--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 08:59:28 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/9res/ML2409/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1311.04 -1315.33 2 -1311.08 -1314.71 -------------------------------------- TOTAL -1311.06 -1315.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897537 0.088311 0.349811 1.468454 0.861408 1501.00 1501.00 1.000 r(A<->C){all} 0.155027 0.018344 0.000087 0.428765 0.117965 168.75 186.79 1.000 r(A<->G){all} 0.180336 0.021930 0.000017 0.476770 0.144739 176.25 185.70 1.012 r(A<->T){all} 0.162376 0.021250 0.000044 0.459630 0.117716 232.58 234.55 1.002 r(C<->G){all} 0.156855 0.017576 0.000082 0.420676 0.122711 189.69 203.86 1.001 r(C<->T){all} 0.170101 0.021729 0.000033 0.475770 0.127413 167.86 182.41 1.006 r(G<->T){all} 0.175305 0.021623 0.000042 0.466266 0.136539 219.62 247.68 1.001 pi(A){all} 0.131198 0.000119 0.109894 0.152280 0.130746 1245.33 1311.55 1.000 pi(C){all} 0.286043 0.000211 0.257285 0.313542 0.286202 1120.49 1162.44 1.000 pi(G){all} 0.339139 0.000225 0.310625 0.367955 0.338815 1154.20 1247.94 1.000 pi(T){all} 0.243620 0.000192 0.217796 0.271015 0.243330 1257.73 1308.37 1.000 alpha{1,2} 0.413422 0.208541 0.000239 1.345223 0.256986 1146.17 1225.13 1.000 alpha{3} 0.448497 0.225417 0.000137 1.450243 0.283781 1268.63 1336.92 1.000 pinvar{all} 0.998415 0.000003 0.994840 0.999998 0.998987 1091.50 1175.83 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1257.739648 Model 2: PositiveSelection -1257.739647 Model 0: one-ratio -1257.739643 Model 7: beta -1257.739672 Model 8: beta&w>1 -1257.739642 Model 0 vs 1 1.0000000202126103E-5 Model 2 vs 1 1.99999976757681E-6 Model 8 vs 7 5.999999984851456E-5
>C1 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C2 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C3 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C4 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C5 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C6 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=327 C1 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C2 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C3 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C4 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C5 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C6 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV ************************************************** C1 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C2 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C3 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C4 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C5 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C6 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG ************************************************** C1 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C2 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C3 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C4 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C5 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C6 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL ************************************************** C1 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C2 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C3 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C4 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C5 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C6 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS ************************************************** C1 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C2 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C3 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C4 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C5 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C6 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG ************************************************** C1 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C2 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C3 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C4 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C5 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C6 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV ************************************************** C1 VGCVAMVFNLFFVNLVTVGLHSYAGVD C2 VGCVAMVFNLFFVNLVTVGLHSYAGVD C3 VGCVAMVFNLFFVNLVTVGLHSYAGVD C4 VGCVAMVFNLFFVNLVTVGLHSYAGVD C5 VGCVAMVFNLFFVNLVTVGLHSYAGVD C6 VGCVAMVFNLFFVNLVTVGLHSYAGVD *************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 327 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 327 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9810] Library Relaxation: Multi_proc [96] Relaxation Summary: [9810]--->[9810] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.514 Mb, Max= 30.894 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C2 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C3 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C4 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C5 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV C6 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV ************************************************** C1 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C2 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C3 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C4 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C5 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG C6 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG ************************************************** C1 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C2 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C3 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C4 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C5 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL C6 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL ************************************************** C1 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C2 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C3 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C4 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C5 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS C6 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS ************************************************** C1 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C2 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C3 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C4 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C5 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG C6 