1181.572) * (-1183.721) [-1181.114] (-1183.920) (-1183.562) -- 0:00:13
780000 -- (-1182.352) (-1182.545) (-1181.930) [-1181.896] * (-1181.674) [-1182.931] (-1185.253) (-1184.943) -- 0:00:13
Average standard deviation of split frequencies: 0.006074
780500 -- [-1181.160] (-1182.424) (-1182.907) (-1181.246) * [-1180.544] (-1181.438) (-1185.149) (-1187.588) -- 0:00:13
781000 -- [-1184.945] (-1184.254) (-1182.815) (-1182.390) * (-1182.360) [-1181.523] (-1185.096) (-1181.487) -- 0:00:13
781500 -- (-1182.964) [-1182.848] (-1182.777) (-1181.782) * (-1182.432) [-1183.359] (-1185.297) (-1181.812) -- 0:00:13
782000 -- (-1182.455) [-1181.642] (-1181.701) (-1180.489) * [-1180.665] (-1180.528) (-1186.045) (-1184.245) -- 0:00:13
782500 -- [-1181.949] (-1184.288) (-1182.833) (-1181.305) * [-1182.343] (-1184.548) (-1182.138) (-1183.723) -- 0:00:13
783000 -- [-1181.059] (-1183.592) (-1184.843) (-1180.999) * (-1182.676) [-1182.912] (-1182.680) (-1181.722) -- 0:00:13
783500 -- (-1182.140) (-1182.375) (-1185.775) [-1181.683] * (-1181.812) [-1184.907] (-1183.619) (-1184.492) -- 0:00:13
784000 -- (-1181.075) (-1183.152) (-1182.404) [-1182.749] * (-1181.521) (-1181.464) [-1180.758] (-1183.511) -- 0:00:13
784500 -- (-1181.785) (-1183.305) (-1182.281) [-1181.631] * (-1180.492) (-1184.365) [-1181.315] (-1184.950) -- 0:00:13
785000 -- (-1182.448) [-1181.970] (-1184.929) (-1181.485) * (-1184.637) (-1182.731) [-1182.015] (-1183.995) -- 0:00:13
Average standard deviation of split frequencies: 0.005751
785500 -- [-1181.471] (-1182.923) (-1184.191) (-1182.462) * (-1185.804) (-1181.853) [-1182.423] (-1184.129) -- 0:00:13
786000 -- (-1183.951) (-1182.612) (-1181.347) [-1182.177] * [-1182.117] (-1181.637) (-1184.499) (-1183.802) -- 0:00:13
786500 -- (-1182.836) (-1182.859) (-1186.847) [-1181.758] * [-1181.317] (-1181.760) (-1181.362) (-1182.673) -- 0:00:13
787000 -- (-1185.384) [-1182.269] (-1183.637) (-1182.564) * (-1188.104) (-1181.252) (-1181.940) [-1183.731] -- 0:00:13
787500 -- [-1180.640] (-1182.689) (-1182.816) (-1183.125) * (-1182.017) [-1188.130] (-1182.821) (-1181.895) -- 0:00:13
788000 -- [-1184.042] (-1183.729) (-1183.330) (-1184.842) * (-1181.447) (-1183.593) (-1182.226) [-1181.239] -- 0:00:13
788500 -- (-1181.844) (-1180.526) [-1182.011] (-1183.553) * (-1183.120) (-1181.583) [-1183.257] (-1184.811) -- 0:00:13
789000 -- (-1187.879) (-1184.208) (-1182.351) [-1183.768] * (-1185.712) [-1189.805] (-1181.786) (-1182.119) -- 0:00:13
789500 -- [-1181.704] (-1183.723) (-1184.123) (-1187.576) * (-1182.412) (-1183.673) (-1185.484) [-1182.749] -- 0:00:13
790000 -- (-1181.116) (-1184.021) (-1184.578) [-1183.373] * [-1182.192] (-1181.076) (-1184.446) (-1182.770) -- 0:00:13
Average standard deviation of split frequencies: 0.005892
790500 -- (-1182.995) (-1181.586) (-1181.234) [-1182.614] * (-1182.977) [-1184.119] (-1182.894) (-1183.624) -- 0:00:12
791000 -- (-1182.733) [-1183.787] (-1181.830) (-1181.705) * (-1185.398) [-1182.038] (-1183.020) (-1184.799) -- 0:00:12
791500 -- [-1181.193] (-1184.128) (-1181.628) (-1181.958) * (-1183.989) (-1180.932) (-1184.739) [-1183.265] -- 0:00:12
792000 -- (-1182.643) (-1183.711) (-1181.547) [-1182.384] * (-1181.824) (-1183.000) (-1188.875) [-1182.090] -- 0:00:12
792500 -- (-1181.761) (-1187.467) [-1183.145] (-1181.520) * (-1182.912) (-1184.405) (-1184.347) [-1185.148] -- 0:00:12
793000 -- (-1183.605) [-1183.811] (-1183.505) (-1180.943) * (-1181.444) [-1184.396] (-1186.516) (-1183.625) -- 0:00:12
793500 -- [-1184.549] (-1185.489) (-1182.632) (-1181.786) * (-1181.436) [-1181.229] (-1182.057) (-1183.224) -- 0:00:13
794000 -- (-1181.776) (-1181.478) (-1181.868) [-1184.085] * (-1181.444) (-1182.172) [-1183.640] (-1182.481) -- 0:00:12
794500 -- (-1181.451) (-1183.006) (-1181.306) [-1182.998] * [-1181.605] (-1183.307) (-1183.560) (-1181.180) -- 0:00:12
795000 -- (-1181.064) [-1181.757] (-1181.059) (-1182.320) * (-1186.614) (-1181.658) (-1181.724) [-1181.218] -- 0:00:12
Average standard deviation of split frequencies: 0.005887
795500 -- (-1180.969) (-1182.834) [-1181.763] (-1182.241) * [-1181.178] (-1181.813) (-1181.364) (-1182.309) -- 0:00:12
796000 -- [-1180.607] (-1184.973) (-1181.781) (-1182.213) * [-1183.848] (-1180.682) (-1182.716) (-1184.131) -- 0:00:12
796500 -- (-1181.722) [-1180.661] (-1183.638) (-1182.808) * (-1184.138) (-1184.850) (-1184.960) [-1185.921] -- 0:00:12
797000 -- (-1182.800) (-1187.275) [-1183.701] (-1182.160) * (-1182.135) (-1182.348) (-1181.822) [-1182.271] -- 0:00:12
797500 -- (-1184.027) [-1181.404] (-1181.202) (-1181.261) * [-1183.446] (-1183.380) (-1181.994) (-1183.059) -- 0:00:12
798000 -- (-1181.395) (-1181.369) (-1181.565) [-1183.926] * (-1181.736) [-1181.137] (-1183.656) (-1181.568) -- 0:00:12
798500 -- (-1181.441) (-1183.821) [-1180.895] (-1183.034) * (-1182.086) (-1182.662) [-1182.732] (-1181.034) -- 0:00:12
799000 -- (-1182.290) (-1181.014) [-1183.729] (-1183.678) * (-1183.284) [-1180.492] (-1182.477) (-1181.034) -- 0:00:12
799500 -- (-1182.648) [-1181.664] (-1184.138) (-1185.595) * (-1182.126) (-1183.611) (-1182.808) [-1182.226] -- 0:00:12
800000 -- (-1183.931) [-1182.139] (-1181.254) (-1183.036) * (-1184.287) [-1181.178] (-1182.248) (-1183.098) -- 0:00:12
Average standard deviation of split frequencies: 0.006182
800500 -- (-1184.081) [-1182.580] (-1185.698) (-1182.691) * (-1183.413) (-1181.458) (-1182.444) [-1182.996] -- 0:00:12
801000 -- [-1181.771] (-1183.522) (-1181.887) (-1181.943) * (-1185.187) (-1181.586) [-1181.522] (-1182.218) -- 0:00:12
801500 -- (-1183.525) [-1181.359] (-1181.365) (-1181.158) * (-1182.607) (-1181.495) (-1181.082) [-1185.059] -- 0:00:12
802000 -- (-1181.114) (-1183.993) [-1183.554] (-1182.365) * [-1182.118] (-1184.834) (-1181.541) (-1181.047) -- 0:00:12
802500 -- [-1184.687] (-1183.298) (-1186.165) (-1181.779) * (-1182.308) (-1186.306) (-1181.200) [-1187.495] -- 0:00:12
803000 -- (-1182.208) [-1181.396] (-1180.835) (-1184.193) * (-1183.102) (-1181.149) [-1181.825] (-1188.026) -- 0:00:12
803500 -- (-1183.241) [-1182.540] (-1181.761) (-1184.801) * (-1182.463) [-1183.384] (-1183.370) (-1186.458) -- 0:00:12
804000 -- [-1183.399] (-1184.464) (-1183.031) (-1184.878) * [-1183.587] (-1181.610) (-1188.283) (-1184.949) -- 0:00:12
804500 -- (-1182.251) (-1184.661) [-1183.548] (-1185.657) * (-1181.907) (-1188.537) [-1182.009] (-1184.872) -- 0:00:12
805000 -- (-1188.802) (-1186.372) [-1184.342] (-1189.672) * [-1186.547] (-1181.153) (-1181.385) (-1184.369) -- 0:00:12
Average standard deviation of split frequencies: 0.005642
805500 -- (-1184.394) [-1182.479] (-1181.838) (-1183.595) * (-1182.411) (-1181.991) [-1181.300] (-1182.561) -- 0:00:12
806000 -- (-1181.429) [-1182.134] (-1184.686) (-1184.074) * (-1183.341) (-1181.008) (-1181.332) [-1181.392] -- 0:00:12
806500 -- [-1181.850] (-1181.154) (-1184.872) (-1183.278) * (-1184.240) (-1182.402) (-1182.946) [-1182.403] -- 0:00:11
807000 -- (-1185.110) [-1183.944] (-1183.455) (-1181.506) * (-1182.858) [-1181.884] (-1184.297) (-1182.036) -- 0:00:11
807500 -- [-1184.605] (-1187.753) (-1181.445) (-1181.462) * [-1181.998] (-1181.870) (-1183.536) (-1184.009) -- 0:00:11
808000 -- (-1187.440) [-1182.420] (-1182.984) (-1182.741) * (-1186.644) [-1181.700] (-1180.515) (-1184.013) -- 0:00:11
808500 -- (-1185.211) (-1181.155) [-1183.833] (-1184.219) * (-1181.922) (-1181.466) [-1181.339] (-1184.467) -- 0:00:11
809000 -- (-1185.082) (-1183.954) [-1182.979] (-1184.670) * [-1181.131] (-1183.289) (-1182.195) (-1185.464) -- 0:00:11
809500 -- (-1184.532) (-1183.849) (-1182.661) [-1184.092] * [-1182.146] (-1183.370) (-1183.857) (-1183.633) -- 0:00:11
810000 -- (-1184.488) (-1187.284) [-1182.283] (-1186.737) * (-1182.309) [-1184.979] (-1182.692) (-1184.299) -- 0:00:11
Average standard deviation of split frequencies: 0.005712
810500 -- [-1188.777] (-1182.964) (-1180.661) (-1182.128) * (-1182.776) (-1186.833) (-1184.858) [-1183.097] -- 0:00:11
811000 -- (-1189.263) [-1184.341] (-1181.007) (-1181.482) * [-1186.676] (-1188.923) (-1185.145) (-1184.370) -- 0:00:11
811500 -- (-1181.604) [-1181.643] (-1183.793) (-1181.795) * (-1183.285) [-1182.956] (-1185.646) (-1182.725) -- 0:00:11
812000 -- (-1180.389) (-1184.176) (-1184.183) [-1183.041] * (-1180.638) [-1182.552] (-1185.881) (-1183.913) -- 0:00:11
812500 -- [-1183.028] (-1182.878) (-1183.887) (-1186.630) * [-1180.625] (-1183.772) (-1181.960) (-1182.631) -- 0:00:11
813000 -- [-1180.841] (-1183.370) (-1182.171) (-1184.320) * (-1183.019) (-1180.813) (-1182.070) [-1183.548] -- 0:00:11
813500 -- [-1183.115] (-1184.262) (-1181.932) (-1184.160) * [-1181.003] (-1182.728) (-1182.525) (-1187.477) -- 0:00:11
814000 -- (-1181.752) (-1181.393) [-1182.045] (-1181.049) * (-1182.504) (-1181.618) [-1185.716] (-1185.399) -- 0:00:11
814500 -- (-1181.974) (-1182.077) [-1183.408] (-1181.105) * (-1181.861) (-1180.988) [-1184.259] (-1183.246) -- 0:00:11
815000 -- (-1182.599) (-1183.113) (-1182.576) [-1186.266] * (-1181.599) (-1180.628) [-1182.839] (-1183.030) -- 0:00:11
Average standard deviation of split frequencies: 0.005777
815500 -- (-1183.190) [-1181.099] (-1182.903) (-1183.573) * [-1181.703] (-1180.949) (-1183.263) (-1183.239) -- 0:00:11
816000 -- (-1186.323) [-1180.987] (-1184.884) (-1184.255) * (-1183.899) (-1185.690) (-1182.751) [-1184.091] -- 0:00:11
816500 -- (-1185.308) (-1182.314) [-1182.351] (-1182.658) * (-1184.876) (-1185.023) (-1185.181) [-1184.438] -- 0:00:11
817000 -- (-1186.552) (-1180.805) (-1181.948) [-1182.385] * (-1183.827) (-1182.700) (-1188.416) [-1181.742] -- 0:00:11
817500 -- (-1181.783) (-1183.440) [-1183.496] (-1182.850) * (-1181.073) (-1183.172) [-1183.711] (-1183.810) -- 0:00:11
818000 -- (-1184.868) (-1181.289) (-1182.772) [-1186.926] * (-1181.483) (-1187.913) [-1182.798] (-1184.380) -- 0:00:11
818500 -- [-1181.671] (-1181.676) (-1182.809) (-1184.697) * [-1182.093] (-1182.453) (-1182.025) (-1184.615) -- 0:00:11
819000 -- (-1186.077) (-1183.301) (-1183.864) [-1181.555] * (-1180.788) [-1183.511] (-1185.065) (-1187.040) -- 0:00:11
819500 -- (-1183.935) [-1182.782] (-1184.904) (-1184.772) * (-1180.758) (-1181.479) (-1181.158) [-1180.479] -- 0:00:11
820000 -- [-1183.095] (-1182.958) (-1181.601) (-1183.757) * (-1183.247) [-1180.739] (-1182.361) (-1182.863) -- 0:00:11
Average standard deviation of split frequencies: 0.005816
820500 -- (-1181.983) [-1184.564] (-1183.439) (-1181.840) * (-1182.277) [-1180.989] (-1181.070) (-1182.273) -- 0:00:11
821000 -- (-1183.110) (-1184.038) (-1181.846) [-1181.677] * (-1182.128) (-1184.640) [-1180.541] (-1184.618) -- 0:00:11