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG ************************************************** C1 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C2 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C3 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C4 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C5 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV C6 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV ************************************************** C1 VGCVAMVFNLFFVNLVTVGLHSYAGVD C2 VGCVAMVFNLFFVNLVTVGLHSYAGVD C3 VGCVAMVFNLFFVNLVTVGLHSYAGVD C4 VGCVAMVFNLFFVNLVTVGLHSYAGVD C5 VGCVAMVFNLFFVNLVTVGLHSYAGVD C6 VGCVAMVFNLFFVNLVTVGLHSYAGVD *************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC C2 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC C3 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC C4 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC C5 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC C6 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC ************************************************** C1 GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT C2 GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT C3 GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT C4 GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT C5 GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT C6 GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ************************************************** C1 ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG C2 ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG C3 ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG C4 ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG C5 ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG C6 ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG ************************************************** C1 GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA C2 GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA C3 GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA C4 GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA C5 GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA C6 GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA ************************************************** C1 CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG C2 CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG C3 CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG C4 CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG C5 CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG C6 CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG ************************************************** C1 TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC C2 TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC C3 TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC C4 TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC C5 TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC C6 TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC ************************************************** C1 CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT C2 CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT C3 CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT C4 CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT C5 CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT C6 CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT ************************************************** C1 GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC C2 GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC C3 GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC C4 GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC C5 GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC C6 GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC ************************************************** C1 AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC C2 AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC C3 AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC C4 AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC C5 AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC C6 AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ************************************************** C1 ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC C2 ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC C3 ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC C4 ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC C5 ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC C6 ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC ************************************************** C1 GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT C2 GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT C3 GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT C4 GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT C5 GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT C6 GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT ************************************************** C1 CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC C2 CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC C3 CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC C4 CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC C5 CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC C6 CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ************************************************** C1 ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG C2 ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG C3 ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG C4 ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG C5 ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG C6 ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG ************************************************** C1 GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC C2 GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC C3 GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC C4 GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC C5 GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC C6 GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC ************************************************** C1 GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT C2 GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT C3 GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT C4 GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT C5 GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT C6 GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT ************************************************** C1 GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA C2 GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA C3 GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA C4 GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA C5 GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA C6 GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA ************************************************** C1 GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG C2 GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG C3 GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG C4 GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG C5 GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG C6 GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG ************************************************** C1 CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG C2 CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG C3 CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG C4 CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG C5 CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG C6 CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG ************************************************** C1 GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC C2 GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC C3 GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC C4 GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC C5 GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC C6 GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC ************************************************** C1 TGTAGGTCTGCATTCGTATGCGGGAGTGGAC C2 TGTAGGTCTGCATTCGTATGCGGGAGTGGAC C3 TGTAGGTCTGCATTCGTATGCGGGAGTGGAC C4 TGTAGGTCTGCATTCGTATGCGGGAGTGGAC C5 TGTAGGTCTGCATTCGTATGCGGGAGTGGAC C6 TGTAGGTCTGCATTCGTATGCGGGAGTGGAC ******************************* >C1 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >C2 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >C3 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >C4 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >C5 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >C6 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >C1 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C2 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C3 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C4 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C5 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >C6 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 981 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579856288 Setting output file names to "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1675958154 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5759037610 Seed = 584117319 Swapseed = 1579856288 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2195.525020 -- -24.965149 Chain 2 -- -2195.525020 -- -24.965149 Chain 3 -- -2195.524892 -- -24.965149 Chain 4 -- -2195.525020 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2195.524687 -- -24.965149 Chain 2 -- -2195.525020 -- -24.965149 Chain 3 -- -2195.525020 -- -24.965149 Chain 4 -- -2195.525020 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2195.525] (-2195.525) (-2195.525) (-2195.525) * [-2195.525] (-2195.525) (-2195.525) (-2195.525) 500 -- [-1332.159] (-1329.151) (-1329.964) (-1337.940) * (-1318.094) [-1323.317] (-1329.331) (-1367.830) -- 0:00:00 1000 -- (-1323.288) (-1318.764) (-1314.422) [-1328.150] * (-1316.019) [-1316.039] (-1328.239) (-1345.620) -- 0:00:00 1500 -- (-1327.162) [-1322.076] (-1321.283) (-1319.636) * (-1325.910) (-1321.112) (-1326.663) [-1315.800] -- 0:00:00 2000 -- (-1324.723) (-1324.159) (-1328.873) [-1320.744] * (-1330.172) (-1320.945) [-1319.809] (-1320.033) -- 0:00:00 2500 -- (-1320.693) (-1323.238) (-1322.463) [-1323.929] * [-1321.358] (-1330.170) (-1319.237) (-1318.445) -- 0:00:00 3000 -- (-1331.099) (-1323.700) (-1320.907) [-1320.594] * [-1317.752] (-1323.274) (-1318.262) (-1317.548) -- 0:00:00 3500 -- [-1320.281] (-1319.138) (-1327.406) (-1321.633) * [-1319.690] (-1324.517) (-1326.205) (-1315.351) -- 0:00:00 4000 -- (-1323.459) (-1332.761) [-1323.051] (-1327.543) * [-1320.292] (-1317.605) (-1319.968) (-1315.003) -- 0:00:00 4500 -- (-1317.967) (-1319.120) [-1319.273] (-1330.237) * (-1333.010) [-1320.753] (-1318.993) (-1322.698) -- 0:00:00 5000 -- (-1318.891) [-1317.341] (-1326.158) (-1321.823) * (-1316.785) [-1322.077] (-1325.334) (-1323.278) -- 0:00:00 Average standard deviation of split frequencies: 0.121422 5500 -- [-1315.898] (-1317.710) (-1321.209) (-1317.203) * (-1323.434) (-1320.924) (-1324.747) [-1316.587] -- 0:00:00 6000 -- (-1322.579) (-1324.097) (-1322.319) [-1318.687] * (-1321.257) [-1329.928] (-1316.815) (-1316.302) -- 0:00:00 6500 -- (-1318.239) (-1328.416) (-1320.112) [-1322.577] * (-1325.733) [-1318.174] (-1319.863) (-1318.692) -- 0:00:00 7000 -- (-1316.073) (-1319.002) (-1328.197) [-1321.717] * (-1321.999) [-1323.601] (-1324.944) (-1318.330) -- 0:00:00 7500 -- (-1317.630) (-1322.799) (-1319.290) [-1327.755] * [-1318.328] (-1319.731) (-1327.102) (-1317.907) -- 0:00:00 8000 -- [-1321.482] (-1325.200) (-1326.295) (-1323.692) * (-1314.815) [-1315.058] (-1324.164) (-1319.554) -- 0:00:00 8500 -- [-1317.394] (-1319.475) (-1326.049) (-1325.352) * (-1329.702) (-1317.803) (-1321.263) [-1320.507] -- 0:00:00 9000 -- (-1321.442) (-1325.579) (-1325.626) [-1317.034] * (-1321.866) [-1316.471] (-1322.584) (-1324.610) -- 0:00:00 9500 -- (-1321.360) (-1324.408) (-1327.639) [-1319.844] * [-1323.768] (-1325.025) (-1324.173) (-1323.069) -- 0:00:00 10000 -- (-1325.728) [-1324.224] (-1320.848) (-1320.660) * [-1323.610] (-1315.256) (-1330.051) (-1321.260) -- 0:00:00 Average standard deviation of split frequencies: 0.079970 10500 -- (-1325.266) [-1318.361] (-1324.678) (-1323.970) * [-1315.249] (-1327.298) (-1323.066) (-1321.914) -- 0:00:00 11000 -- (-1320.980) (-1322.301) [-1321.283] (-1315.118) * [-1321.116] (-1321.886) (-1327.941) (-1319.746) -- 0:00:00 11500 -- [-1318.075] (-1314.633) (-1324.946) (-1321.573) * [-1324.986] (-1317.518) (-1310.615) (-1329.325) -- 0:00:00 12000 -- (-1334.396) [-1312.878] (-1323.194) (-1328.889) * (-1321.475) (-1320.731) (-1310.951) [-1322.729] -- 0:01:22 12500 -- (-1329.730) (-1319.541) [-1322.983] (-1324.724) * [-1315.681] (-1320.797) (-1311.334) (-1326.457) -- 0:01:19 13000 -- (-1318.542) [-1316.420] (-1316.593) (-1326.012) * (-1318.575) (-1338.231) (-1314.073) [-1316.598] -- 0:01:15 13500 -- (-1322.700) (-1315.488) [-1320.405] (-1320.504) * (-1322.194) [-1324.499] (-1315.352) (-1325.518) -- 0:01:13 14000 -- [-1319.658] (-1319.671) (-1319.854) (-1320.746) * (-1317.460) (-1318.939) (-1318.188) [-1318.831] -- 0:01:10 14500 -- (-1329.971) (-1331.969) [-1318.407] (-1314.683) * (-1316.370) (-1318.960) (-1314.237) [-1319.430] -- 