821500 -- (-1181.867) (-1185.656) (-1182.818) [-1182.191] * (-1182.639) (-1183.422) (-1180.553) [-1182.329] -- 0:00:11
822000 -- (-1185.032) (-1181.913) [-1184.032] (-1184.593) * (-1180.777) (-1182.489) [-1181.479] (-1182.959) -- 0:00:11
822500 -- (-1182.893) (-1183.035) [-1186.185] (-1182.247) * [-1180.719] (-1181.958) (-1182.543) (-1183.136) -- 0:00:11
823000 -- [-1181.485] (-1183.736) (-1182.479) (-1182.165) * (-1182.468) [-1183.121] (-1182.569) (-1182.732) -- 0:00:10
823500 -- (-1182.708) (-1182.070) [-1183.439] (-1184.708) * (-1183.139) [-1182.966] (-1183.132) (-1182.817) -- 0:00:10
824000 -- (-1181.937) (-1183.876) [-1184.530] (-1186.576) * (-1183.001) (-1181.468) [-1182.462] (-1182.156) -- 0:00:10
824500 -- (-1181.930) (-1182.629) [-1183.540] (-1182.089) * (-1182.521) (-1181.230) [-1182.605] (-1183.684) -- 0:00:10
825000 -- (-1184.049) (-1185.902) (-1180.971) [-1180.951] * [-1181.494] (-1180.390) (-1183.165) (-1181.854) -- 0:00:10
Average standard deviation of split frequencies: 0.005885
825500 -- (-1184.765) (-1184.678) [-1182.478] (-1182.125) * (-1182.780) (-1181.744) [-1186.034] (-1186.934) -- 0:00:10
826000 -- (-1183.378) (-1182.680) [-1182.000] (-1181.824) * (-1189.504) (-1180.551) [-1181.814] (-1181.274) -- 0:00:10
826500 -- (-1184.091) (-1187.221) [-1184.870] (-1182.125) * (-1185.439) (-1180.816) [-1181.254] (-1182.252) -- 0:00:10
827000 -- (-1183.422) [-1181.756] (-1184.985) (-1183.343) * [-1186.176] (-1182.383) (-1182.616) (-1181.042) -- 0:00:10
827500 -- (-1184.300) (-1184.285) [-1183.676] (-1182.413) * [-1182.490] (-1187.116) (-1181.605) (-1180.830) -- 0:00:10
828000 -- (-1184.472) (-1181.829) (-1181.944) [-1180.851] * [-1181.675] (-1184.229) (-1183.234) (-1180.830) -- 0:00:10
828500 -- (-1182.897) (-1186.000) (-1180.937) [-1182.783] * (-1181.758) [-1181.229] (-1183.017) (-1181.596) -- 0:00:10
829000 -- (-1186.938) (-1183.960) (-1182.561) [-1182.551] * (-1183.461) (-1181.434) [-1183.419] (-1181.149) -- 0:00:10
829500 -- (-1185.093) (-1182.246) (-1182.404) [-1181.330] * [-1181.223] (-1184.412) (-1181.778) (-1181.791) -- 0:00:10
830000 -- [-1182.144] (-1183.812) (-1182.329) (-1183.268) * (-1183.004) (-1185.043) [-1181.967] (-1183.621) -- 0:00:10
Average standard deviation of split frequencies: 0.005817
830500 -- (-1182.351) [-1181.847] (-1181.508) (-1182.262) * (-1181.921) (-1184.798) [-1182.682] (-1182.961) -- 0:00:10
831000 -- (-1186.253) (-1183.588) [-1181.030] (-1183.271) * [-1182.798] (-1184.272) (-1182.681) (-1181.895) -- 0:00:10
831500 -- [-1181.462] (-1182.339) (-1181.773) (-1183.173) * (-1182.105) (-1184.756) [-1181.606] (-1182.428) -- 0:00:10
832000 -- (-1180.981) (-1181.189) (-1180.914) [-1184.568] * (-1181.556) (-1182.166) [-1180.917] (-1182.140) -- 0:00:10
832500 -- (-1181.174) [-1182.570] (-1186.141) (-1182.594) * (-1185.964) [-1183.247] (-1182.192) (-1181.879) -- 0:00:10
833000 -- [-1183.792] (-1181.965) (-1182.816) (-1180.876) * [-1187.237] (-1184.615) (-1182.883) (-1183.133) -- 0:00:10
833500 -- [-1184.331] (-1182.790) (-1183.897) (-1181.138) * (-1183.098) (-1184.297) [-1183.007] (-1182.780) -- 0:00:10
834000 -- [-1181.376] (-1182.054) (-1185.755) (-1181.428) * (-1183.935) (-1181.765) (-1183.367) [-1182.099] -- 0:00:10
834500 -- (-1186.595) (-1183.237) (-1181.626) [-1181.840] * [-1182.724] (-1182.883) (-1183.520) (-1181.758) -- 0:00:10
835000 -- (-1185.087) (-1181.791) (-1181.588) [-1181.909] * (-1184.868) (-1185.848) (-1188.927) [-1183.327] -- 0:00:10
Average standard deviation of split frequencies: 0.005921
835500 -- (-1181.843) (-1182.476) [-1185.256] (-1182.467) * (-1183.506) [-1183.146] (-1185.200) (-1181.791) -- 0:00:10
836000 -- [-1181.744] (-1183.578) (-1186.222) (-1183.618) * (-1182.311) [-1187.666] (-1181.215) (-1181.133) -- 0:00:10
836500 -- (-1181.268) (-1182.006) [-1182.807] (-1184.411) * (-1183.087) (-1182.250) [-1180.712] (-1185.240) -- 0:00:10
837000 -- (-1183.904) (-1186.892) [-1184.434] (-1183.328) * (-1183.417) (-1182.109) [-1181.323] (-1185.135) -- 0:00:10
837500 -- [-1181.749] (-1181.453) (-1182.500) (-1182.881) * [-1184.088] (-1184.547) (-1182.889) (-1182.944) -- 0:00:10
838000 -- (-1183.334) (-1182.870) [-1183.061] (-1181.980) * (-1183.156) (-1181.441) [-1183.289] (-1183.138) -- 0:00:10
838500 -- (-1182.473) [-1182.082] (-1181.879) (-1181.880) * [-1182.225] (-1184.489) (-1181.337) (-1186.528) -- 0:00:10
839000 -- [-1183.742] (-1181.164) (-1183.945) (-1181.675) * (-1182.358) (-1182.473) (-1183.373) [-1181.988] -- 0:00:09
839500 -- (-1188.759) (-1180.584) (-1184.138) [-1183.032] * [-1181.436] (-1180.585) (-1181.041) (-1183.186) -- 0:00:09
840000 -- (-1181.813) (-1183.772) (-1183.352) [-1183.257] * (-1183.920) (-1180.973) [-1180.709] (-1183.560) -- 0:00:09
Average standard deviation of split frequencies: 0.005643
840500 -- (-1187.058) (-1180.498) [-1183.116] (-1182.522) * [-1181.883] (-1183.146) (-1181.621) (-1189.168) -- 0:00:09
841000 -- (-1184.018) [-1182.839] (-1181.114) (-1184.710) * (-1180.875) (-1185.741) (-1187.561) [-1181.946] -- 0:00:09
841500 -- (-1181.868) (-1180.892) [-1182.338] (-1189.848) * (-1182.931) [-1183.103] (-1188.748) (-1184.511) -- 0:00:09
842000 -- (-1184.852) (-1183.090) [-1182.583] (-1184.221) * (-1183.278) [-1183.094] (-1183.954) (-1185.879) -- 0:00:09
842500 -- (-1184.345) (-1183.302) (-1181.570) [-1184.256] * (-1184.702) (-1183.277) (-1182.718) [-1181.929] -- 0:00:09
843000 -- (-1182.009) (-1181.887) [-1182.104] (-1181.147) * [-1181.853] (-1183.177) (-1185.882) (-1183.501) -- 0:00:09
843500 -- [-1181.495] (-1181.359) (-1182.327) (-1182.251) * (-1186.183) [-1182.995] (-1183.550) (-1181.964) -- 0:00:09
844000 -- (-1181.805) (-1183.021) [-1183.239] (-1183.831) * (-1182.158) [-1182.137] (-1184.894) (-1182.555) -- 0:00:09
844500 -- (-1182.086) (-1185.461) (-1184.554) [-1183.232] * (-1182.220) [-1183.561] (-1181.549) (-1182.843) -- 0:00:09
845000 -- (-1182.608) (-1187.918) [-1180.678] (-1183.302) * [-1183.304] (-1185.438) (-1180.486) (-1181.175) -- 0:00:09
Average standard deviation of split frequencies: 0.006064
845500 -- [-1182.777] (-1182.164) (-1180.866) (-1186.516) * [-1181.808] (-1182.213) (-1181.759) (-1181.496) -- 0:00:09
846000 -- (-1193.478) (-1181.565) [-1181.354] (-1183.695) * (-1181.688) (-1187.099) [-1180.614] (-1181.033) -- 0:00:09
846500 -- (-1182.061) (-1184.955) (-1182.968) [-1186.072] * (-1182.189) (-1190.227) [-1180.341] (-1181.620) -- 0:00:09
847000 -- [-1187.133] (-1182.639) (-1182.016) (-1189.249) * (-1182.399) [-1186.316] (-1181.494) (-1181.549) -- 0:00:09
847500 -- (-1182.467) (-1182.272) [-1184.699] (-1181.233) * (-1181.807) (-1182.349) (-1184.450) [-1181.198] -- 0:00:09
848000 -- (-1181.693) (-1184.214) (-1183.899) [-1181.087] * (-1181.430) (-1183.054) (-1181.525) [-1181.346] -- 0:00:09
848500 -- (-1181.745) (-1182.543) [-1182.443] (-1185.292) * (-1183.869) (-1187.415) [-1182.466] (-1181.346) -- 0:00:09
849000 -- (-1181.954) (-1182.125) [-1183.383] (-1182.087) * (-1182.854) (-1183.565) [-1183.107] (-1181.335) -- 0:00:09
849500 -- (-1183.549) [-1181.377] (-1181.153) (-1181.219) * (-1181.950) (-1183.177) (-1182.207) [-1181.190] -- 0:00:09
850000 -- (-1184.707) (-1182.415) [-1181.485] (-1183.291) * (-1181.430) (-1186.300) [-1182.129] (-1183.287) -- 0:00:09
Average standard deviation of split frequencies: 0.005576
850500 -- (-1181.343) (-1181.121) [-1181.106] (-1182.621) * [-1184.186] (-1183.689) (-1181.527) (-1185.800) -- 0:00:09
851000 -- (-1182.349) (-1181.803) (-1183.316) [-1182.009] * (-1183.657) [-1186.976] (-1183.669) (-1183.572) -- 0:00:09
851500 -- [-1184.149] (-1190.458) (-1183.237) (-1181.798) * (-1186.057) (-1182.556) (-1181.712) [-1183.186] -- 0:00:09
852000 -- [-1182.232] (-1181.547) (-1182.254) (-1182.283) * (-1183.681) (-1182.505) (-1182.345) [-1182.039] -- 0:00:09
852500 -- (-1183.312) (-1181.454) (-1183.385) [-1180.416] * (-1185.215) [-1181.692] (-1184.073) (-1182.060) -- 0:00:09
853000 -- (-1182.712) [-1180.383] (-1182.397) (-1181.391) * (-1181.534) (-1183.288) (-1182.990) [-1180.790] -- 0:00:09
853500 -- (-1183.212) [-1181.708] (-1181.630) (-1180.970) * [-1182.353] (-1181.100) (-1182.398) (-1184.836) -- 0:00:09
854000 -- [-1184.874] (-1183.184) (-1183.570) (-1181.547) * [-1182.673] (-1184.822) (-1181.841) (-1184.088) -- 0:00:09
854500 -- (-1184.515) (-1184.636) [-1185.544] (-1184.338) * (-1182.518) [-1181.741] (-1183.128) (-1184.028) -- 0:00:09
855000 -- [-1182.413] (-1181.309) (-1189.288) (-1184.134) * (-1181.498) (-1185.319) (-1183.073) [-1182.212] -- 0:00:08
Average standard deviation of split frequencies: 0.005851
855500 -- (-1182.025) [-1183.579] (-1185.754) (-1183.612) * (-1183.410) (-1185.143) (-1181.356) [-1183.396] -- 0:00:08
856000 -- (-1181.429) [-1182.393] (-1185.363) (-1182.051) * (-1183.376) [-1183.291] (-1181.667) (-1185.281) -- 0:00:08
856500 -- (-1183.750) (-1182.398) (-1184.738) [-1181.973] * (-1182.072) [-1182.677] (-1180.821) (-1183.575) -- 0:00:08
857000 -- (-1181.754) (-1186.424) [-1182.925] (-1181.556) * (-1183.296) [-1182.736] (-1182.216) (-1183.163) -- 0:00:08
857500 -- (-1183.546) [-1183.619] (-1184.436) (-1185.687) * (-1183.407) [-1180.547] (-1181.599) (-1183.189) -- 0:00:08
858000 -- [-1184.229] (-1183.949) (-1183.403) (-1181.162) * (-1181.448) [-1183.178] (-1182.450) (-1183.657) -- 0:00:08
858500 -- (-1181.783) (-1182.253) (-1187.514) [-1182.076] * [-1181.666] (-1183.051) (-1182.883) (-1181.850) -- 0:00:08
859000 -- (-1180.945) (-1182.629) [-1183.543] (-1180.626) * (-1182.435) (-1183.339) [-1186.672] (-1181.300) -- 0:00:08
859500 -- (-1182.027) [-1182.924] (-1183.004) (-1182.078) * (-1182.716) [-1182.385] (-1182.652) (-1186.218) -- 0:00:08
860000 -- (-1182.771) [-1184.593] (-1181.784) (-1182.994) * (-1184.065) (-1183.930) [-1182.080] (-1183.128) -- 0:00:08
Average standard deviation of split frequencies: 0.004747
860500 -- (-1181.563) (-1183.815) (-1182.151) [-1182.938] * [-1182.701] (-1185.174) (-1182.324) (-1180.830) -- 0:00:08
861000 -- [-1181.925] (-1181.308) (-1182.715) (-1185.078) * (-1181.460) [-1180.759] (-1184.148) (-1184.717) -- 0:00:08
861500 -- (-1181.481) (-1181.940) [-1182.182] (-1184.061) * (-1184.739) (-1180.900) (-1183.297) [-1186.269] -- 0:00:08
862000 -- [-1182.612] (-1183.222) (-1180.804) (-1182.532) * [-1184.162] (-1183.302) (-1181.924) (-1182.320) -- 0:00:08
862500 -- (-1181.493) (-1184.227) [-1183.077] (-1181.997) * (-1182.768) [-1181.441] (-1185.436) (-1182.087) -- 0:00:08
863000 -- (-1181.490) [-1182.536] (-1181.976) (-1183.401) * (-1181.113) [-1180.556] (-1184.333) (-1181.939) -- 0:00:08