0:01:07 15000 -- (-1328.372) (-1318.857) [-1320.651] (-1316.140) * (-1321.858) [-1326.315] (-1312.410) (-1326.267) -- 0:01:05 Average standard deviation of split frequencies: 0.067344 15500 -- [-1330.012] (-1323.308) (-1324.297) (-1324.595) * (-1323.693) (-1320.407) (-1310.239) [-1318.814] -- 0:01:03 16000 -- (-1318.397) (-1325.215) [-1315.619] (-1319.441) * (-1322.792) (-1323.099) (-1312.569) [-1320.491] -- 0:01:01 16500 -- [-1319.857] (-1323.784) (-1318.538) (-1320.583) * (-1320.111) (-1324.144) (-1311.995) [-1323.969] -- 0:00:59 17000 -- (-1324.204) (-1322.328) (-1320.483) [-1318.921] * (-1316.603) (-1322.477) [-1310.878] (-1318.171) -- 0:00:57 17500 -- (-1311.895) [-1315.364] (-1318.412) (-1327.564) * [-1319.544] (-1319.436) (-1311.468) (-1326.575) -- 0:00:56 18000 -- (-1312.438) [-1314.318] (-1324.737) (-1340.856) * (-1330.358) (-1326.258) (-1310.422) [-1319.979] -- 0:00:54 18500 -- [-1315.041] (-1319.448) (-1325.429) (-1323.748) * [-1322.891] (-1318.345) (-1313.421) (-1322.568) -- 0:00:53 19000 -- [-1311.964] (-1325.631) (-1319.655) (-1327.704) * (-1318.692) (-1324.163) (-1314.750) [-1314.968] -- 0:00:51 19500 -- (-1312.684) (-1321.868) [-1317.664] (-1329.214) * (-1316.757) (-1325.880) [-1311.453] (-1321.034) -- 0:00:50 20000 -- (-1314.625) [-1325.728] (-1324.900) (-1321.716) * [-1324.414] (-1325.208) (-1309.723) (-1326.676) -- 0:00:49 Average standard deviation of split frequencies: 0.052823 20500 -- [-1314.803] (-1316.264) (-1323.153) (-1319.996) * (-1321.364) (-1317.488) (-1310.898) [-1316.521] -- 0:00:47 21000 -- [-1310.447] (-1330.450) (-1318.075) (-1326.123) * [-1319.898] (-1317.382) (-1310.630) (-1325.497) -- 0:00:46 21500 -- (-1309.851) [-1326.540] (-1317.040) (-1319.331) * (-1319.560) (-1318.324) (-1315.873) [-1324.402] -- 0:00:45 22000 -- (-1311.022) [-1322.214] (-1326.196) (-1312.748) * (-1321.505) (-1321.173) [-1309.727] (-1320.185) -- 0:00:44 22500 -- (-1313.274) [-1318.550] (-1323.274) (-1316.202) * [-1318.312] (-1318.480) (-1313.780) (-1319.994) -- 0:00:43 23000 -- (-1312.779) [-1323.110] (-1321.629) (-1315.453) * (-1312.857) [-1317.851] (-1312.687) (-1324.332) -- 0:00:42 23500 -- (-1310.439) (-1332.010) [-1325.652] (-1314.231) * [-1316.170] (-1318.873) (-1315.677) (-1320.831) -- 0:00:41 24000 -- [-1311.949] (-1318.703) (-1329.085) (-1310.636) * (-1315.444) [-1322.203] (-1313.083) (-1333.187) -- 0:00:40 24500 -- (-1311.674) (-1321.309) (-1327.712) [-1310.649] * (-1325.615) [-1323.484] (-1312.042) (-1327.030) -- 0:00:39 25000 -- (-1310.780) [-1323.916] (-1325.885) (-1310.468) * [-1323.097] (-1321.583) (-1311.241) (-1333.656) -- 0:00:39 Average standard deviation of split frequencies: 0.041207 25500 -- (-1312.774) (-1322.320) (-1320.888) [-1311.089] * (-1317.603) (-1322.555) (-1312.144) [-1313.745] -- 0:00:38 26000 -- (-1312.861) [-1314.889] (-1325.122) (-1311.312) * (-1323.922) [-1318.320] (-1312.509) (-1313.792) -- 0:00:37 26500 -- [-1311.830] (-1325.735) (-1320.249) (-1310.970) * (-1325.892) (-1317.100) [-1311.324] (-1310.863) -- 0:00:36 27000 -- (-1310.240) [-1327.023] (-1320.030) (-1312.055) * (-1318.645) (-1320.822) (-1311.642) [-1314.520] -- 0:00:36 27500 -- (-1312.036) [-1314.019] (-1320.074) (-1311.607) * (-1321.588) (-1311.975) [-1311.202] (-1313.270) -- 0:01:10 28000 -- (-1311.125) (-1316.052) [-1320.618] (-1309.985) * (-1315.930) [-1313.519] (-1312.284) (-1309.903) -- 0:01:09 28500 -- (-1312.318) (-1323.281) [-1317.660] (-1311.588) * (-1318.657) [-1311.275] (-1313.176) (-1312.338) -- 0:01:08 29000 -- [-1312.734] (-1320.983) (-1323.707) (-1310.988) * (-1318.870) (-1311.395) [-1312.483] (-1313.660) -- 0:01:06 29500 -- (-1314.689) (-1324.075) (-1323.184) [-1310.723] * (-1318.052) (-1310.927) [-1313.948] (-1314.619) -- 0:01:05 30000 -- (-1310.780) (-1326.608) (-1319.683) [-1311.756] * (-1319.993) [-1312.765] (-1310.439) (-1314.300) -- 0:01:04 Average standard deviation of split frequencies: 0.045384 30500 -- (-1309.705) (-1321.864) (-1323.464) [-1310.839] * (-1320.205) [-1312.498] (-1313.310) (-1315.675) -- 0:01:03 31000 -- [-1311.397] (-1325.545) (-1319.640) (-1310.635) * (-1320.350) (-1310.338) [-1313.542] (-1313.290) -- 0:01:02 31500 -- (-1311.939) (-1327.482) (-1320.507) [-1313.347] * (-1322.901) [-1310.457] (-1312.738) (-1312.143) -- 0:01:01 32000 -- (-1313.001) (-1319.129) (-1324.096) [-1312.402] * [-1316.615] (-1309.859) (-1314.318) (-1313.200) -- 0:01:00 32500 -- (-1310.767) [-1321.866] (-1319.483) (-1312.480) * (-1318.473) [-1310.965] (-1311.385) (-1312.466) -- 0:00:59 33000 -- (-1310.713) (-1320.837) (-1320.511) [-1317.219] * [-1318.931] (-1312.913) (-1311.909) (-1311.877) -- 0:00:58 33500 -- (-1310.978) (-1321.963) [-1324.188] (-1310.469) * (-1327.411) [-1314.031] (-1312.362) (-1315.142) -- 0:00:57 34000 -- (-1311.859) (-1319.545) [-1318.777] (-1311.088) * (-1321.248) (-1310.868) (-1311.344) [-1313.304] -- 0:00:56 34500 -- [-1310.946] (-1325.363) (-1317.350) (-1314.591) * (-1327.396) (-1311.775) [-1315.888] (-1311.437) -- 0:00:55 35000 -- [-1310.997] (-1327.932) (-1321.778) (-1312.880) * (-1319.248) [-1310.511] (-1313.608) (-1315.326) -- 0:00:55 Average standard deviation of split frequencies: 0.035355 35500 -- (-1312.427) [-1316.812] (-1318.981) (-1310.620) * (-1325.229) [-1311.096] (-1313.719) (-1314.612) -- 0:00:54 36000 -- (-1311.021) [-1320.640] (-1326.068) (-1316.694) * (-1324.238) (-1311.702) [-1311.220] (-1311.055) -- 0:00:53 36500 -- [-1310.855] (-1321.082) (-1317.259) (-1313.713) * (-1316.329) (-1310.202) [-1311.970] (-1310.744) -- 0:00:52 37000 -- (-1310.202) [-1316.532] (-1325.086) (-1310.599) * [-1321.565] (-1314.705) (-1311.905) (-1311.329) -- 0:00:52 37500 -- (-1311.299) [-1322.557] (-1325.000) (-1310.285) * (-1314.911) (-1309.899) [-1313.325] (-1312.510) -- 0:00:51 38000 -- (-1310.691) (-1320.861) (-1319.449) [-1310.654] * (-1314.239) (-1309.776) [-1312.993] (-1312.046) -- 0:00:50 38500 -- (-1315.097) (-1323.192) (-1316.380) [-1312.526] * (-1314.091) (-1309.985) [-1317.849] (-1312.722) -- 0:00:49 39000 -- (-1318.795) (-1319.381) (-1321.418) [-1312.531] * (-1314.169) [-1311.386] (-1313.658) (-1313.226) -- 0:00:49 39500 -- (-1311.545) [-1316.832] (-1321.331) (-1313.640) * (-1311.498) (-1310.521) [-1314.504] (-1314.013) -- 0:00:48 40000 -- (-1310.114) (-1318.762) [-1314.468] (-1314.257) * [-1312.262] (-1310.510) (-1318.211) (-1312.874) -- 0:00:48 Average standard deviation of split frequencies: 0.050638 40500 -- (-1310.379) (-1318.179) [-1320.812] (-1312.521) * [-1312.952] (-1309.656) (-1319.288) (-1315.929) -- 0:00:47 41000 -- (-1314.619) (-1324.801) [-1321.317] (-1311.169) * (-1312.965) (-1311.278) [-1314.239] (-1313.566) -- 0:00:46 41500 -- (-1318.275) (-1319.954) [-1317.229] (-1312.049) * (-1312.615) (-1314.020) (-1314.524) [-1310.810] -- 0:00:46 42000 -- (-1315.001) [-1321.257] (-1326.635) (-1310.619) * [-1311.679] (-1314.715) (-1314.008) (-1312.754) -- 0:00:45 42500 -- [-1310.483] (-1319.970) (-1325.502) (-1310.584) * (-1317.908) [-1313.495] (-1313.040) (-1312.844) -- 0:00:45 43000 -- [-1311.310] (-1322.325) (-1325.687) (-1311.069) * (-1312.955) (-1310.619) (-1315.754) [-1312.671] -- 0:00:44 43500 -- [-1310.583] (-1320.747) (-1323.948) (-1313.377) * (-1313.059) [-1311.319] (-1319.348) (-1312.015) -- 0:01:05 44000 -- (-1313.598) [-1313.965] (-1319.935) (-1313.511) * (-1313.383) (-1311.174) (-1321.078) [-1311.572] -- 0:01:05 44500 -- (-1311.804) (-1324.172) (-1332.790) [-1311.634] * (-1310.191) [-1312.915] (-1311.570) (-1314.096) -- 0:01:04 45000 -- (-1312.684) (-1326.035) (-1319.279) [-1312.269] * (-1310.798) [-1310.573] (-1317.070) (-1310.808) -- 0:01:03 Average standard deviation of split frequencies: 0.043554 45500 -- [-1311.190] (-1322.678) (-1322.436) (-1312.218) * (-1312.876) [-1310.621] (-1311.937) (-1310.059) -- 0:01:02 46000 -- [-1311.446] (-1320.514) (-1328.296) (-1313.949) * (-1310.641) (-1310.607) [-1310.234] (-1312.554) -- 0:01:02 46500 -- (-1310.344) [-1323.209] (-1321.022) (-1310.881) * (-1314.095) [-1310.783] (-1310.233) (-1310.243) -- 0:01:01 47000 -- (-1311.678) (-1319.721) [-1317.527] (-1310.259) * (-1311.955) (-1311.059) [-1310.482] (-1312.041) -- 0:01:00 47500 -- (-1311.971) (-1319.649) (-1319.303) [-1311.473] * [-1311.681] (-1310.151) (-1311.514) (-1311.068) -- 0:01:00 48000 -- (-1310.248) [-1320.097] (-1319.039) (-1313.267) * (-1311.470) [-1311.687] (-1311.529) (-1310.419) -- 0:00:59 48500 -- [-1311.077] (-1319.154) (-1321.876) (-1312.231) * (-1315.576) (-1311.528) [-1312.101] (-1311.513) -- 0:00:58 49000 -- (-1313.412) (-1314.917) [-1319.617] (-1314.979) * (-1315.209) (-1311.256) [-1310.314] (-1313.975) -- 0:00:58 49500 -- [-1316.106] (-1317.208) (-1323.714) (-1314.828) * (-1312.981) (-1311.343) [-1313.417] (-1311.329) -- 0:00:57 50000 -- (-1311.663) (-1320.836) [-1317.437] (-1313.896) * (-1310.937) [-1310.722] (-1312.660) (-1312.789) -- 0:00:57 Average standard deviation of split frequencies: 0.042799 50500 -- (-1310.312) [-1324.713] (-1325.071) (-1315.860) * [-1310.961] (-1310.993) (-1311.608) (-1312.199) -- 0:00:56 51000 -- (-1310.730) (-1320.688) [-1318.803] (-1312.599) * (-1312.028) (-1313.155) (-1313.512) [-1313.360] -- 0:00:55 51500 -- [-1314.433] (-1322.728) (-1317.758) (-1311.293) * [-1310.206] (-1311.549) (-1312.506) (-1309.956) -- 0:00:55 52000 -- (-1310.616) [-1318.683] (-1315.451) (-1311.972) * (-1310.584) (-1309.584) (-1313.877) [-1310.357] -- 0:00:54 52500 -- (-1310.451) (-1322.391) (-1315.055) [-1311.923] * (-1311.470) (-1309.712) (-1315.700) [-1311.085] -- 0:00:54 53000 -- [-1319.904] (-1319.230) (-1322.527) (-1311.567) * (-1309.884) (-1310.454) (-1315.790) [-1310.765] -- 0:00:53 53500 -- (-1312.445) [-1315.484] (-1316.740) (-1311.815) * [-1310.659] (-1310.688) (-1315.508) (-1310.278) -- 0:00:53 54000 -- (-1311.347) (-1321.673) (-1317.831) [-1312.530] * (-1309.644) (-1312.832) (-1312.683) [-1310.204] -- 0:00:52 54500 -- [-1312.681] (-1319.457) (-1321.373) (-1314.482) * [-1310.644] (-1316.357) (-1312.755) (-1311.800) -- 0:00:52 55000 -- (-1311.465) (-1320.737) [-1318.122] (-1315.460) * (-1313.001) (-1311.851) [-1311.441] (-1311.372) -- 0:00:51 Average standard deviation of split frequencies: 0.044896 55500 -- (-1309.348) (-1315.470) (-1315.131) [-1313.702] * (-1312.446) (-1312.927) (-1312.012) [-1312.606] -- 0:00:51 56000 -- (-1309.349) (-1326.112) [-1316.773] (-1311.138) * [-1311.609] (-1312.221) (-1310.161) (-1312.281) -- 0:00:50 56500 -- (-1309.649) (-1326.044) [-1312.934] (-1312.370) * (-1311.678) (-1311.956) (-1312.648) [-1311.926] -- 0:00:50 57000 -- (-1309.709) (-1321.535) [-1317.986] (-1309.844) * [-1310.108] (-1311.891) (-1313.227) (-1309.877) -- 0:00:49 57500 -- (-1309.929) (-1324.069) (-1327.394) [-1309.963] * [-1310.567] (-1310.448) (-1313.514) (-1309.886) -- 0:00:49 58000 -- [-1310.587] (-1320.168) (-1316.219) (-1309.722) * (-1314.225) (-1311.540) [-1311.581] (-1310.396) -- 0:00:48 58500 -- (-1309.970) (-1324.562) (-1316.547) [-1310.731] * (-1310.330) (-1311.689) [-1312.629] (-1312.609) -- 0:00:48 59000 -- [-1309.969] (-1317.561) (-1325.667) (-1311.833) * (-1310.489) [-1312.151] (-1313.361) (-1311.973) -- 0:00:47 59500 -- [-1310.499] (-1320.598) (-1328.470) (-1310.771) * [-1310.456] (-1310.807) (-1313.429) (-1313.286) -- 0:01:03 60000 -- [-1311.117] (-1329.005) (-1320.847) (-1310.679) * (-1311.250) [-1310.822] (-1313.434) (-1313.556) -- 0:01:02 Average standard deviation of split frequencies: 0.042182 60500 -- (-1311.226) [-1320.397] (-1324.775) (-1317.084) * [-1313.191] (-1310.731) (-1310.531) (-1309.539) -- 0:01:02 61000 -- [-1309.596] (-1325.705) (-1327.847) (-1309.944) * (-1312.834) (-1312.398) (-1314.449) [-1309.556] -- 0:01:01 61500 -- (-1312.638) [-1317.295] (-1318.583) (-1309.944) * (-1311.841) (-1311.069) (-1314.754) [-1311.202] -- 0:01:01 62000 -- (-1313.098) (-1319.891) (-1318.574) [-1310.968] * [-1313.404] (-1311.674) (-1310.634) (-1311.587) -- 0:01:00 62500 -- (-1310.326) (-1324.197) (-1323.426) [-1310.465] * (-1315.693) (-1312.167) (-1315.378) [-1311.534] -- 0:01:00 63000 -- [-1311.420] (-1323.381) (-1316.476) (-1312.837) * (-1314.766) (-1311.262) (-1312.956) [-1312.043] -- 0:00:59 63500 -- (-1315.228) [-1310.893] (-1322.675) (-1313.315) * (-1313.114) [-1313.051] (-1311.670) (-1311.505) -- 0:00:58 64000 -- [-1310.259] (-1313.877) (-1321.417) (-1311.355) * [-1313.164] (-1312.414) (-1310.457) (-1310.550) -- 0:00:58 64500 -- (-1313.540) [-1312.255] (-1333.384) (-1310.565) * [-1311.247] (-1312.910) (-1311.067) (-1313.170) -- 0:00:58 65000 -- (-1312.770) (-1310.514) [-1322.768] (-1310.390) * (-1310.904) (-1312.644) [-1313.657] (-1311.722) -- 0:00:57 Average standard deviation of split frequencies: 0.039454 65500 -- (-1314.512) [-1310.243] (-1321.541) (-1312.922) * [-1310.622] (-1313.540) (-1313.976) (-1310.870) -- 0:00:57 66000 -- (-1314.678) (-1313.671) [-1315.836] (-1311.386) * (-1310.879) (-1310.808) [-1314.502] (-1314.065) -- 0:00:56 66500 -- (-1316.238) (-1314.483) (-1323.218) [-1310.769] * (-1313.257) [-1314.185] (-1313.688) (-1314.575) -- 0:00:56 67000 -- (-1312.792) (-1312.582) (-1323.008) [-1312.961] * [-1311.106] (-1312.026) (-1312.197) (-1311.536) -- 0:00:55 67500 -- (-1314.975) (-1311.917) (-1317.262) [-1311.973] * (-1310.988) [-1311.425] (-1312.574) (-1313.042) -- 0:00:55 68000 -- [-1313.165] (-1313.009) (-1321.403) (-1313.045) * (-1312.448) (-1311.915) [-1312.265] (-1311.950) -- 0:00:54 68500 -- (-1313.203) (-1314.813) [-1315.843] (-1312.775) * (-1312.637) [-1314.148] (-1311.456) (-1312.205) -- 0:00:54 69000 -- (-1310.387) (-1311.165) [-1318.955] (-1310.386) * [-1310.066] (-1312.055) (-1311.930) (-1312.068) -- 0:00:53 69500 -- (-1310.267) (-1311.206) (-1317.724) [-1311.369] * (-1310.952) [-1311.775] (-1312.830) (-1311.719) -- 0:00:53 70000 -- [-1311.009] (-1311.408) (-1320.954) (-1313.126) * (-1311.803) [-1312.477] (-1311.959) (-1313.285) -- 0:00:53 Average standard deviation of split frequencies: 0.035578 70500 -- [-1311.318] (-1310.354) (-1321.656) (-1314.374) * [-1312.138] (-1316.631) (-1313.338) (-1314.316) -- 0:00:52 71000 -- (-1311.245) (-1310.003) (-1318.991) [-1317.026] * [-1312.588] (-1315.261) (-1311.102) (-1312.818) -- 0:00:52 71500 -- (-1311.129) (-1310.843) (-1330.056) [-1314.106] * (-1310.677) (-1314.014) (-1313.514) [-1312.400] -- 0:00:51 72000 -- [-1312.271] (-1314.026) (-1317.673) (-1309.863) * (-1310.246) (-1314.155) (-1312.457) [-1313.229] -- 0:00:51 72500 -- (-1310.211) (-1316.852) [-1317.947] (-1309.946) * (-1310.028) (-1310.636) [-1315.730] (-1313.419) -- 0:00:51 73000 -- (-1310.421) (-1311.107) (-1323.040) [-1310.975] * (-1315.884) (-1311.531) [-1312.150] (-1313.533) -- 0:00:50 73500 -- (-1310.699) [-1311.616] (-1323.199) (-1311.270) * [-1309.597] (-1315.598) (-1310.143) (-1314.187) -- 0:00:50 74000 -- [-1310.609] (-1312.253) (-1326.323) (-1310.841) * [-1310.370] (-1314.620) (-1312.124) (-1320.837) -- 0:00:50 74500 -- (-1310.251) (-1316.508) [-1321.703] (-1311.206) * [-1310.303] (-1313.599) (-1314.955) (-1316.441) -- 0:00:49 75000 -- (-1311.529) (-1315.147) [-1314.464] (-1311.789) * (-1311.278) [-1310.941] (-1311.865) (-1318.643) -- 0:00:49 Average standard deviation of split frequencies: 0.029635 75500 -- (-1311.020) (-1310.968) [-1316.836] (-1312.647) * (-1310.489) [-1310.941] (-1311.816) (-1315.320) -- 0:01:01 76000 -- (-1309.858) (-1311.321) (-1316.970) [-1312.833] * (-1310.722) [-1310.671] (-1312.758) (-1312.419) -- 0:01:00 76500 -- (-1310.677) (-1309.546) (-1322.809) [-1310.883] * (-1313.064) (-1310.992) (-1311.500) [-1311.580] -- 0:01:00 77000 -- [-1313.849] (-1313.788) (-1328.275) (-1313.372) * [-1311.848] (-1311.460) (-1313.114) (-1311.310) -- 0:00:59 77500 -- [-1310.722] (-1311.724) (-1315.053) (-1313.132) * (-1312.918) (-1312.368) [-1313.333] (-1315.067) -- 0:00:59 78000 -- (-1310.687) (-1312.030) [-1319.924] (-1313.166) * (-1311.780) [-1311.794] (-1312.932) (-1311.452) -- 0:00:59 78500 -- [-1310.328] (-1310.154) (-1324.078) (-1313.764) * (-1310.919) [-1312.296] (-1311.959) (-1310.016) -- 0:00:58 79000 -- (-1312.280) (-1309.720) (-1319.719) [-1312.896] * (-1312.638) (-1312.350) (-1313.649) [-1311.053] -- 0:00:58 79500 -- (-1309.784) (-1309.808) (-1318.500) [-1312.305] * (-1313.842) (-1311.501) (-1319.262) [-1310.611] -- 0:00:57 80000 -- (-1309.665) [-1314.792] (-1321.381) (-1314.332) * [-1313.693] (-1311.037) (-1313.187) (-1311.461) -- 0:00:57 Average standard deviation of split frequencies: 0.028895 80500 -- (-1310.442) (-1315.566) [-1316.572] (-1312.076) * (-1311.286) (-1310.275) (-1312.830) [-1310.967] -- 0:00:57 81000 -- [-1310.360] (-1312.979) (-1319.666) (-1310.134) * [-1309.974] (-1316.343) (-1310.924) (-1315.414) -- 0:00:56 81500 -- [-1315.002] (-1313.480) (-1319.310) (-1310.690) * (-1309.905) (-1311.962) (-1310.934) [-1312.908] -- 0:00:56 82000 -- (-1314.861) (-1315.929) [-1323.241] (-1312.961) * (-1311.183) (-1311.453) (-1312.713) [-1317.029] -- 0:00:55 82500 -- (-1313.586) (-1316.155) (-1316.482) [-1310.986] * (-1312.463) (-1311.914) (-1312.087) [-1312.485] -- 0:00:55 83000 -- [-1311.995] (-1310.943) (-1317.625) (-1312.529) * [-1311.666] (-1310.099) (-1310.989) (-1313.233) -- 0:00:55 83500 -- [-1314.745] (-1311.633) (-1332.841) (-1313.196) * (-1314.383) [-1309.855] (-1313.305) (-1314.179) -- 0:00:54 84000 -- (-1312.694) [-1313.608] (-1324.097) (-1310.827) * (-1311.913) [-1309.817] (-1314.357) (-1313.058) -- 0:00:54 84500 -- [-1315.345] (-1313.349) (-1320.067) (-1311.717) * (-1311.371) [-1310.281] (-1313.784) (-1312.920) -- 0:00:54 85000 -- [-1314.119] (-1312.905) (-1324.198) (-1313.787) * (-1310.872) [-1309.781] (-1312.642) (-1310.249) -- 0:00:53 Average standard deviation of split frequencies: 0.027984 85500 -- (-1310.752) (-1313.197) [-1320.610] (-1310.029) * (-1312.878) (-1310.955) [-1311.480] (-1310.062) -- 0:00:53 86000 -- [-1312.471] (-1311.635) (-1326.321) (-1315.971) * (-1311.925) [-1311.971] (-1311.803) (-1309.835) -- 0:00:53 86500 -- (-1312.290) [-1312.652] (-1328.867) (-1313.382) * [-1310.618] (-1311.544) (-1311.624) (-1312.752) -- 0:00:52 87000 -- (-1310.474) (-1310.390) (-1318.633) [-1312.242] * [-1310.617] (-1317.495) (-1311.857) (-1314.600) -- 0:00:52 87500 -- (-1310.419) [-1310.412] (-1314.357) (-1310.581) * (-1311.245) (-1310.173) (-1312.633) [-1310.023] -- 0:00:52 88000 -- (-1310.848) (-1310.601) [-1313.374] (-1312.737) * (-1311.164) (-1310.173) [-1313.584] (-1311.502) -- 0:00:51 88500 -- (-1312.973) [-1310.286] (-1312.620) (-1310.624) * (-1311.033) (-1309.720) [-1316.098] (-1309.917) -- 0:00:51 89000 -- [-1316.051] (-1311.629) (-1310.066) (-1313.477) * (-1312.708) [-1309.791] (-1311.245) (-1310.333) -- 0:00:51 89500 -- (-1311.623) [-1310.780] (-1309.708) (-1310.530) * (-1314.424) (-1312.126) [-1314.391] (-1313.539) -- 0:00:50 90000 -- [-1311.320] (-1310.909) (-1317.194) (-1312.988) * (-1310.655) (-1313.513) (-1311.961) [-1310.705] -- 0:00:50 Average standard deviation of split frequencies: 0.027036 90500 -- (-1311.917) [-1315.133] (-1318.812) (-1312.625) * (-1313.184) (-1312.752) [-1312.365] (-1312.800) -- 0:00:50 91000 -- (-1312.280) (-1312.563) (-1317.236) [-1311.810] * (-1312.807) (-1315.910) [-1314.038] (-1310.343) -- 0:00:49 91500 -- (-1311.261) (-1315.032) [-1312.840] (-1312.536) * [-1316.449] (-1309.635) (-1316.086) (-1310.275) -- 0:00:49 92000 -- [-1311.151] (-1310.363) (-1316.811) (-1311.874) * (-1312.745) (-1310.475) (-1311.964) [-1312.615] -- 0:00:59 92500 -- (-1315.353) (-1312.713) (-1313.197) [-1311.105] * (-1315.838) [-1310.768] (-1313.212) (-1310.467) -- 0:00:58 93000 -- (-1318.613) (-1314.356) (-1313.589) [-1311.184] * [-1310.261] (-1310.595) (-1311.496) (-1312.132) -- 0:00:58 93500 -- (-1318.562) (-1312.473) (-1313.095) [-1310.182] * [-1310.655] (-1310.483) (-1313.407) (-1310.036) -- 0:00:58 94000 -- (-1311.693) (-1313.611) [-1312.746] (-1312.264) * (-1311.198) (-1310.190) (-1311.115) [-1310.481] -- 0:00:57 94500 -- (-1311.505) (-1312.978) [-1311.699] (-1311.995) * (-1310.102) [-1310.241] (-1312.601) (-1310.098) -- 0:00:57 95000 -- [-1310.532] (-1314.394) (-1310.307) (-1311.662) * (-1310.833) (-1312.516) [-1309.713] (-1310.630) -- 0:00:57 Average standard deviation of split frequencies: 0.024811 95500 -- (-1309.493) (-1316.419) [-1311.915] (-1310.508) * (-1312.320) (-1310.423) (-1309.541) [-1311.091] -- 0:00:56 96000 -- (-1311.982) (-1312.068) [-1314.299] (-1311.965) * (-1313.452) (-1311.644) (-1313.710) [-1309.716] -- 0:00:56 96500 -- (-1309.886) (-1311.496) [-1314.403] (-1312.962) * (-1319.210) [-1310.365] (-1310.613) (-1310.629) -- 