863500 -- (-1182.261) (-1182.249) [-1180.773] (-1181.147) * [-1185.806] (-1182.325) (-1184.120) (-1182.963) -- 0:00:08
864000 -- (-1184.661) (-1183.328) (-1181.674) [-1181.363] * (-1183.062) [-1180.803] (-1184.379) (-1183.207) -- 0:00:08
864500 -- (-1181.051) (-1182.827) [-1181.536] (-1183.284) * (-1181.294) (-1181.919) (-1182.301) [-1183.561] -- 0:00:08
865000 -- (-1182.938) (-1182.716) [-1181.560] (-1186.079) * (-1182.478) (-1182.398) [-1180.730] (-1185.554) -- 0:00:08
Average standard deviation of split frequencies: 0.005307
865500 -- (-1185.480) (-1182.949) [-1181.419] (-1184.848) * [-1181.807] (-1184.429) (-1180.906) (-1181.626) -- 0:00:08
866000 -- (-1184.974) [-1181.703] (-1182.128) (-1185.640) * [-1182.306] (-1184.500) (-1183.290) (-1182.894) -- 0:00:08
866500 -- (-1180.877) [-1182.287] (-1182.082) (-1182.974) * (-1182.021) (-1183.895) (-1183.098) [-1182.560] -- 0:00:08
867000 -- (-1183.125) [-1180.984] (-1183.488) (-1182.498) * (-1187.662) [-1183.196] (-1182.302) (-1181.848) -- 0:00:08
867500 -- (-1182.311) (-1183.943) (-1185.387) [-1181.604] * (-1187.009) [-1181.541] (-1182.342) (-1183.851) -- 0:00:08
868000 -- (-1183.838) (-1182.410) (-1185.037) [-1185.939] * [-1185.365] (-1182.497) (-1181.688) (-1182.159) -- 0:00:08
868500 -- [-1183.318] (-1183.187) (-1184.917) (-1182.379) * (-1180.896) (-1181.288) (-1181.727) [-1181.849] -- 0:00:08
869000 -- (-1183.204) (-1180.769) (-1186.036) [-1180.844] * [-1182.862] (-1182.143) (-1184.097) (-1182.153) -- 0:00:08
869500 -- (-1183.672) [-1183.318] (-1185.854) (-1182.265) * (-1185.634) (-1181.822) [-1182.229] (-1181.424) -- 0:00:08
870000 -- (-1184.767) (-1183.665) [-1181.395] (-1181.084) * (-1183.787) (-1184.035) (-1181.774) [-1181.689] -- 0:00:08
Average standard deviation of split frequencies: 0.005076
870500 -- (-1184.328) [-1181.966] (-1181.140) (-1183.416) * (-1184.895) [-1185.802] (-1182.663) (-1183.373) -- 0:00:08
871000 -- (-1182.473) [-1182.832] (-1180.686) (-1182.715) * (-1182.071) [-1182.506] (-1182.730) (-1186.092) -- 0:00:07
871500 -- (-1181.534) (-1183.818) (-1186.566) [-1181.609] * (-1182.853) (-1180.841) (-1183.442) [-1183.272] -- 0:00:07
872000 -- (-1185.383) (-1184.888) [-1182.173] (-1181.447) * [-1182.871] (-1182.320) (-1190.285) (-1183.056) -- 0:00:07
872500 -- (-1183.448) (-1183.691) (-1184.030) [-1185.074] * (-1182.242) (-1184.237) (-1181.309) [-1186.091] -- 0:00:07
873000 -- (-1180.747) (-1184.161) (-1185.021) [-1184.555] * [-1180.748] (-1184.007) (-1181.566) (-1182.251) -- 0:00:07
873500 -- [-1181.268] (-1182.852) (-1180.900) (-1181.927) * (-1181.809) (-1184.020) (-1185.798) [-1183.678] -- 0:00:07
874000 -- (-1181.598) [-1182.195] (-1183.125) (-1182.482) * (-1182.302) (-1184.825) (-1182.549) [-1182.693] -- 0:00:07
874500 -- [-1181.381] (-1182.846) (-1185.705) (-1182.741) * [-1182.180] (-1183.721) (-1184.438) (-1183.355) -- 0:00:07
875000 -- (-1181.095) [-1187.938] (-1183.824) (-1181.825) * (-1182.633) (-1182.584) [-1181.655] (-1184.889) -- 0:00:07
Average standard deviation of split frequencies: 0.005112
875500 -- (-1185.054) (-1181.087) [-1181.801] (-1188.121) * (-1183.218) (-1183.863) (-1183.470) [-1183.570] -- 0:00:07
876000 -- (-1182.625) (-1188.305) [-1181.495] (-1182.290) * (-1183.204) (-1182.997) [-1181.568] (-1182.664) -- 0:00:07
876500 -- (-1182.078) (-1181.186) (-1184.222) [-1181.981] * (-1182.026) (-1183.707) [-1181.544] (-1181.761) -- 0:00:07
877000 -- (-1184.070) (-1182.861) (-1184.188) [-1183.070] * (-1183.670) (-1183.432) [-1181.377] (-1181.760) -- 0:00:07
877500 -- [-1185.319] (-1187.395) (-1183.356) (-1185.332) * (-1182.241) (-1184.588) [-1185.331] (-1181.077) -- 0:00:07
878000 -- (-1185.979) (-1181.714) [-1185.202] (-1182.620) * (-1184.179) [-1184.983] (-1183.456) (-1182.213) -- 0:00:07
878500 -- (-1184.255) (-1180.927) (-1185.233) [-1181.864] * [-1181.961] (-1182.152) (-1184.278) (-1182.312) -- 0:00:07
879000 -- [-1182.116] (-1182.076) (-1181.434) (-1183.837) * (-1182.230) (-1185.658) (-1183.759) [-1185.338] -- 0:00:07
879500 -- (-1183.110) [-1184.656] (-1182.587) (-1189.152) * (-1182.022) [-1181.147] (-1183.795) (-1183.730) -- 0:00:07
880000 -- [-1184.113] (-1185.144) (-1182.036) (-1181.366) * [-1182.871] (-1180.741) (-1182.616) (-1181.088) -- 0:00:07
Average standard deviation of split frequencies: 0.005018
880500 -- (-1181.969) [-1183.420] (-1184.578) (-1181.685) * (-1184.079) [-1184.331] (-1183.915) (-1182.415) -- 0:00:07
881000 -- [-1186.664] (-1183.476) (-1183.149) (-1183.882) * (-1186.597) (-1181.743) (-1182.705) [-1184.703] -- 0:00:07
881500 -- (-1187.340) (-1185.267) (-1184.483) [-1181.479] * (-1183.233) (-1182.820) (-1182.935) [-1182.399] -- 0:00:07
882000 -- (-1184.853) [-1183.696] (-1184.792) (-1184.909) * [-1186.200] (-1186.085) (-1185.281) (-1183.700) -- 0:00:07
882500 -- (-1183.527) (-1182.234) (-1183.506) [-1183.720] * (-1183.310) [-1181.496] (-1185.722) (-1183.984) -- 0:00:07
883000 -- (-1182.322) [-1184.373] (-1181.503) (-1183.503) * (-1183.604) (-1189.417) (-1181.406) [-1185.076] -- 0:00:07
883500 -- (-1181.484) (-1184.945) (-1182.642) [-1183.693] * (-1189.443) (-1185.157) (-1184.156) [-1182.699] -- 0:00:07
884000 -- (-1184.429) [-1181.809] (-1181.794) (-1182.498) * [-1183.530] (-1183.944) (-1182.019) (-1185.711) -- 0:00:07
884500 -- (-1184.460) [-1183.198] (-1184.590) (-1185.053) * [-1180.871] (-1185.516) (-1185.051) (-1181.417) -- 0:00:07
885000 -- [-1187.424] (-1184.339) (-1181.151) (-1188.008) * (-1181.467) (-1183.198) (-1181.692) [-1181.940] -- 0:00:07
Average standard deviation of split frequencies: 0.004922
885500 -- (-1183.533) (-1182.856) (-1182.998) [-1182.949] * (-1183.915) (-1182.825) (-1182.499) [-1182.370] -- 0:00:07
886000 -- (-1183.642) (-1182.479) [-1182.790] (-1182.547) * [-1183.296] (-1183.893) (-1185.060) (-1181.236) -- 0:00:07
886500 -- (-1184.337) (-1181.875) [-1181.746] (-1189.641) * (-1182.709) (-1181.801) [-1186.196] (-1184.735) -- 0:00:07
887000 -- (-1183.397) [-1182.759] (-1184.396) (-1188.195) * (-1189.086) [-1182.290] (-1180.838) (-1183.497) -- 0:00:07
887500 -- [-1180.880] (-1184.197) (-1181.113) (-1184.116) * (-1186.498) [-1185.145] (-1181.901) (-1183.302) -- 0:00:06
888000 -- (-1181.175) (-1183.909) (-1181.715) [-1184.674] * (-1185.677) (-1181.351) (-1182.376) [-1182.820] -- 0:00:06
888500 -- (-1187.622) (-1181.764) (-1185.022) [-1185.615] * (-1182.315) (-1182.153) [-1181.124] (-1186.376) -- 0:00:06
889000 -- (-1184.507) [-1182.448] (-1185.207) (-1186.575) * (-1182.000) [-1183.785] (-1182.629) (-1182.719) -- 0:00:06
889500 -- (-1184.030) [-1180.877] (-1185.192) (-1184.536) * (-1187.896) (-1186.063) [-1181.144] (-1184.073) -- 0:00:06
890000 -- (-1183.567) [-1181.936] (-1181.202) (-1182.140) * (-1189.625) (-1181.997) (-1181.329) [-1182.159] -- 0:00:06
Average standard deviation of split frequencies: 0.004499
890500 -- (-1180.932) [-1182.521] (-1180.478) (-1183.868) * (-1181.900) (-1182.626) [-1182.230] (-1184.284) -- 0:00:06
891000 -- (-1181.982) [-1182.510] (-1181.721) (-1181.806) * (-1181.085) (-1182.471) (-1181.858) [-1183.211] -- 0:00:06
891500 -- (-1181.784) (-1181.248) (-1186.579) [-1180.820] * [-1181.938] (-1184.149) (-1182.046) (-1184.338) -- 0:00:06
892000 -- (-1182.423) [-1181.114] (-1189.400) (-1182.973) * (-1184.159) (-1182.983) (-1184.243) [-1182.029] -- 0:00:06
892500 -- [-1182.438] (-1183.000) (-1182.168) (-1185.535) * [-1182.731] (-1180.654) (-1183.468) (-1183.602) -- 0:00:06
893000 -- (-1185.993) (-1188.938) (-1182.749) [-1181.301] * (-1183.783) [-1182.030] (-1181.635) (-1185.703) -- 0:00:06
893500 -- [-1181.766] (-1187.119) (-1190.406) (-1181.283) * (-1186.508) (-1185.408) (-1183.759) [-1181.704] -- 0:00:06
894000 -- (-1182.084) (-1184.447) (-1185.265) [-1181.325] * (-1186.358) [-1181.413] (-1183.375) (-1184.465) -- 0:00:06
894500 -- (-1183.109) (-1181.765) (-1184.593) [-1183.491] * [-1183.818] (-1182.138) (-1183.257) (-1187.110) -- 0:00:06
895000 -- [-1183.435] (-1182.218) (-1182.180) (-1186.910) * (-1181.528) [-1181.780] (-1185.586) (-1181.816) -- 0:00:06
Average standard deviation of split frequencies: 0.004308
895500 -- (-1185.575) (-1181.076) [-1180.594] (-1189.176) * (-1185.311) [-1181.976] (-1182.398) (-1188.559) -- 0:00:06
896000 -- (-1190.350) (-1183.008) (-1180.724) [-1182.201] * (-1182.664) (-1187.069) [-1181.496] (-1185.717) -- 0:00:06
896500 -- [-1183.830] (-1183.007) (-1184.052) (-1184.382) * (-1185.046) (-1185.231) (-1183.052) [-1184.234] -- 0:00:06
897000 -- [-1181.209] (-1184.670) (-1182.439) (-1184.517) * [-1183.452] (-1185.921) (-1185.076) (-1183.295) -- 0:00:06
897500 -- (-1182.214) [-1182.699] (-1180.850) (-1184.069) * (-1189.072) [-1182.511] (-1184.256) (-1182.774) -- 0:00:06
898000 -- (-1180.711) [-1182.487] (-1184.503) (-1180.982) * [-1183.619] (-1182.500) (-1181.862) (-1183.475) -- 0:00:06
898500 -- (-1182.864) (-1185.959) (-1182.993) [-1182.083] * (-1182.148) (-1182.105) [-1180.889] (-1183.969) -- 0:00:06
899000 -- (-1182.155) (-1184.546) [-1183.727] (-1185.001) * (-1183.845) (-1181.468) [-1182.023] (-1181.810) -- 0:00:06
899500 -- (-1180.960) (-1184.771) [-1182.494] (-1183.112) * (-1182.354) (-1181.517) (-1181.472) [-1181.446] -- 0:00:06
900000 -- [-1183.075] (-1181.664) (-1181.314) (-1189.194) * (-1182.338) (-1181.508) (-1185.330) [-1181.466] -- 0:00:06
Average standard deviation of split frequencies: 0.004048
900500 -- (-1183.225) (-1183.078) (-1180.452) [-1182.387] * [-1181.620] (-1182.538) (-1184.865) (-1180.633) -- 0:00:06
901000 -- [-1180.773] (-1185.187) (-1182.787) (-1185.882) * (-1183.831) [-1181.167] (-1183.840) (-1181.950) -- 0:00:06
901500 -- (-1183.104) [-1182.449] (-1182.348) (-1182.252) * (-1181.876) (-1182.012) [-1184.680] (-1180.674) -- 0:00:06
902000 -- [-1183.365] (-1185.371) (-1183.431) (-1188.879) * [-1180.818] (-1182.915) (-1185.031) (-1180.980) -- 0:00:06
902500 -- (-1183.042) (-1186.168) (-1185.039) [-1181.692] * (-1182.487) (-1184.700) [-1181.021] (-1183.227) -- 0:00:06
903000 -- (-1182.318) [-1182.782] (-1186.464) (-1183.332) * (-1184.997) (-1183.358) [-1184.852] (-1180.981) -- 0:00:06
903500 -- (-1184.053) [-1182.183] (-1184.505) (-1182.094) * [-1186.324] (-1188.228) (-1190.349) (-1183.014) -- 0:00:05
904000 -- [-1184.899] (-1183.123) (-1181.653) (-1182.885) * [-1180.658] (-1182.750) (-1181.363) (-1183.409) -- 0:00:05
904500 -- (-1183.849) [-1183.669] (-1182.181) (-1182.997) * (-1180.959) (-1183.475) (-1183.282) [-1182.290] -- 0:00:05
905000 -- (-1182.519) [-1181.385] (-1182.358) (-1182.071) * (-1181.663) [-1182.216] (-1181.196) (-1182.421) -- 0:00:05
Average standard deviation of split frequencies: 0.004438
905500 -- (-1180.798) (-1184.510) [-1182.115] (-1186.414) * (-1180.361) [-1181.001] (-1181.010) (-1184.706) -- 0:00:05
906000 -- (-1181.343) (-1183.839) [-1183.267] (-1183.247) * (-1181.723) (-1183.459) [-1182.673] (-1182.676) -- 0:00:05
906500 -- [-1181.928] (-1181.941) (-1188.777) (-1183.224) * (-1185.188) [-1181.660] (-1182.379) (-1184.263) -- 0:00:05
907000 -- (-1186.691) (-1181.271) (-1182.711) [-1182.205] * (-1181.316) (-1181.559) [-1181.393] (-1182.558) -- 0:00:05
907500 -- (-1188.527) (-1181.631) [-1185.113] (-1182.463) * [-1182.171] (-1182.207) (-1182.178) (-1181.986) -- 0:00:05
908000 -- (-1182.415) (-1182.487) [-1183.651] (-1183.366) * [-1183.368] (-1182.235) (-1184.198) (-1183.298) -- 0:00:05
908500 -- (-1184.706) [-1181.826] (-1180.883) (-1183.665) * (-1186.101) (-1181.918) (-1184.051) [-1181.038] -- 0:00:05
909000 -- (-1182.001) (-1183.430) [-1182.323] (-1182.515) * (-1181.904) (-1181.402) [-1181.537] (-1182.160) -- 0:00:05
909500 -- (-1182.473) [-1182.735] (-1183.346) (-1181.239) * [-1184.182] (-1180.600) (-1182.464) (-1183.108) -- 0:00:05
910000 -- (-1183.348) (-1184.937) (-1184.108) [-1181.879] * (-1185.276) [-1185.283] (-1183.149) (-1183.491) -- 0:00:05
Average standard deviation of split frequencies: 0.004594
910500 -- (-1182.175) [-1182.873] (-1182.928) (-1191.358) * (-1181.243) (-1183.737) [-1181.969] (-1186.494) -- 0:00:05
911000 -- [-1188.185] (-1183.234) (-1182.079) (-1188.118) * [-1181.186] (-1183.486) (-1186.868) (-1182.451) -- 0:00:05
911500 -- (-1182.606) [-1181.706] (-1185.530) (-1185.212) * (-1183.763) [-1182.407] (-1193.374) (-1181.403) -- 0:00:05
912000 -- (-1182.975) (-1184.326) [-1188.269] (-1180.621) * (-1185.597) [-1182.567] (-1185.784) (-1182.935) -- 0:00:05
912500 -- [-1183.787] (-1185.867) (-1184.721) (-1183.216) * (-1183.162) [-1182.759] (-1180.951) (-1183.215) -- 0:00:05
913000 -- [-1181.346] (-1184.353) (-1187.075) (-1186.148) * (-1182.964) (-1181.212) [-1182.299] (-1181.361) -- 0:00:05
913500 -- [-1182.363] (-1184.528) (-1182.272) (-1183.992) * [-1181.048] (-1181.520) (-1181.766) (-1181.317) -- 0:00:05
914000 -- (-1182.414) [-1182.512] (-1183.363) (-1181.284) * [-1181.097] (-1183.090) (-1186.838) (-1180.981) -- 0:00:05
914500 -- [-1184.106] (-1181.626) (-1183.136) (-1183.156) * (-1181.281) [-1182.849] (-1186.276) (-1185.967) -- 0:00:05
915000 -- (-1186.708) (-1183.405) [-1182.607] (-1188.944) * [-1181.380] (-1184.521) (-1182.450) (-1183.134) -- 0:00:05
Average standard deviation of split frequencies: 0.005243
915500 -- (-1182.702) (-1184.125) [-1182.802] (-1185.300) * (-1183.795) (-1182.305) [-1186.955] (-1180.792) -- 0:00:05
916000 -- (-1184.003) (-1182.022) (-1182.820) [-1181.750] * (-1181.957) (-1183.648) [-1183.575] (-1186.761) -- 0:00:05
916500 -- (-1184.200) [-1181.587] (-1183.069) (-1182.289) * (-1184.772) (-1184.416) (-1182.141) [-1184.395] -- 0:00:05
917000 -- (-1182.933) (-1181.771) [-1183.329] (-1181.005) * [-1182.697] (-1183.314) (-1184.193) (-1180.565) -- 0:00:05
917500 -- (-1183.363) (-1181.369) (-1184.466) [-1181.732] * (-1183.620) [-1181.071] (-1188.246) (-1184.058) -- 0:00:05
918000 -- [-1182.225] (-1182.312) (-1184.171) (-1182.574) * (-1183.605) (-1183.625) [-1183.856] (-1183.939) -- 0:00:05
918500 -- [-1185.146] (-1184.599) (-1183.199) (-1182.051) * [-1186.567] (-1187.452) (-1181.707) (-1180.780) -- 0:00:05
919000 -- [-1181.321] (-1189.249) (-1183.301) (-1180.897) * [-1186.033] (-1182.644) (-1181.698) (-1181.495) -- 0:00:05
919500 -- [-1183.001] (-1186.064) (-1181.806) (-1186.025) * (-1180.619) [-1182.465] (-1183.367) (-1182.543) -- 0:00:05
920000 -- (-1184.697) (-1188.365) [-1184.521] (-1188.365) * (-1180.854) [-1182.355] (-1183.075) (-1181.319) -- 0:00:05
Average standard deviation of split frequencies: 0.005312
920500 -- (-1182.064) [-1185.933] (-1181.197) (-1188.556) * (-1185.166) (-1184.938) [-1181.141] (-1180.896) -- 0:00:05
921000 -- (-1182.080) (-1186.799) (-1181.124) [-1183.748] * (-1181.483) (-1184.927) (-1184.160) [-1181.945] -- 0:00:04
921500 -- (-1184.930) (-1180.550) [-1181.597] (-1188.439) * (-1183.866) [-1182.111] (-1183.279) (-1184.825) -- 0:00:04
922000 -- (-1182.021) (-1184.346) (-1183.453) [-1184.628] * (-1183.828) (-1185.982) (-1181.910) [-1182.278] -- 0:00:04
922500 -- [-1182.439] (-1184.304) (-1182.872) (-1181.706) * [-1182.857] (-1186.584) (-1182.140) (-1182.506) -- 0:00:04
923000 -- (-1181.977) (-1182.061) [-1180.980] (-1180.711) * (-1185.427) (-1181.245) (-1182.026) [-1182.520] -- 0:00:04
923500 -- [-1181.151] (-1181.828) (-1180.731) (-1181.127) * (-1184.345) (-1182.736) [-1183.296] (-1182.710) -- 0:00:04
924000 -- (-1181.918) (-1181.791) (-1180.779) [-1180.879] * (-1184.524) (-1182.215) (-1181.459) [-1183.338] -- 0:00:04
924500 -- (-1182.925) (-1181.553) (-1182.798) [-1181.563] * (-1182.899) [-1182.989] (-1181.631) (-1182.488) -- 0:00:04
925000 -- (-1184.235) [-1181.649] (-1182.862) (-1181.270) * (-1188.094) (-1183.564) (-1183.152) [-1181.109] -- 0:00:04
Average standard deviation of split frequencies: 0.005282
925500 -- (-1181.553) [-1181.037] (-1181.456) (-1180.631) * (-1182.928) (-1183.714) [-1183.071] (-1182.797) -- 0:00:04
926000 -- (-1182.329) (-1183.007) [-1181.556] (-1180.535) * (-1184.886) (-1184.626) [-1182.836] (-1182.420) -- 0:00:04
926500 -- (-1186.899) [-1182.063] (-1181.778) (-1180.800) * (-1184.369) (-1182.633) [-1182.476] (-1181.605) -- 0:00:04
927000 -- (-1182.027) (-1180.995) (-1182.163) [-1183.765] * (-1181.923) (-1181.585) [-1181.953] (-1182.821) -- 0:00:04
927500 -- [-1184.984] (-1185.711) (-1180.766) (-1186.069) * (-1180.649) [-1180.921] (-1181.919) (-1182.193) -- 0:00:04
928000 -- (-1181.256) (-1182.749) [-1182.276] (-1184.162) * (-1183.773) [-1183.159] (-1181.177) (-1184.736) -- 0:00:04
928500 -- (-1180.742) (-1183.883) (-1183.131) [-1181.680] * (-1181.824) (-1181.414) [-1181.176] (-1182.718) -- 0:00:04
929000 -- (-1180.816) (-1180.829) [-1181.673] (-1180.954) * [-1181.855] (-1185.351) (-1182.120) (-1184.009) -- 0:00:04
929500 -- (-1181.774) (-1180.640) [-1182.813] (-1180.622) * (-1183.469) (-1182.158) (-1183.613) [-1183.669] -- 0:00:04
930000 -- (-1180.605) (-1182.305) [-1181.833] (-1183.011) * (-1187.172) (-1184.855) [-1181.934] (-1184.352) -- 0:00:04
Average standard deviation of split frequencies: 0.005255
930500 -- [-1181.627] (-1184.830) (-1181.400) (-1183.044) * (-1183.381) [-1181.640] (-1182.610) (-1182.951) -- 0:00:04
931000 -- (-1185.920) (-1184.550) (-1181.093) [-1182.629] * (-1183.122) [-1181.576] (-1183.265) (-1182.504) -- 0:00:04
931500 -- (-1181.642) (-1185.138) (-1182.371) [-1181.515] * [-1184.413] (-1180.691) (-1182.232) (-1183.846) -- 0:00:04
932000 -- (-1181.629) (-1181.018) [-1183.014] (-1182.046) * [-1183.785] (-1184.974) (-1190.941) (-1182.444) -- 0:00:04
932500 -- (-1184.085) (-1183.259) [-1184.203] (-1183.991) * [-1183.402] (-1183.987) (-1186.379) (-1181.729) -- 0:00:04
933000 -- (-1183.944) (-1183.145) (-1184.242) [-1182.946] * (-1180.685) (-1183.020) (-1184.961) [-1181.535] -- 0:00:04
933500 -- (-1187.252) (-1185.288) [-1181.799] (-1182.161) * (-1180.855) (-1184.696) [-1181.535] (-1182.370) -- 0:00:04
934000 -- [-1185.678] (-1181.862) (-1182.747) (-1182.693) * (-1182.583) [-1182.657] (-1181.334) (-1185.884) -- 0:00:04
934500 -- (-1185.012) [-1182.802] (-1183.984) (-1182.495) * (-1182.786) [-1184.947] (-1180.591) (-1181.513) -- 0:00:04
935000 -- (-1182.394) (-1184.492) [-1181.947] (-1180.827) * (-1185.698) [-1180.957] (-1181.536) (-1180.702) -- 0:00:04
Average standard deviation of split frequencies: 0.004848
935500 -- [-1181.866] (-1182.618) (-1181.104) (-1183.125) * (-1182.807) (-1180.771) [-1181.378] (-1181.098) -- 0:00:04
936000 -- [-1181.998] (-1181.982) (-1182.101) (-1181.489) * [-1182.484] (-1182.189) (-1182.913) (-1181.502) -- 0:00:04
936500 -- (-1182.388) [-1183.723] (-1185.238) (-1183.252) * (-1183.492) [-1182.588] (-1181.751) (-1186.557) -- 0:00:04
937000 -- (-1183.407) [-1184.637] (-1183.250) (-1187.038) * (-1186.588) [-1181.402] (-1180.493) (-1181.302) -- 0:00:03
937500 -- (-1181.144) (-1185.143) (-1182.688) [-1183.009] * (-1186.195) (-1181.408) [-1181.669] (-1180.973) -- 0:00:03
938000 -- [-1181.437] (-1186.692) (-1182.424) (-1183.125) * (-1182.309) (-1181.932) [-1184.086] (-1180.381) -- 0:00:03
938500 -- [-1183.339] (-1184.454) (-1184.075) (-1182.947) * (-1182.269) (-1185.502) [-1187.161] (-1182.430) -- 0:00:03
939000 -- [-1182.929] (-1182.061) (-1185.977) (-1187.859) * [-1181.519] (-1184.144) (-1186.159) (-1183.370) -- 0:00:03
939500 -- [-1181.116] (-1184.240) (-1180.896) (-1181.484) * (-1182.217) (-1183.509) (-1181.581) [-1182.417] -- 0:00:03
940000 -- (-1182.705) (-1182.374) [-1182.275] (-1181.131) * (-1185.690) (-1184.024) [-1182.099] (-1181.917) -- 0:00:03
Average standard deviation of split frequencies: 0.004917
940500 -- (-1181.945) (-1182.708) (-1182.355) [-1182.591] * [-1182.287] (-1185.840) (-1184.019) (-1182.042) -- 0:00:03
941000 -- (-1186.851) [-1185.102] (-1182.250) (-1181.896) * [-1182.035] (-1181.556) (-1187.297) (-1182.038) -- 0:00:03
941500 -- [-1182.502] (-1183.408) (-1180.652) (-1184.943) * (-1182.087) [-1181.572] (-1184.176) (-1183.293) -- 0:00:03
942000 -- (-1183.240) [-1185.791] (-1183.524) (-1182.905) * (-1183.364) (-1182.395) (-1181.995) [-1181.384] -- 0:00:03
942500 -- (-1181.355) [-1183.767] (-1182.296) (-1181.377) * (-1181.835) (-1184.709) [-1181.558] (-1180.942) -- 0:00:03
943000 -- [-1181.359] (-1180.619) (-1183.143) (-1183.046) * (-1181.491) (-1187.706) (-1183.353) [-1181.753] -- 0:00:03
943500 -- (-1182.058) (-1185.249) (-1183.312) [-1181.722] * (-1180.601) [-1183.505] (-1189.388) (-1182.335) -- 0:00:03
944000 -- [-1184.521] (-1187.045) (-1186.298) (-1181.799) * [-1182.656] (-1181.693) (-1185.995) (-1186.489) -- 0:00:03
944500 -- (-1185.620) [-1182.759] (-1181.604) (-1180.861) * (-1189.763) (-1182.245) [-1183.664] (-1182.738) -- 0:00:03
945000 -- (-1184.486) [-1181.905] (-1181.159) (-1182.260) * (-1181.285) (-1186.296) (-1187.496) [-1183.074] -- 0:00:03
Average standard deviation of split frequencies: 0.004890
945500 -- (-1184.712) (-1180.651) [-1180.526] (-1183.133) * (-1181.625) [-1186.317] (-1183.551) (-1183.678) -- 0:00:03
946000 -- (-1185.653) (-1181.640) [-1183.879] (-1182.249) * (-1181.599) [-1182.677] (-1185.260) (-1184.119) -- 0:00:03
946500 -- (-1184.912) (-1182.819) (-1184.129) [-1183.341] * (-1181.620) [-1184.764] (-1181.409) (-1181.247) -- 0:00:03
947000 -- [-1183.892] (-1183.793) (-1181.331) (-1184.387) * [-1184.608] (-1186.336) (-1182.910) (-1186.815) -- 0:00:03