0:00:56 97000 -- (-1312.516) (-1312.553) (-1314.598) [-1313.590] * (-1316.084) (-1311.819) [-1310.109] (-1312.884) -- 0:00:55 97500 -- [-1315.996] (-1313.699) (-1316.646) (-1312.811) * (-1314.659) (-1312.795) [-1309.811] (-1311.864) -- 0:00:55 98000 -- [-1314.684] (-1310.965) (-1315.912) (-1311.608) * (-1314.222) (-1312.338) [-1311.291] (-1310.015) -- 0:00:55 98500 -- (-1310.165) [-1310.467] (-1316.727) (-1313.188) * (-1312.646) (-1309.912) (-1313.091) [-1310.317] -- 0:00:54 99000 -- (-1309.815) [-1310.468] (-1315.446) (-1314.027) * (-1313.091) (-1309.935) (-1314.830) [-1310.374] -- 0:00:54 99500 -- [-1309.632] (-1312.836) (-1310.417) (-1312.440) * (-1313.375) (-1309.935) (-1310.130) [-1312.050] -- 0:00:54 100000 -- (-1310.042) (-1312.548) (-1311.309) [-1310.860] * (-1317.100) (-1310.230) [-1310.490] (-1310.025) -- 0:00:54 Average standard deviation of split frequencies: 0.025632 100500 -- [-1311.251] (-1311.147) (-1310.289) (-1311.473) * (-1312.775) (-1309.552) (-1312.330) [-1310.723] -- 0:00:53 101000 -- (-1310.708) (-1311.665) (-1310.497) [-1313.104] * (-1312.640) [-1311.205] (-1314.830) (-1310.564) -- 0:00:53 101500 -- (-1310.827) (-1311.498) [-1312.211] (-1311.478) * (-1312.378) [-1311.215] (-1312.481) (-1313.414) -- 0:00:53 102000 -- (-1311.612) [-1310.443] (-1311.343) (-1313.997) * (-1311.734) [-1309.668] (-1311.279) (-1310.160) -- 0:00:52 102500 -- [-1309.705] (-1311.312) (-1310.242) (-1310.807) * (-1311.294) [-1310.048] (-1314.831) (-1309.928) -- 0:00:52 103000 -- (-1310.855) (-1313.970) (-1314.212) [-1312.522] * [-1310.502] (-1311.464) (-1314.810) (-1309.878) -- 0:00:52 103500 -- (-1311.828) (-1313.432) [-1311.626] (-1314.480) * [-1313.452] (-1309.983) (-1316.165) (-1309.854) -- 0:00:51 104000 -- (-1311.002) (-1311.837) (-1309.704) [-1311.572] * (-1313.666) (-1310.777) (-1312.946) [-1311.931] -- 0:00:51 104500 -- (-1310.657) [-1311.394] (-1311.489) (-1311.930) * (-1312.103) (-1312.563) [-1311.885] (-1310.482) -- 0:00:51 105000 -- (-1313.377) (-1313.021) (-1310.248) [-1310.897] * (-1311.972) [-1311.373] (-1309.530) (-1312.366) -- 0:00:51 Average standard deviation of split frequencies: 0.023718 105500 -- [-1314.312] (-1311.926) (-1310.661) (-1311.533) * (-1311.463) (-1310.896) [-1309.556] (-1309.927) -- 0:00:50 106000 -- (-1317.407) [-1311.031] (-1314.216) (-1311.067) * (-1310.264) [-1310.165] (-1310.213) (-1310.994) -- 0:00:50 106500 -- (-1310.811) (-1312.886) [-1312.171] (-1313.966) * [-1311.345] (-1310.498) (-1310.746) (-1315.411) -- 0:00:50 107000 -- [-1311.063] (-1313.013) (-1313.080) (-1314.183) * (-1313.570) (-1311.285) [-1312.716] (-1311.558) -- 0:00:50 107500 -- (-1310.673) [-1314.237] (-1313.495) (-1314.081) * [-1313.690] (-1315.579) (-1309.811) (-1311.543) -- 0:00:49 108000 -- (-1311.513) (-1312.788) (-1316.029) [-1313.193] * (-1311.553) (-1314.149) [-1310.094] (-1311.067) -- 0:00:57 108500 -- [-1309.953] (-1313.211) (-1315.982) (-1310.889) * (-1312.503) [-1314.298] (-1311.442) (-1311.709) -- 0:00:57 109000 -- [-1310.882] (-1310.270) (-1312.862) (-1314.984) * [-1310.635] (-1312.482) (-1310.884) (-1312.628) -- 0:00:57 109500 -- [-1312.579] (-1310.029) (-1312.052) (-1311.643) * (-1314.448) (-1310.703) [-1311.732] (-1310.288) -- 0:00:56 110000 -- (-1313.587) (-1310.049) (-1310.166) [-1309.960] * (-1314.205) [-1310.698] (-1311.321) (-1311.367) -- 0:00:56 Average standard deviation of split frequencies: 0.024493 110500 -- (-1312.625) [-1312.345] (-1310.517) (-1312.080) * [-1315.237] (-1314.213) (-1309.620) (-1312.005) -- 0:00:56 111000 -- (-1315.079) (-1312.641) (-1314.213) [-1311.233] * (-1317.403) (-1310.724) (-1311.066) [-1310.422] -- 0:00:56 111500 -- (-1313.267) (-1311.048) (-1313.434) [-1310.206] * (-1316.123) (-1311.170) [-1311.367] (-1310.782) -- 0:00:55 112000 -- (-1310.791) [-1310.920] (-1311.108) (-1315.196) * (-1312.493) (-1311.109) (-1313.369) [-1311.133] -- 0:00:55 112500 -- (-1313.482) [-1309.765] (-1311.555) (-1318.604) * [-1310.323] (-1311.863) (-1310.347) (-1310.943) -- 0:00:55 113000 -- (-1311.530) [-1309.872] (-1313.226) (-1312.600) * (-1311.598) (-1313.895) (-1314.612) [-1311.488] -- 0:00:54 113500 -- (-1315.572) [-1310.214] (-1311.917) (-1312.774) * (-1310.208) (-1313.101) [-1313.413] (-1310.950) -- 0:00:54 114000 -- (-1313.538) [-1311.527] (-1312.679) (-1310.938) * (-1310.201) (-1311.646) (-1312.460) [-1310.502] -- 0:00:54 114500 -- (-1315.805) (-1310.068) (-1313.435) [-1312.035] * (-1310.193) (-1311.071) [-1313.871] (-1309.874) -- 0:00:54 115000 -- (-1314.122) (-1310.550) [-1311.954] (-1312.468) * (-1313.233) [-1310.064] (-1310.201) (-1311.518) -- 0:00:53 Average standard deviation of split frequencies: 0.023367 115500 -- [-1314.051] (-1312.640) (-1312.380) (-1311.082) * (-1315.200) [-1311.191] (-1310.607) (-1310.702) -- 0:00:53 116000 -- (-1311.931) (-1310.391) [-1312.481] (-1313.603) * (-1314.761) (-1311.232) (-1310.596) [-1310.568] -- 0:00:53 116500 -- (-1311.899) [-1309.986] (-1311.705) (-1316.416) * (-1313.561) (-1313.359) [-1311.806] (-1310.522) -- 0:00:53 117000 -- (-1311.927) [-1309.933] (-1313.905) (-1311.894) * (-1314.871) [-1310.229] (-1311.093) (-1310.119) -- 0:00:52 117500 -- [-1313.540] (-1310.945) (-1313.930) (-1310.728) * [-1312.519] (-1310.177) (-1311.806) (-1310.847) -- 0:00:52 118000 -- (-1314.186) (-1312.423) (-1317.805) [-1310.339] * (-1311.948) [-1309.738] (-1311.560) (-1315.726) -- 0:00:52 118500 -- (-1312.492) (-1313.459) (-1314.962) [-1310.483] * (-1315.973) [-1309.753] (-1313.499) (-1312.774) -- 0:00:52 119000 -- (-1313.231) [-1315.404] (-1320.844) (-1310.525) * (-1312.808) (-1309.730) (-1313.069) [-1312.673] -- 0:00:51 119500 -- [-1312.226] (-1310.637) (-1314.153) (-1310.306) * (-1312.196) (-1311.192) (-1311.684) [-1314.057] -- 0:00:51 120000 -- [-1312.962] (-1309.999) (-1313.485) (-1309.485) * [-1310.283] (-1310.905) (-1311.011) (-1310.834) -- 0:00:51 Average standard deviation of split frequencies: 0.023440 120500 -- [-1312.050] (-1312.856) (-1315.503) (-1311.193) * [-1309.912] (-1309.969) (-1310.913) (-1311.010) -- 0:00:51 121000 -- [-1311.506] (-1316.518) (-1312.511) (-1313.374) * [-1310.299] (-1311.376) (-1310.047) (-1309.933) -- 0:00:50 121500 -- (-1313.619) (-1310.848) [-1310.361] (-1311.376) * (-1313.148) (-1311.454) (-1310.482) [-1310.175] -- 0:00:50 122000 -- (-1313.814) [-1310.921] (-1310.442) (-1311.943) * (-1310.011) (-1311.220) [-1311.452] (-1311.741) -- 0:00:50 122500 -- (-1313.690) [-1310.890] (-1311.689) (-1314.099) * (-1309.765) (-1310.862) (-1313.765) [-1310.964] -- 0:00:50 123000 -- (-1316.065) [-1310.243] (-1311.663) (-1312.451) * (-1309.766) (-1312.051) (-1310.411) [-1309.689] -- 0:00:49 123500 -- (-1314.370) [-1310.235] (-1311.277) (-1310.544) * (-1309.449) (-1313.289) [-1311.787] (-1314.625) -- 0:00:49 