947500 -- [-1183.280] (-1183.175) (-1180.478) (-1181.049) * [-1183.199] (-1185.402) (-1183.369) (-1181.614) -- 0:00:03
948000 -- (-1181.899) [-1183.965] (-1181.356) (-1183.249) * [-1183.633] (-1186.374) (-1182.732) (-1183.719) -- 0:00:03
948500 -- (-1181.772) (-1181.904) [-1181.240] (-1183.393) * (-1183.343) (-1183.506) [-1181.928] (-1186.891) -- 0:00:03
949000 -- [-1181.585] (-1184.458) (-1188.523) (-1181.591) * (-1181.846) (-1183.068) (-1181.599) [-1182.160] -- 0:00:03
949500 -- (-1186.022) (-1181.779) [-1181.161] (-1181.171) * (-1181.351) (-1184.960) (-1181.043) [-1181.971] -- 0:00:03
950000 -- [-1182.017] (-1182.569) (-1182.648) (-1182.856) * (-1183.340) (-1188.749) (-1184.100) [-1180.632] -- 0:00:03
Average standard deviation of split frequencies: 0.005238
950500 -- [-1182.581] (-1182.717) (-1185.550) (-1183.099) * (-1182.943) (-1181.607) [-1181.611] (-1181.689) -- 0:00:03
951000 -- (-1196.193) [-1181.086] (-1183.752) (-1183.106) * [-1181.333] (-1183.113) (-1181.508) (-1181.759) -- 0:00:03
951500 -- (-1185.672) (-1183.093) [-1184.286] (-1183.694) * [-1181.616] (-1181.834) (-1184.900) (-1182.163) -- 0:00:03
952000 -- (-1181.708) (-1183.540) (-1183.213) [-1184.023] * (-1183.524) (-1181.922) (-1187.663) [-1183.260] -- 0:00:03
952500 -- (-1182.327) (-1185.226) [-1182.665] (-1185.212) * [-1181.004] (-1186.593) (-1190.234) (-1185.417) -- 0:00:02
953000 -- (-1182.789) (-1184.089) [-1182.051] (-1188.692) * (-1181.420) (-1183.237) (-1184.395) [-1182.388] -- 0:00:02
953500 -- [-1181.870] (-1182.243) (-1183.946) (-1184.888) * (-1181.570) [-1181.673] (-1184.377) (-1183.470) -- 0:00:02
954000 -- (-1182.991) (-1184.340) [-1181.468] (-1183.841) * (-1181.294) (-1184.026) [-1182.547] (-1185.908) -- 0:00:02
954500 -- (-1182.778) (-1187.818) (-1182.038) [-1182.006] * (-1181.732) (-1182.718) (-1181.659) [-1183.799] -- 0:00:02
955000 -- (-1183.392) (-1184.347) [-1182.068] (-1182.081) * (-1182.950) [-1182.452] (-1182.030) (-1183.986) -- 0:00:02
Average standard deviation of split frequencies: 0.005640
955500 -- (-1182.527) (-1182.853) (-1181.597) [-1185.182] * (-1185.817) (-1183.640) (-1183.184) [-1181.843] -- 0:00:02
956000 -- (-1184.134) (-1180.812) (-1182.787) [-1185.987] * (-1182.189) [-1183.963] (-1183.437) (-1181.881) -- 0:00:02
956500 -- (-1182.655) (-1182.617) [-1184.211] (-1181.627) * (-1187.466) (-1183.605) [-1182.150] (-1182.549) -- 0:00:02
957000 -- (-1184.041) (-1183.034) (-1183.371) [-1183.552] * (-1185.142) [-1180.765] (-1185.061) (-1183.106) -- 0:00:02
957500 -- (-1186.404) [-1183.470] (-1184.259) (-1192.351) * (-1185.675) (-1181.473) [-1183.146] (-1181.840) -- 0:00:02
958000 -- [-1183.399] (-1190.581) (-1182.900) (-1185.536) * (-1184.455) (-1184.228) (-1184.421) [-1182.372] -- 0:00:02
958500 -- [-1182.438] (-1184.956) (-1184.826) (-1182.261) * (-1183.680) (-1183.572) (-1183.225) [-1181.877] -- 0:00:02
959000 -- (-1182.234) (-1184.287) (-1183.903) [-1182.071] * (-1182.971) (-1181.553) (-1181.584) [-1183.565] -- 0:00:02
959500 -- [-1182.841] (-1180.779) (-1182.407) (-1184.132) * [-1183.490] (-1181.808) (-1183.209) (-1185.240) -- 0:00:02
960000 -- (-1184.594) [-1184.192] (-1184.712) (-1181.602) * [-1181.636] (-1185.028) (-1182.998) (-1182.343) -- 0:00:02
Average standard deviation of split frequencies: 0.005612
960500 -- (-1181.906) [-1183.222] (-1182.815) (-1181.799) * (-1184.531) [-1181.014] (-1186.925) (-1182.773) -- 0:00:02
961000 -- (-1182.229) [-1183.990] (-1181.894) (-1182.798) * [-1181.463] (-1182.350) (-1183.216) (-1182.371) -- 0:00:02
961500 -- (-1182.129) (-1182.445) [-1181.288] (-1182.827) * (-1182.120) (-1181.694) [-1183.411] (-1185.469) -- 0:00:02
962000 -- (-1180.944) [-1184.020] (-1183.598) (-1181.235) * (-1181.784) (-1180.744) [-1186.655] (-1183.676) -- 0:00:02
962500 -- (-1183.089) (-1181.208) [-1182.893] (-1181.684) * (-1183.748) (-1180.744) (-1184.354) [-1182.332] -- 0:00:02
963000 -- [-1181.431] (-1183.561) (-1182.836) (-1181.797) * (-1186.210) [-1183.378] (-1186.409) (-1181.996) -- 0:00:02
963500 -- [-1181.941] (-1185.104) (-1184.128) (-1184.614) * (-1184.569) (-1184.717) [-1183.158] (-1183.671) -- 0:00:02
964000 -- [-1182.923] (-1184.599) (-1181.758) (-1181.270) * [-1181.837] (-1181.577) (-1181.815) (-1181.780) -- 0:00:02
964500 -- (-1182.730) (-1184.140) [-1182.947] (-1183.276) * (-1184.235) (-1180.810) [-1182.655] (-1182.829) -- 0:00:02
965000 -- (-1186.622) [-1180.884] (-1182.084) (-1184.380) * (-1180.900) (-1184.114) [-1181.130] (-1181.709) -- 0:00:02
Average standard deviation of split frequencies: 0.005520
965500 -- (-1182.783) [-1181.233] (-1183.907) (-1183.964) * (-1184.423) (-1182.446) [-1181.240] (-1181.982) -- 0:00:02
966000 -- [-1181.088] (-1181.002) (-1181.725) (-1187.715) * (-1184.365) (-1182.542) [-1186.277] (-1183.134) -- 0:00:02
966500 -- (-1181.692) (-1181.008) (-1182.668) [-1183.200] * (-1182.249) (-1182.455) (-1181.954) [-1183.164] -- 0:00:02
967000 -- (-1181.984) (-1180.967) (-1181.601) [-1182.335] * (-1184.386) (-1181.822) (-1181.820) [-1186.592] -- 0:00:02
967500 -- (-1182.617) (-1188.726) (-1182.502) [-1181.952] * (-1182.649) (-1180.888) [-1182.672] (-1186.463) -- 0:00:02
968000 -- (-1181.864) (-1182.138) [-1181.870] (-1185.993) * (-1184.464) (-1183.879) (-1183.458) [-1183.456] -- 0:00:02
968500 -- [-1182.996] (-1181.315) (-1185.901) (-1182.724) * (-1185.375) (-1186.149) [-1182.528] (-1184.624) -- 0:00:01
969000 -- (-1181.867) (-1182.442) [-1184.392] (-1181.379) * (-1183.052) (-1184.997) [-1181.488] (-1183.840) -- 0:00:01
969500 -- (-1183.117) (-1181.905) [-1181.829] (-1182.932) * (-1185.255) [-1183.871] (-1182.123) (-1182.288) -- 0:00:01
970000 -- (-1180.765) (-1181.336) [-1181.172] (-1182.001) * (-1186.590) (-1183.036) (-1183.317) [-1181.739] -- 0:00:01
Average standard deviation of split frequencies: 0.005251
970500 -- (-1183.106) [-1184.194] (-1181.003) (-1181.988) * (-1184.065) (-1182.663) [-1188.559] (-1187.071) -- 0:00:01
971000 -- [-1182.970] (-1186.843) (-1182.852) (-1187.991) * (-1181.306) (-1183.908) (-1182.470) [-1184.456] -- 0:00:01
971500 -- (-1183.970) [-1184.118] (-1185.947) (-1184.815) * [-1181.551] (-1181.772) (-1182.235) (-1180.670) -- 0:00:01
972000 -- [-1183.010] (-1180.728) (-1183.849) (-1180.953) * (-1181.280) (-1181.122) [-1182.632] (-1181.274) -- 0:00:01
972500 -- [-1184.045] (-1184.790) (-1183.263) (-1182.842) * (-1181.918) [-1181.343] (-1182.557) (-1183.144) -- 0:00:01
973000 -- (-1182.615) [-1183.703] (-1189.284) (-1183.212) * (-1181.826) (-1182.022) (-1184.480) [-1187.218] -- 0:00:01
973500 -- (-1185.274) [-1181.543] (-1185.474) (-1182.241) * [-1182.204] (-1187.540) (-1182.033) (-1182.076) -- 0:00:01
974000 -- [-1182.139] (-1187.986) (-1181.869) (-1184.187) * (-1182.057) [-1181.057] (-1180.623) (-1182.881) -- 0:00:01
974500 -- [-1182.425] (-1182.198) (-1182.935) (-1185.939) * (-1183.045) (-1181.884) (-1182.526) [-1183.237] -- 0:00:01
975000 -- [-1181.577] (-1182.074) (-1183.411) (-1182.758) * [-1182.121] (-1183.464) (-1183.569) (-1184.462) -- 0:00:01
Average standard deviation of split frequencies: 0.005434
975500 -- (-1181.139) (-1181.148) [-1181.605] (-1184.449) * (-1186.390) [-1182.538] (-1183.838) (-1183.393) -- 0:00:01
976000 -- (-1185.110) [-1181.647] (-1182.599) (-1181.960) * (-1181.809) [-1182.473] (-1187.273) (-1182.610) -- 0:00:01
976500 -- [-1183.851] (-1183.135) (-1189.042) (-1184.843) * [-1181.518] (-1182.922) (-1182.834) (-1182.224) -- 0:00:01
977000 -- [-1181.467] (-1185.377) (-1189.463) (-1187.023) * (-1182.489) (-1183.118) (-1183.801) [-1180.820] -- 0:00:01
977500 -- [-1184.178] (-1181.899) (-1186.803) (-1186.898) * (-1186.426) (-1186.584) [-1182.180] (-1182.629) -- 0:00:01
978000 -- [-1181.558] (-1184.717) (-1183.313) (-1185.686) * (-1183.325) (-1185.117) [-1184.724] (-1182.971) -- 0:00:01
978500 -- (-1181.472) (-1183.337) [-1181.294] (-1185.772) * (-1180.404) (-1184.001) (-1188.330) [-1184.566] -- 0:00:01
979000 -- (-1183.433) (-1182.280) (-1185.010) [-1181.722] * (-1181.981) (-1182.314) (-1183.679) [-1183.641] -- 0:00:01
979500 -- [-1181.282] (-1182.798) (-1182.011) (-1182.035) * (-1182.250) (-1181.879) (-1182.132) [-1184.899] -- 0:00:01
980000 -- (-1181.950) (-1183.276) [-1183.207] (-1180.548) * (-1180.865) (-1181.950) (-1189.145) [-1183.155] -- 0:00:01
Average standard deviation of split frequencies: 0.005348
980500 -- [-1182.009] (-1182.295) (-1181.058) (-1181.149) * (-1180.727) (-1181.347) [-1182.222] (-1182.107) -- 0:00:01
981000 -- [-1181.277] (-1181.749) (-1180.990) (-1181.279) * (-1181.889) [-1180.688] (-1184.440) (-1182.339) -- 0:00:01
981500 -- [-1181.239] (-1182.994) (-1180.463) (-1180.994) * (-1180.850) (-1182.189) [-1182.704] (-1183.073) -- 0:00:01
982000 -- [-1181.749] (-1183.151) (-1186.952) (-1185.159) * (-1185.224) [-1182.143] (-1183.053) (-1181.653) -- 0:00:01
982500 -- (-1182.330) [-1180.315] (-1181.309) (-1185.219) * [-1182.671] (-1182.676) (-1183.886) (-1181.862) -- 0:00:01
983000 -- [-1186.698] (-1181.071) (-1184.901) (-1184.146) * (-1183.049) (-1181.343) (-1183.103) [-1192.181] -- 0:00:01
983500 -- [-1183.629] (-1182.165) (-1181.516) (-1182.058) * (-1181.145) (-1180.877) (-1186.711) [-1182.324] -- 0:00:01
984000 -- (-1181.103) [-1183.944] (-1183.730) (-1182.675) * (-1181.845) [-1181.953] (-1183.512) (-1182.503) -- 0:00:01
984500 -- (-1183.954) [-1185.470] (-1182.588) (-1186.540) * (-1185.533) (-1181.430) [-1181.808] (-1185.292) -- 0:00:00
985000 -- (-1189.414) (-1182.208) [-1181.476] (-1180.890) * (-1183.151) [-1182.034] (-1185.058) (-1183.686) -- 0:00:00
Average standard deviation of split frequencies: 0.005498
985500 -- (-1186.352) (-1182.029) [-1181.071] (-1182.540) * (-1181.563) (-1181.333) [-1182.363] (-1184.017) -- 0:00:00
986000 -- (-1185.998) [-1183.130] (-1182.630) (-1181.847) * (-1190.088) (-1181.984) [-1182.003] (-1183.507) -- 0:00:00
986500 -- (-1182.072) (-1183.769) (-1182.183) [-1180.971] * (-1182.832) (-1186.121) [-1182.645] (-1184.424) -- 0:00:00
987000 -- [-1182.297] (-1181.968) (-1182.484) (-1185.567) * (-1181.918) [-1183.382] (-1181.911) (-1185.365) -- 0:00:00
987500 -- [-1185.768] (-1181.578) (-1184.044) (-1181.790) * (-1182.971) (-1183.435) [-1182.823] (-1182.282) -- 0:00:00
988000 -- [-1185.497] (-1182.547) (-1180.457) (-1181.542) * (-1185.221) (-1182.931) (-1181.825) [-1183.357] -- 0:00:00
988500 -- (-1182.982) [-1186.250] (-1185.737) (-1182.720) * (-1181.232) (-1186.136) (-1181.426) [-1183.140] -- 0:00:00
989000 -- (-1186.383) (-1185.383) (-1184.682) [-1181.501] * [-1182.921] (-1182.865) (-1181.452) (-1183.173) -- 0:00:00
989500 -- (-1193.962) (-1183.414) [-1182.354] (-1181.146) * (-1182.582) (-1182.839) (-1181.826) [-1181.430] -- 0:00:00
990000 -- (-1188.792) (-1181.116) [-1184.040] (-1183.248) * (-1182.211) (-1181.886) (-1182.631) [-1181.688] -- 0:00:00
Average standard deviation of split frequencies: 0.005918
990500 -- [-1181.191] (-1182.331) (-1182.217) (-1183.210) * (-1184.144) [-1180.868] (-1182.847) (-1181.236) -- 0:00:00
991000 -- (-1181.466) (-1182.069) [-1187.889] (-1183.290) * (-1182.963) (-1182.259) (-1185.311) [-1183.701] -- 0:00:00
991500 -- (-1181.322) [-1181.475] (-1187.817) (-1186.925) * (-1183.889) (-1181.257) [-1180.811] (-1183.792) -- 0:00:00
992000 -- [-1181.192] (-1181.626) (-1185.413) (-1182.080) * (-1182.371) (-1185.223) (-1182.577) [-1181.496] -- 0:00:00
992500 -- [-1185.360] (-1181.682) (-1184.197) (-1186.399) * (-1183.984) [-1184.854] (-1181.686) (-1181.930) -- 0:00:00
993000 -- (-1181.560) [-1184.714] (-1182.904) (-1181.692) * [-1186.140] (-1181.694) (-1182.100) (-1182.631) -- 0:00:00
993500 -- (-1183.228) [-1183.678] (-1183.699) (-1186.453) * [-1183.789] (-1181.654) (-1181.247) (-1184.723) -- 0:00:00
994000 -- (-1184.666) [-1186.471] (-1182.978) (-1181.010) * [-1182.368] (-1183.948) (-1183.088) (-1181.837) -- 0:00:00
994500 -- (-1181.552) [-1183.795] (-1181.573) (-1182.919) * (-1183.133) (-1185.624) (-1185.197) [-1182.593] -- 0:00:00
995000 -- [-1180.819] (-1185.469) (-1182.480) (-1182.756) * (-1183.061) (-1183.989) [-1183.606] (-1182.423) -- 0:00:00
Average standard deviation of split frequencies: 0.005591
995500 -- (-1182.075) (-1185.912) [-1186.200] (-1182.961) * (-1182.983) (-1182.800) [-1180.983] (-1181.397) -- 0:00:00
996000 -- (-1184.739) (-1181.440) [-1186.290] (-1183.887) * (-1184.957) (-1182.266) (-1181.445) [-1181.019] -- 0:00:00
996500 -- (-1181.512) [-1181.152] (-1184.809) (-1181.908) * (-1183.316) [-1180.407] (-1182.149) (-1185.336) -- 0:00:00
997000 -- (-1181.783) [-1183.217] (-1181.521) (-1183.862) * (-1183.127) (-1183.697) (-1181.208) [-1183.018] -- 0:00:00
997500 -- (-1185.414) (-1183.803) (-1182.188) [-1187.250] * (-1184.787) (-1181.358) [-1185.278] (-1185.466) -- 0:00:00
998000 -- (-1184.168) [-1183.581] (-1182.278) (-1181.882) * (-1185.246) (-1184.158) [-1182.283] (-1185.250) -- 0:00:00
998500 -- [-1181.216] (-1180.888) (-1184.340) (-1184.777) * (-1185.298) (-1182.905) (-1190.024) [-1184.131] -- 0:00:00
999000 -- (-1182.040) (-1182.672) [-1181.243] (-1181.597) * [-1182.435] (-1184.102) (-1183.349) (-1182.248) -- 0:00:00
999500 -- (-1186.706) [-1186.999] (-1181.675) (-1183.730) * [-1181.021] (-1184.541) (-1187.562) (-1180.717) -- 0:00:00
1000000 -- (-1182.909) (-1184.980) (-1181.664) [-1181.911] * (-1182.844) (-1182.688) [-1182.510] (-1183.671) -- 0:00:00
Average standard deviation of split frequencies: 0.005741
Analysis completed in 1 mins 3 seconds
Analysis used 61.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1180.30
Likelihood of best state for "cold" chain of run 2 was -1180.30
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.4 % ( 30 %) Dirichlet(Pi{all})
27.7 % ( 30 %) Slider(Pi{all})
78.8 % ( 52 %) Multiplier(Alpha{1,2})
77.6 % ( 52 %) Multiplier(Alpha{3})
18.3 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.4 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.9 % ( 25 %) Dirichlet(Pi{all})
28.4 % ( 28 %) Slider(Pi{all})
78.6 % ( 54 %) Multiplier(Alpha{1,2})
77.4 % ( 54 %) Multiplier(Alpha{3})
18.4 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165973 0.82 0.67
3 | 167269 166341 0.84
4 | 166907 166871 166639
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166399 0.82 0.67
3 | 166029 166525 0.84
4 | 167082 167273 166692
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1181.93
| 2 |
| 1 1 2 |
| 2 2 12 1 2 1 2 1 |
| 1 1 1 21 2 2 2 *2 2 2 1 |
|2 12 2 1 1 1 1 1 |
| 2 2 ** 1 1 1* 2 1 1 11 2|
| * 1 1 2 2 11 2 2 211 22 1 12 1 |
| 22 2 12 2 2 1 21 2 212 2 2 2 |
| 2 1 11 1 2212 2 21 1 1 1 1 |
| 1 2 21 2 2 |
| 1 2 1 1 2 |
| 2 |
|1 1 |
| |
| 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1183.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1182.00 -1185.01
2 -1181.98 -1186.11
--------------------------------------
TOTAL -1181.99 -1185.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888415 0.090920 0.328415 1.459962 0.848021 835.79 992.61 1.000
r(A<->C){all} 0.162236 0.019343 0.000124 0.446936 0.124707 209.00 236.16 1.000
r(A<->G){all} 0.164134 0.020339 0.000060 0.462740 0.125724 118.13 158.84 1.000
r(A<->T){all} 0.171659 0.020322 0.000036 0.464137 0.137173 131.90 211.96 1.003
r(C<->G){all} 0.169958 0.019970 0.000062 0.462501 0.134628 242.40 247.24 1.002
r(C<->T){all} 0.173363 0.020675 0.000068 0.461802 0.137599 191.61 233.82 1.001
r(G<->T){all} 0.158649 0.019141 0.000201 0.430790 0.118832 252.03 280.79 1.007
pi(A){all} 0.149183 0.000149 0.125767 0.173174 0.149139 1211.60 1265.17 1.000
pi(C){all} 0.297493 0.000237 0.267379 0.326501 0.297143 1251.14 1272.31 1.000
pi(G){all} 0.344404 0.000251 0.315260 0.376971 0.343763 1217.88 1290.75 1.000
pi(T){all} 0.208919 0.000184 0.183023 0.235626 0.208858 1070.05 1159.29 1.000
alpha{1,2} 0.416627 0.231876 0.000155 1.388473 0.242880 1035.39 1199.64 1.000
alpha{3} 0.471905 0.233713 0.000285 1.430554 0.318115 1243.59 1278.10 1.000
pinvar{all} 0.998304 0.000004 0.994384 0.999999 0.998949 943.31 1088.58 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- .*.*..
9 -- .**.**
10 -- .*..*.
11 -- ..*.*.
12 -- ....**
13 -- ..**..
14 -- ..*..*
15 -- .***.*
16 -- ..****
17 -- .*.***
18 -- .**...
19 -- ...*.*
20 -- .*...*
21 -- ...**.
22 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.013662 0.143904 0.163225 2
8 458 0.152565 0.001884 0.151233 0.153897 2
9 448 0.149234 0.000942 0.148568 0.149900 2
10 448 0.149234 0.004711 0.145903 0.152565 2
11 441 0.146902 0.006124 0.142572 0.151233 2
12 440 0.146569 0.001884 0.145237 0.147901 2
13 430 0.143238 0.004711 0.139907 0.146569 2
14 426 0.141905 0.007537 0.136576 0.147235 2
15 426 0.141905 0.002827 0.139907 0.143904 2
16 422 0.140573 0.016959 0.128581 0.152565 2
17 413 0.137575 0.001413 0.136576 0.138574 2
18 413 0.137575 0.001413 0.136576 0.138574 2
19 398 0.132578 0.002827 0.130580 0.134577 2
20 398 0.132578 0.002827 0.130580 0.134577 2
21 387 0.128914 0.006124 0.124584 0.133245 2
22 280 0.093271 0.016017 0.081945 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2406/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097383 0.010002 0.000001 0.294536 0.066207 1.000 2
length{all}[2] 0.099386 0.009619 0.000002 0.294899 0.070858 1.000 2
length{all}[3] 0.096230 0.009838 0.000007 0.292446 0.065047 1.000 2
length{all}[4] 0.096075 0.009479 0.000049 0.298258 0.065660 1.001 2
length{all}[5] 0.100027 0.009919 0.000024 0.299654 0.068589 1.000 2
length{all}[6] 0.097606 0.009922 0.000016 0.287278 0.068074 1.000 2
length{all}[7] 0.098636 0.009981 0.000488 0.272584 0.068258 1.000 2
length{all}[8] 0.101704 0.011585 0.000156 0.305067 0.064370 1.007 2
length{all}[9] 0.099172 0.009114 0.000157 0.308461 0.066841 0.998 2
length{all}[10] 0.103454 0.011993 0.000291 0.313993 0.066716 0.998 2
length{all}[11] 0.098608 0.009212 0.000156 0.317477 0.068978 0.998 2
length{all}[12] 0.102094 0.008836 0.000158 0.282485 0.073627 0.999 2
length{all}[13] 0.098753 0.008900 0.000226 0.283194 0.071826 0.998 2
length{all}[14] 0.107053 0.012128 0.000200 0.345771 0.075805 1.003 2
length{all}[15] 0.104075 0.010570 0.000700 0.285836 0.070291 1.001 2
length{all}[16] 0.105569 0.009599 0.000591 0.312537 0.074178 0.999 2
length{all}[17] 0.101895 0.010965 0.000252 0.290920 0.070837 0.998 2
length{all}[18] 0.093038 0.008791 0.000357 0.276104 0.062484 0.999 2
length{all}[19] 0.097833 0.009094 0.000481 0.297765 0.065259 1.003 2
length{all}[20] 0.102544 0.011850 0.000006 0.311019 0.068902 0.997 2
length{all}[21] 0.103200 0.011806 0.000418 0.338646 0.071611 0.998 2
length{all}[22] 0.099099 0.010487 0.000185 0.275790 0.069729 1.010 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005741
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 882
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 294 / 294 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 294 / 294 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.034973 0.051420 0.058714 0.059081 0.090948 0.010161 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1222.512553
Iterating by ming2
Initial: fx= 1222.512553
x= 0.03497 0.05142 0.05871 0.05908 0.09095 0.01016 0.30000 1.30000
1 h-m-p 0.0000 0.0000 703.2270 ++ 1205.143336 m 0.0000 13 | 1/8
2 h-m-p 0.0004 0.0055 62.6061 ----------.. | 1/8
3 h-m-p 0.0000 0.0001 642.2071 ++ 1169.524779 m 0.0001 43 | 2/8
4 h-m-p 0.0011 0.0078 46.3263 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 576.5985 ++ 1150.443814 m 0.0001 74 | 3/8
6 h-m-p 0.0009 0.0138 30.1629 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 500.5562 ++ 1144.062842 m 0.0000 105 | 4/8
8 h-m-p 0.0005 0.0235 20.4456 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 408.8555 ++ 1143.848917 m 0.0000 136 | 5/8
10 h-m-p 0.0001 0.0332 13.9747 ---------.. | 5/8
11 h-m-p 0.0000 0.0001 288.1841 ++ 1134.523621 m 0.0001 165 | 6/8
12 h-m-p 0.4506 8.0000 0.0000 +++ 1134.523621 m 8.0000 177 | 6/8
13 h-m-p 0.2018 8.0000 0.0004 +++ 1134.523621 m 8.0000 191 | 6/8
14 h-m-p 0.0027 0.3195 1.2843 ------------.. | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.523621 m 8.0000 228 | 6/8
16 h-m-p 0.0530 8.0000 0.0036 ------Y 1134.523621 0 0.0000 247 | 6/8
17 h-m-p 0.0160 8.0000 0.0002 +++++ 1134.523621 m 8.0000 263 | 6/8
18 h-m-p 0.0008 0.2411 1.6101 +++++ 1134.523615 m 0.2411 279 | 7/8
19 h-m-p 1.0132 8.0000 0.2416 ++ 1134.523604 m 8.0000 290 | 7/8
20 h-m-p 1.6000 8.0000 0.6290 ++ 1134.523598 m 8.0000 302 | 7/8
21 h-m-p 1.6000 8.0000 1.1766 ++ 1134.523595 m 8.0000 314 | 7/8
22 h-m-p 1.2273 8.0000 7.6693 ++ 1134.523593 m 8.0000 325 | 7/8
23 h-m-p 1.6000 8.0000 13.7754 ++ 1134.523593 m 8.0000 336 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 N 1134.523593 0 1.6000 347 | 6/8
25 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.523593 m 8.0000 362 | 6/8
26 h-m-p 0.0632 8.0000 0.0057 ++++ 1134.523591 m 8.0000 377 | 6/8
27 h-m-p 0.0453 8.0000 1.0058 ++++ 1134.523525 m 8.0000 392 | 6/8
28 h-m-p 1.6000 8.0000 0.2390 ++ 1134.523523 m 8.0000 403 | 6/8
29 h-m-p 0.0030 0.0159 628.0772 ----------Y 1134.523523 0 0.0000 426 | 6/8
30 h-m-p 0.7004 8.0000 0.0000 ---Y 1134.523523 0 0.0027 440 | 6/8
31 h-m-p 0.0248 8.0000 0.0000 Y 1134.523523 0 0.0248 453
Out..
lnL = -1134.523523
454 lfun, 454 eigenQcodon, 2724 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108283 0.104309 0.010944 0.094715 0.080815 0.040529 10.003829 0.522344 0.209608
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 1.892953
np = 9
lnL0 = -1256.000645
Iterating by ming2
Initial: fx= 1256.000645
x= 0.10828 0.10431 0.01094 0.09471 0.08082 0.04053 10.00383 0.52234 0.20961
1 h-m-p 0.0000 0.0000 641.1261 ++ 1239.142239 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0004 384.3713 ++ 1197.131734 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0001 1078.6008 ++ 1159.529569 m 0.0001 38 | 3/9
4 h-m-p 0.0007 0.0033 40.7160 ++ 1156.333432 m 0.0033 50 | 4/9
5 h-m-p 0.0000 0.0001 501.8130 ++ 1150.035230 m 0.0001 62 | 5/9
6 h-m-p 0.0005 0.0085 77.6149 +++ 1145.292438 m 0.0085 75 | 6/9
7 h-m-p 0.0001 0.0006 39.9856 ++ 1141.133760 m 0.0006 87 | 7/9
8 h-m-p 0.0160 8.0000 2.9349 -------------.. | 7/9
9 h-m-p 0.0000 0.0001 289.3880 ++ 1134.523664 m 0.0001 122 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 -Y 1134.523664 0 0.0170 135 | 8/9
11 h-m-p 0.0176 8.0000 0.0000 -Y 1134.523664 0 0.0011 149
Out..
lnL = -1134.523664
150 lfun, 450 eigenQcodon, 1800 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108909 0.078645 0.074120 0.093480 0.092163 0.013566 9.996404 0.917118 0.195491 0.498958 194.753267
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.043549
np = 11
lnL0 = -1190.834211
Iterating by ming2
Initial: fx= 1190.834211
x= 0.10891 0.07865 0.07412 0.09348 0.09216 0.01357 9.99640 0.91712 0.19549 0.49896 194.75327
1 h-m-p 0.0000 0.0003 120.0094 +++ 1186.739255 m 0.0003 17 | 1/11
2 h-m-p 0.0007 0.0334 38.0361 +++ 1147.327999 m 0.0334 32 | 2/11
3 h-m-p 0.0000 0.0000 53821.6932 ++ 1142.078463 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0007 645.7468 ++ 1138.336665 m 0.0007 60 | 4/11
5 h-m-p 0.0000 0.0000 33137.4511 ++ 1134.610161 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 9494.9356 ++ 1134.523546 m 0.0000 88 | 6/11
7 h-m-p 1.6000 8.0000 0.0062 ++ 1134.523545 m 8.0000 102 | 6/11
8 h-m-p 0.0186 2.9727 2.6709 ++++ 1134.523523 m 2.9727 123 | 6/11
9 h-m-p 0.0000 0.0000 0.1012
h-m-p: 0.00000000e+00 0.00000000e+00 1.01239068e-01 1134.523523
.. | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +Y 1134.523523 0 0.0640 154 | 7/11
11 h-m-p 0.0160 8.0000 0.0001 Y 1134.523523 0 0.0040 172
Out..
lnL = -1134.523523
173 lfun, 692 eigenQcodon, 3114 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1134.516777 S = -1134.516678 -0.000038
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:02
did 20 / 54 patterns 0:02
did 30 / 54 patterns 0:02
did 40 / 54 patterns 0:02
did 50 / 54 patterns 0:02
did 54 / 54 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102829 0.019856 0.051980 0.050496 0.045378 0.012720 9.972605 0.732430 1.421381
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 2.551476
np = 9
lnL0 = -1215.557114
Iterating by ming2
Initial: fx= 1215.557114
x= 0.10283 0.01986 0.05198 0.05050 0.04538 0.01272 9.97261 0.73243 1.42138
1 h-m-p 0.0000 0.0000 680.9353 ++ 1194.530675 m 0.0000 14 | 1/9
2 h-m-p 0.0012 0.0396 24.1572 -----------.. | 1/9
3 h-m-p 0.0000 0.0000 630.3171 ++ 1184.538774 m 0.0000 47 | 2/9
4 h-m-p 0.0008 0.0556 17.0554 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 566.2789 ++ 1155.183084 m 0.0001 80 | 3/9
6 h-m-p 0.0042 0.0676 10.4350 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 503.1638 ++ 1150.648890 m 0.0000 114 | 4/9
8 h-m-p 0.0008 0.1821 9.4843 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 410.9785 ++ 1149.774948 m 0.0000 147 | 5/9
10 h-m-p 0.0005 0.2487 6.9370 -----------.. | 5/9
11 h-m-p 0.0000 0.0002 287.0328 +++ 1134.523794 m 0.0002 181 | 6/9
12 h-m-p 0.8993 8.0000 0.0000 ++ 1134.523794 m 8.0000 193 | 6/9
13 h-m-p 0.0402 8.0000 0.0067 ++++ 1134.523792 m 8.0000 210 | 6/9
14 h-m-p 0.0827 8.0000 0.6453 ++++ 1134.523759 m 8.0000 227 | 6/9
15 h-m-p 1.6000 8.0000 0.2691 ++ 1134.523757 m 8.0000 242 | 6/9
16 h-m-p 0.6054 8.0000 3.5564 ++ 1134.523745 m 8.0000 257 | 6/9
17 h-m-p 0.7866 3.9331 18.6845 ++ 1134.523642 m 3.9331 269 | 7/9
18 h-m-p 0.9152 4.5759 24.0276 --------Y 1134.523642 0 0.0000 289 | 7/9
19 h-m-p 0.0160 8.0000 0.0867 -N 1134.523642 0 0.0010 302 | 7/9
20 h-m-p 1.6000 8.0000 0.0000 --------------N 1134.523642 0 0.0000 330
Out..
lnL = -1134.523642
331 lfun, 3641 eigenQcodon, 19860 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045292 0.072149 0.063161 0.012044 0.016258 0.059727 0.000100 0.900000 0.985089 1.333988 189.483253
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.559114
np = 11
lnL0 = -1164.024222
Iterating by ming2
Initial: fx= 1164.024222
x= 0.04529 0.07215 0.06316 0.01204 0.01626 0.05973 0.00011 0.90000 0.98509 1.33399 189.48325
1 h-m-p 0.0000 0.0000 202.0778 ++ 1163.794217 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 788.1568 +CYYYYCCCCC 1153.220439 10 0.0001 46 | 1/11
3 h-m-p 0.0142 0.1232 4.8446 ++ 1148.617280 m 0.1232 60 | 2/11
4 h-m-p 0.0000 0.0000 630066.5256 ++ 1147.606408 m 0.0000 74 | 3/11
5 h-m-p 0.0001 0.0007 225.7883 ++ 1146.345248 m 0.0007 88 | 4/11
6 h-m-p 0.0000 0.0002 466.2649 ++ 1145.802016 m 0.0002 102 | 5/11
7 h-m-p 0.0002 0.0008 136.9613
QuantileBeta(0.15, 0.00500, 2.15781) = 1.223642e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
+ 1142.664977 m 0.0008 116
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210340e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.17656) = 1.210341e-160 2000 rounds
| 6/11
8 h-m-p 0.0018 0.0090 22.8266
QuantileBeta(0.15, 0.00500, 2.13775) = 1.238195e-160 2000 rounds
++ 1136.572478 m 0.0090 130 | 7/11
9 h-m-p 0.0011 0.0054 58.5734 ++ 1134.523599 m 0.0054 144 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ----Y 1134.523599 0 0.0016 162 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.523599 m 8.0000 182 | 7/11
12 h-m-p 0.0367 8.0000 0.0050 ++++ 1134.523598 m 8.0000 202 | 7/11
13 h-m-p 0.0987 4.6284 0.4047 +
QuantileBeta(0.15, 0.00500, 2.20628) = 1.189835e-160 2000 rounds
Y 1134.523597 0 0.8805 221 | 7/11
14 h-m-p 1.6000 8.0000 0.0157 Y 1134.523597 0 0.9423 239 | 7/11
15 h-m-p 1.6000 8.0000 0.0001 ++ 1134.523597 m 8.0000 257 | 7/11
16 h-m-p 0.0160 8.0000 0.4052 ++
QuantileBeta(0.15, 0.00500, 2.32618) = 1.113656e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.32330) = 7.255871e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.59048) = 5.022749e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
Y 1134.523590 0 5.4524 279
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.505142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76374) = 6.285406e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76342) = 6.286014e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.76358) = 6.285710e-161 2000 rounds
| 7/11
17 h-m-p 1.6000 8.0000 0.7022
QuantileBeta(0.15, 0.00500, 4.66647) = 4.931629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.37516) = 2.993838e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
+ 1134.523553 m 8.0000 297
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.739327e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27831) = 2.646840e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27781) = 2.647009e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.27806) = 2.646924e-161 2000 rounds
| 7/11
18 h-m-p 1.6000 8.0000 3.2972
QuantileBeta(0.15, 0.00500, 12.51609) = 1.714240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 25.23019) = 8.332005e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
+ 1134.523523 m 8.0000 315
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.361597e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46824) = 7.113271e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 29.46823) = 7.113275e-162 2000 rounds
| 7/11
19 h-m-p 1.6000 8.0000 3.4867
QuantileBeta(0.15, 0.00500, 33.94991) = 4.963089e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.39496) = 2.118443e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
+ 1134.523517 m 8.0000 329
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 2.001292e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87667) = 1.933661e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.87664) = 1.933662e-162 2000 rounds
| 7/11
20 h-m-p 0.7897 3.9487 14.8552 ++ 1134.523512 m 3.9487 343 | 7/11
21 h-m-p 0.0000 0.0000 21.4762
h-m-p: 0.00000000e+00 0.00000000e+00 2.14761814e+01 1134.523512
.. | 7/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.523512 m 8.0000 371 | 7/11
23 h-m-p 0.0262 8.0000 0.0018 -------Y 1134.523512 0 0.0000 396 | 8/11
24 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.523512 m 8.0000 417 | 8/11
25 h-m-p 0.0007 0.3350 1.4807 -----------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 1134.523512 m 8.0000 460 | 8/11
27 h-m-p 0.0772 8.0000 0.0006 ------------Y 1134.523512 0 0.0000 489
Out..
lnL = -1134.523512
490 lfun, 5880 eigenQcodon, 32340 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1134.516980 S = -1134.516700 -0.000122
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:20
did 20 / 54 patterns 0:20
did 30 / 54 patterns 0:20
did 40 / 54 patterns 0:20
did 50 / 54 patterns 0:20
did 54 / 54 patterns 0:20
Time used: 0:21
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2406/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 294
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 6 6 6 | TCC 2 2 2 2 2 2 | TAC 6 6 6 6 6 6 | TGC 1 1 1 1 1 1
Leu TTA 3 3 3 3 3 3 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 5 5 5 5 5 5
CTA 5 5 5 5 5 5 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 17 17 17 17 17 17 | CCG 6 6 6 6 6 6 | CAG 2 2 2 2 2 2 | CGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 14 14 14 14 14 14 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 4 4 4 4 4 4 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 5 5 5 5 5 5 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 11 11 11 11 11 11 | Asp GAT 2 2 2 2 2 2 | Gly GGT 4 4 4 4 4 4
GTC 12 12 12 12 12 12 | GCC 12 12 12 12 12 12 | GAC 8 8 8 8 8 8 | GGC 13 13 13 13 13 13
GTA 2 2 2 2 2 2 | GCA 6 6 6 6 6 6 | Glu GAA 2 2 2 2 2 2 | GGA 6 6 6 6 6 6
GTG 24 24 24 24 24 24 | GCG 17 17 17 17 17 17 | GAG 0 0 0 0 0 0 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908876_1_2571_MLBR_RS12250
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
#2: NC_002677_1_NP_302556_1_1428_ML2406
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
#3: NZ_LVXE01000073_1_WP_010908876_1_2623_A3216_RS13245
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
#4: NZ_LYPH01000074_1_WP_010908876_1_2504_A8144_RS12025
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
#5: NZ_CP029543_1_WP_010908876_1_2597_DIJ64_RS13230
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
#6: NZ_AP014567_1_WP_010908876_1_2662_JK2ML_RS13555
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 6
TTC 36 | TCC 12 | TAC 36 | TGC 6
Leu L TTA 18 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 48 | TAG 0 | Trp W TGG 54
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 18 | CCC 18 | CAC 30 | CGC 30
CTA 30 | CCA 12 | Gln Q CAA 18 | CGA 6
CTG 102 | CCG 36 | CAG 12 | CGG 54
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 36 | ACC 84 | AAC 24 | AGC 18
ATA 0 | ACA 24 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 42 | ACG 30 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 66 | Asp D GAT 12 | Gly G GGT 24
GTC 72 | GCC 72 | GAC 48 | GGC 78
GTA 12 | GCA 36 | Glu E GAA 12 | GGA 36
GTG 144 | GCG 102 | GAG 0 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17347 C:0.22109 A:0.17347 G:0.43197
position 2: T:0.34354 C:0.32313 A:0.13265 G:0.20068
position 3: T:0.10884 C:0.35034 A:0.13946 G:0.40136
Average T:0.20862 C:0.29819 A:0.14853 G:0.34467
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1134.523523 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 10.003829 189.483253
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908876_1_2571_MLBR_RS12250: 0.000004, NC_002677_1_NP_302556_1_1428_ML2406: 0.000004, NZ_LVXE01000073_1_WP_010908876_1_2623_A3216_RS13245: 0.000004, NZ_LYPH01000074_1_WP_010908876_1_2504_A8144_RS12025: 0.000004, NZ_CP029543_1_WP_010908876_1_2597_DIJ64_RS13230: 0.000004, NZ_AP014567_1_WP_010908876_1_2662_JK2ML_RS13555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 10.00383
omega (dN/dS) = 189.48325
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.9 244.1 189.4833 0.0000 0.0000 0.0 0.0
7..2 0.000 637.9 244.1 189.4833 0.0000 0.0000 0.0 0.0
7..3 0.000 637.9 244.1 189.4833 0.0000 0.0000 0.0 0.0
7..4 0.000 637.9 244.1 189.4833 0.0000 0.0000 0.0 0.0
7..5 0.000 637.9 244.1 189.4833 0.0000 0.0000 0.0 0.0
7..6 0.000 637.9 244.1 189.4833 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1134.523664 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 9.996404 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908876_1_2571_MLBR_RS12250: 0.000004, NC_002677_1_NP_302556_1_1428_ML2406: 0.000004, NZ_LVXE01000073_1_WP_010908876_1_2623_A3216_RS13245: 0.000004, NZ_LYPH01000074_1_WP_010908876_1_2504_A8144_RS12025: 0.000004, NZ_CP029543_1_WP_010908876_1_2597_DIJ64_RS13230: 0.000004, NZ_AP014567_1_WP_010908876_1_2662_JK2ML_RS13555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 9.99640
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.9 244.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 637.9 244.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 637.9 244.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 637.9 244.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 637.9 244.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 637.9 244.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1134.523523 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 9.972605 0.015973 0.111501 1.000000 194.749561
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908876_1_2571_MLBR_RS12250: 0.000004, NC_002677_1_NP_302556_1_1428_ML2406: 0.000004, NZ_LVXE01000073_1_WP_010908876_1_2623_A3216_RS13245: 0.000004, NZ_LYPH01000074_1_WP_010908876_1_2504_A8144_RS12025: 0.000004, NZ_CP029543_1_WP_010908876_1_2597_DIJ64_RS13230: 0.000004, NZ_AP014567_1_WP_010908876_1_2662_JK2ML_RS13555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 9.97261
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01597 0.11150 0.87253
w: 1.00000 1.00000 194.74956
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 637.9 244.1 170.0516 0.0000 0.0000 0.0 0.0
7..2 0.000 637.9 244.1 170.0516 0.0000 0.0000 0.0 0.0
7..3 0.000 637.9 244.1 170.0516 0.0000 0.0000 0.0 0.0
7..4 0.000 637.9 244.1 170.0516 0.0000 0.0000 0.0 0.0
7..5 0.000 637.9 244.1 170.0516 0.0000 0.0000 0.0 0.0
7..6 0.000 637.9 244.1 170.0516 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908876_1_2571_MLBR_RS12250)
Pr(w>1) post mean +- SE for w
1 M 0.873 170.050
2 A 0.873 170.051
3 S 0.873 170.051
4 F 0.873 170.051
5 A 0.873 170.051
6 Q 0.873 170.051
7 W 0.873 170.051
8 I 0.873 170.051
9 S 0.873 170.051
10 G 0.873 170.051
11 A 0.873 170.051
12 R 0.873 170.051
13 P 0.873 170.051
14 R 0.873 170.051
15 T 0.873 170.051
16 L 0.873 170.051
17 P 0.873 170.051
18 N 0.873 170.051
19 A 0.873 170.051
20 V 0.873 170.051
21 A 0.873 170.051
22 P 0.873 170.051
23 V 0.873 170.051
24 V 0.873 170.051
25 A 0.873 170.051
26 G 0.873 170.051
27 T 0.873 170.051
28 G 0.873 170.051
29 T 0.873 170.051
30 A 0.873 170.051
31 A 0.873 170.051
32 W 0.873 170.051
33 L 0.873 170.051
34 H 0.873 170.051
35 S 0.873 170.051
36 A 0.873 170.051
37 V 0.873 170.051
38 W 0.873 170.051
39 W 0.873 170.051
40 K 0.873 170.051
41 A 0.873 170.051
42 L 0.873 170.051
43 L 0.873 170.051
44 A 0.873 170.051
45 L 0.873 170.051
46 V 0.873 170.051
47 V 0.873 170.051
48 A 0.873 170.051
49 V 0.873 170.051
50 A 0.873 170.051
51 L 0.873 170.051
52 V 0.873 170.051
53 I 0.873 170.051
54 G 0.873 170.051
55 V 0.873 170.051
56 N 0.873 170.051
57 Y 0.873 170.051
58 A 0.873 170.051
59 N 0.873 170.051
60 D 0.873 170.051
61 Y 0.873 170.051
62 S 0.873 170.051
63 D 0.873 170.051
64 G 0.873 170.051
65 I 0.873 170.051
66 R 0.873 170.051
67 G 0.873 170.051
68 T 0.873 170.051
69 D 0.873 170.051
70 D 0.873 170.051
71 H 0.873 170.051
72 R 0.873 170.051
73 A 0.873 170.051
74 G 0.873 170.051
75 P 0.873 170.051
76 M 0.873 170.050
77 R 0.873 170.051
78 L 0.873 170.051
79 V 0.873 170.051
80 G 0.873 170.051
81 S 0.873 170.051
82 R 0.873 170.051
83 L 0.873 170.051
84 A 0.873 170.051
85 F 0.873 170.051
86 P 0.873 170.051
87 R 0.873 170.052
88 S 0.873 170.051
89 V 0.873 170.051
90 L 0.873 170.051
91 T 0.873 170.051
92 A 0.873 170.051
93 A 0.873 170.051
94 V 0.873 170.051
95 V 0.873 170.051
96 G 0.873 170.051
97 L 0.873 170.051
98 T 0.873 170.051
99 V 0.873 170.051
100 S 0.873 170.051
101 T 0.873 170.051
102 V 0.873 170.051
103 A 0.873 170.051
104 G 0.873 170.051
105 L 0.873 170.051
106 A 0.873 170.051
107 L 0.873 170.051
108 A 0.873 170.051
109 L 0.873 170.051
110 L 0.873 170.051
111 S 0.873 170.051
112 A 0.873 170.051
113 P 0.873 170.051
114 W 0.873 170.051
115 L 0.873 170.051
116 I 0.873 170.051
117 M 0.873 170.050
118 V 0.873 170.051
119 G 0.873 170.051
120 A 0.873 170.051
121 T 0.873 170.051
122 C 0.873 170.051
123 I 0.873 170.051
124 A 0.873 170.051
125 G 0.873 170.051
126 A 0.873 170.051
127 W 0.873 170.051
128 L 0.873 170.051
129 Y 0.873 170.051
130 T 0.873 170.051
131 G 0.873 170.051
132 S 0.873 170.051
133 S 0.873 170.051
134 K 0.873 170.051
135 P 0.873 170.051
136 Y 0.873 170.051
137 G 0.873 170.051
138 Y 0.873 170.051
139 K 0.873 170.051
140 G 0.873 170.051
141 F 0.873 170.051
142 G 0.873 170.051
143 E 0.873 170.051
144 V 0.873 170.051
145 A 0.873 170.051
146 V 0.873 170.051
147 F 0.873 170.051
148 V 0.873 170.051
149 F 0.873 170.051
150 F 0.873 170.051
151 G 0.873 170.051
152 L 0.873 170.051
153 V 0.873 170.051
154 A 0.873 170.051
155 V 0.873 170.051
156 L 0.873 170.051
157 G 0.873 170.051
158 T 0.873 170.051
159 E 0.873 170.051
160 Y 0.873 170.051
161 T 0.873 170.051
162 Q 0.873 170.051
163 A 0.873 170.051
164 L 0.873 170.051
165 R 0.873 170.051
166 V 0.873 170.051
167 D 0.873 170.051
168 W 0.873 170.051
169 V 0.873 170.051
170 G 0.873 170.051
171 L 0.873 170.051
172 V 0.873 170.051
173 L 0.873 170.051
174 A 0.873 170.051
175 V 0.873 170.051
176 S 0.873 170.051
177 T 0.873 170.051
178 G 0.873 170.051
179 A 0.873 170.051
180 L 0.873 170.051
181 S 0.873 170.051
182 S 0.873 170.051
183 S 0.873 170.051
184 V 0.873 170.051
185 L 0.873 170.051
186 V 0.873 170.051
187 A 0.873 170.051
188 N 0.873 170.051
189 N 0.873 170.051
190 L 0.873 170.051
191 R 0.873 170.051
192 D 0.873 170.051
193 I 0.873 170.051
194 H 0.873 170.051
195 T 0.873 170.051
196 D 0.873 170.051
197 T 0.873 170.051
198 Q 0.873 170.051
199 S 0.873 170.051
200 H 0.873 170.051
201 K 0.873 170.051
202 F 0.873 170.051
203 T 0.873 170.051
204 L 0.873 170.051
205 A 0.873 170.051
206 V 0.873 170.051
207 R 0.873 170.051
208 L 0.873 170.051
209 G 0.873 170.051
210 D 0.873 170.051
211 A 0.873 170.051
212 H 0.873 170.051
213 T 0.873 170.051
214 R 0.873 170.051
215 Q 0.873 170.051
216 L 0.873 170.051
217 Y 0.873 170.051
218 Q 0.873 170.051
219 A 0.873 170.051
220 L 0.873 170.051
221 L 0.873 170.051
222 V 0.873 170.051
223 A 0.873 170.051
224 T 0.873 170.051
225 G 0.873 170.051
226 V 0.873 170.051
227 L 0.873 170.051
228 T 0.873 170.051
229 V 0.873 170.051
230 V 0.873 170.051
231 L 0.873 170.051
232 M 0.873 170.050
233 V 0.873 170.051
234 A 0.873 170.051
235 T 0.873 170.051
236 S 0.873 170.051
237 W 0.873 170.051
238 C 0.873 170.051
239 A 0.873 170.051
240 V 0.873 170.051
241 G 0.873 170.051
242 L 0.873 170.051
243 V 0.873 170.051
244 A 0.873 170.051
245 T 0.873 170.051
246 P 0.873 170.051
247 L 0.873 170.051
248 A 0.873 170.051
249 L 0.873 170.051
250 R 0.873 170.051
251 A 0.873 170.051
252 M 0.873 170.050
253 R 0.873 170.051
254 P 0.873 170.051
255 V 0.873 170.051
256 R 0.873 170.051
257 S 0.873 170.051
258 G 0.873 170.051
259 R 0.873 170.051
260 M 0.873 170.050
261 G 0.873 170.051
262 P 0.873 170.051
263 D 0.873 170.051
264 L 0.873 170.051
265 T 0.873 170.051
266 P 0.873 170.051
267 V 0.873 170.051
268 L 0.873 170.051
269 R 0.873 170.051
270 D 0.873 170.051
271 T 0.873 170.051
272 G 0.873 170.051
273 L 0.873 170.051
274 A 0.873 170.051
275 M 0.873 170.050
276 V 0.873 170.051
277 V 0.873 170.051
278 W 0.873 170.051
279 A 0.873 170.051
280 I 0.873 170.051
281 A 0.873 170.051
282 V 0.873 170.051
283 A 0.873 170.051
284 G 0.873 170.051
285 A 0.873 170.051
286 L 0.873 170.051
287 T 0.873 170.051
288 L 0.873 170.051
289 A 0.873 170.051
290 G 0.873 170.051
291 S 0.873 170.051
292 V 0.873 170.051
293 T 0.873 170.051
294 Y 0.873 170.051
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908876_1_2571_MLBR_RS12250)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1134.523642 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 73.057891 82.772897
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908876_1_2571_MLBR_RS12250: 0.000004, NC_002677_1_NP_302556_1_1428_ML2406: 0.000004, NZ_LVXE01000073_1_WP_010908876_1_2623_A3216_RS13245: 0.000004, NZ_LYPH01000074_1_WP_010908876_1_2504_A8144_RS12025: 0.000004, NZ_CP029543_1_WP_010908876_1_2597_DIJ64_RS13230: 0.000004, NZ_AP014567_1_WP_010908876_1_2662_JK2ML_RS13555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 73.05789 q = 82.77290
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.40348 0.42741 0.44177 0.45329 0.46367 0.47373 0.48414 0.49574 0.51027 0.53463
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 630.8 251.2 0.4688 0.0000 0.0000 0.0 0.0
7..2 0.000 630.8 251.2 0.4688 0.0000 0.0000 0.0 0.0
7..3 0.000 630.8 251.2 0.4688 0.0000 0.0000 0.0 0.0
7..4 0.000 630.8 251.2 0.4688 0.0000 0.0000 0.0 0.0
7..5 0.000 630.8 251.2 0.4688 0.0000 0.0000 0.0 0.0
7..6 0.000 630.8 251.2 0.4688 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1134.523512 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 72.158890 0.590746 0.005000 99.000000 190.468751
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908876_1_2571_MLBR_RS12250: 0.000004, NC_002677_1_NP_302556_1_1428_ML2406: 0.000004, NZ_LVXE01000073_1_WP_010908876_1_2623_A3216_RS13245: 0.000004, NZ_LYPH01000074_1_WP_010908876_1_2504_A8144_RS12025: 0.000004, NZ_CP029543_1_WP_010908876_1_2597_DIJ64_RS13230: 0.000004, NZ_AP014567_1_WP_010908876_1_2662_JK2ML_RS13555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 72.15889
Parameters in M8 (beta&w>1):
p0 = 0.59075 p = 0.00500 q = 99.00000
(p1 = 0.40925) w = 190.46875
MLEs of dN/dS (w) for site classes (K=11)
p: 0.05907 0.05907 0.05907 0.05907 0.05907 0.05907 0.05907 0.05907 0.05907 0.05907 0.40925
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 190.46875
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 639.1 242.9 77.9502 0.0000 0.0000 0.0 0.0
7..2 0.000 639.1 242.9 77.9502 0.0000 0.0000 0.0 0.0
7..3 0.000 639.1 242.9 77.9502 0.0000 0.0000 0.0 0.0
7..4 0.000 639.1 242.9 77.9502 0.0000 0.0000 0.0 0.0
7..5 0.000 639.1 242.9 77.9502 0.0000 0.0000 0.0 0.0
7..6 0.000 639.1 242.9 77.9502 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908876_1_2571_MLBR_RS12250)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908876_1_2571_MLBR_RS12250)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:21