124000 -- (-1313.270) [-1309.571] (-1313.076) (-1312.799) * (-1309.426) (-1317.426) [-1311.410] (-1310.520) -- 0:00:56 124500 -- (-1312.769) [-1309.560] (-1311.214) (-1312.531) * [-1310.474] (-1314.042) (-1310.687) (-1310.617) -- 0:00:56 125000 -- [-1310.942] (-1310.101) (-1312.731) (-1313.722) * (-1310.522) [-1313.848] (-1312.462) (-1313.257) -- 0:00:56 Average standard deviation of split frequencies: 0.022251 125500 -- [-1310.022] (-1310.776) (-1312.406) (-1311.341) * (-1312.187) (-1318.013) [-1311.348] (-1311.364) -- 0:00:55 126000 -- [-1310.549] (-1312.361) (-1311.249) (-1314.404) * (-1312.587) (-1312.056) [-1315.091] (-1311.210) -- 0:00:55 126500 -- (-1312.093) (-1311.275) [-1313.861] (-1312.144) * [-1311.169] (-1310.882) (-1314.596) (-1314.701) -- 0:00:55 127000 -- (-1310.196) [-1313.391] (-1311.849) (-1314.695) * (-1312.696) (-1310.564) (-1314.000) [-1310.924] -- 0:00:54 127500 -- (-1310.181) [-1310.620] (-1310.622) (-1316.908) * (-1313.375) (-1310.708) (-1316.714) [-1310.129] -- 0:00:54 128000 -- [-1310.989] (-1310.257) (-1313.761) (-1316.325) * (-1310.575) (-1311.735) (-1317.129) [-1317.514] -- 0:00:54 128500 -- [-1309.985] (-1311.169) (-1313.651) (-1315.790) * [-1313.716] (-1315.049) (-1313.909) (-1317.537) -- 0:00:54 129000 -- (-1310.283) (-1310.393) (-1312.423) [-1315.458] * (-1312.181) (-1310.604) (-1312.201) [-1311.762] -- 0:00:54 129500 -- (-1311.502) [-1310.485] (-1313.529) (-1310.368) * (-1311.753) (-1311.981) (-1313.503) [-1311.765] -- 0:00:53 130000 -- (-1311.520) (-1310.903) (-1313.856) [-1309.521] * [-1313.657] (-1311.063) (-1311.233) (-1316.585) -- 0:00:53 Average standard deviation of split frequencies: 0.020697 130500 -- (-1310.215) (-1310.902) (-1310.936) [-1309.523] * [-1313.238] (-1311.407) (-1312.425) (-1318.464) -- 0:00:53 131000 -- (-1309.584) [-1310.386] (-1315.604) (-1315.210) * (-1315.466) (-1310.537) (-1311.884) [-1318.578] -- 0:00:53 131500 -- (-1313.740) (-1312.464) (-1312.512) [-1313.732] * (-1313.174) (-1316.140) (-1312.908) [-1311.291] -- 0:00:52 132000 -- (-1312.492) [-1309.735] (-1311.986) (-1313.732) * (-1311.101) [-1311.324] (-1312.340) (-1311.379) -- 0:00:52 132500 -- [-1310.230] (-1310.324) (-1310.152) (-1309.468) * (-1310.285) (-1311.014) [-1311.794] (-1311.552) -- 0:00:52 133000 -- (-1310.436) [-1311.294] (-1311.599) (-1311.498) * (-1310.236) [-1311.107] (-1310.263) (-1312.210) -- 0:00:52 133500 -- [-1313.002] (-1310.961) (-1310.604) (-1310.962) * (-1310.724) [-1312.718] (-1311.585) (-1314.410) -- 0:00:51 134000 -- [-1309.950] (-1309.609) (-1311.382) (-1311.791) * (-1310.769) [-1314.014] (-1310.991) (-1312.510) -- 0:00:51 134500 -- (-1310.153) (-1310.855) (-1312.814) [-1312.915] * [-1311.602] (-1313.021) (-1312.086) (-1311.439) -- 0:00:51 135000 -- [-1309.729] (-1311.059) (-1312.740) (-1309.874) * (-1311.728) (-1312.854) [-1309.814] (-1311.239) -- 0:00:51 Average standard deviation of split frequencies: 0.020615 135500 -- (-1310.523) (-1311.184) [-1311.140] (-1309.756) * [-1310.273] (-1312.111) (-1310.387) (-1311.575) -- 0:00:51 136000 -- (-1310.151) (-1311.318) [-1310.954] (-1310.254) * (-1310.857) (-1314.250) [-1310.148] (-1311.566) -- 0:00:50 136500 -- [-1310.983] (-1313.297) (-1312.033) (-1309.716) * (-1310.919) (-1315.792) (-1310.549) [-1311.517] -- 0:00:50 137000 -- (-1310.545) (-1310.856) (-1313.513) [-1310.696] * (-1311.106) (-1314.155) [-1310.429] (-1312.164) -- 0:00:50 137500 -- (-1310.545) (-1310.490) (-1312.534) [-1312.200] * [-1311.108] (-1312.723) (-1309.710) (-1311.722) -- 0:00:50 138000 -- (-1311.037) [-1311.887] (-1312.037) (-1313.116) * (-1316.467) [-1311.614] (-1310.004) (-1313.355) -- 0:00:49 138500 -- (-1310.671) (-1313.666) (-1311.722) [-1313.013] * (-1314.868) (-1312.178) (-1314.930) [-1311.116] -- 0:00:49 139000 -- [-1311.018] (-1310.210) (-1315.416) (-1315.579) * (-1312.662) [-1310.115] (-1309.594) (-1314.684) -- 0:00:49 139500 -- [-1312.281] (-1313.608) (-1312.999) (-1316.780) * [-1312.609] (-1312.010) (-1313.419) (-1313.806) -- 0:00:49 140000 -- [-1310.988] (-1311.781) (-1312.355) (-1317.873) * (-1313.419) (-1312.529) (-1312.520) [-1314.128] -- 0:00:49 Average standard deviation of split frequencies: 0.019319 140500 -- (-1311.415) (-1314.221) [-1310.911] (-1316.216) * (-1313.049) (-1311.711) (-1312.912) [-1309.535] -- 0:00:55 141000 -- [-1310.163] (-1315.631) (-1310.720) (-1314.457) * (-1314.828) (-1313.552) [-1315.775] (-1309.535) -- 0:00:54 141500 -- (-1309.756) (-1313.625) (-1312.827) [-1311.708] * (-1309.905) (-1310.559) (-1316.262) [-1311.910] -- 0:00:54 142000 -- (-1311.958) [-1313.718] (-1310.725) (-1311.394) * (-1312.733) [-1310.498] (-1314.784) (-1310.348) -- 0:00:54 142500 -- (-1313.626) (-1316.398) (-1314.990) [-1310.030] * [-1313.570] (-1310.498) (-1314.619) (-1310.924) -- 0:00:54 143000 -- (-1312.152) [-1318.223] (-1311.326) (-1310.359) * (-1312.327) [-1311.987] (-1315.019) (-1310.817) -- 0:00:53 143500 -- (-1312.937) (-1313.383) (-1317.925) [-1309.922] * (-1310.876) (-1313.615) (-1314.132) [-1309.877] -- 0:00:53 144000 -- (-1311.288) (-1313.810) [-1313.277] (-1312.736) * (-1317.052) (-1309.819) (-1311.132) [-1309.932] -- 0:00:53 144500 -- [-1311.731] (-1314.065) (-1310.922) (-1315.704) * (-1310.994) (-1309.784) (-1311.382) [-1311.377] -- 0:00:53 145000 -- (-1313.871) [-1311.069] (-1310.792) (-1311.372) * (-1310.539) [-1309.717] (-1315.277) (-1317.844) -- 0:00:53 Average standard deviation of split frequencies: 0.018353 145500 -- [-1316.137] (-1312.370) (-1310.854) (-1313.356) * (-1310.794) (-1309.617) [-1312.364] (-1316.427) -- 0:00:52 146000 -- (-1313.106) [-1312.718] (-1312.069) (-1310.957) * (-1311.490) [-1310.148] (-1316.967) (-1311.144) -- 0:00:52 146500 -- [-1310.741] (-1312.842) (-1311.479) (-1313.275) * (-1313.034) (-1310.078) (-1309.990) [-1311.098] -- 0:00:52 147000 -- (-1311.990) (-1310.441) (-1311.121) [-1311.663] * (-1311.802) (-1311.536) (-1312.039) [-1310.100] -- 0:00:52 147500 -- [-1312.157] (-1312.167) (-1310.188) (-1312.926) * [-1311.110] (-1312.966) (-1309.468) (-1317.359) -- 0:00:52 148000 -- (-1310.529) (-1313.733) (-1309.710) [-1310.637] * (-1313.822) (-1310.592) [-1311.464] (-1310.139) -- 0:00:51 148500 -- (-1312.662) (-1315.207) (-1310.080) [-1311.374] * (-1310.803) [-1311.004] (-1313.560) (-1309.484) -- 0:00:51 149000 -- (-1310.468) (-1313.538) [-1312.250] (-1311.935) * (-1312.294) (-1317.167) [-1313.056] (-1309.898) -- 0:00:51 149500 -- [-1317.716] (-1311.927) (-1311.949) (-1310.677) * (-1313.534) (-1309.451) (-1312.039) [-1311.034] -- 0:00:51 150000 -- (-1313.287) (-1309.855) [-1314.844] (-1312.278) * (-1314.687) [-1309.927] (-1312.145) (-1310.231) -- 0:00:51 Average standard deviation of split frequencies: 0.018279 150500 -- (-1309.889) [-1310.911] (-1315.160) (-1310.504) * [-1312.387] (-1309.861) (-1310.826) (-1310.624) -- 0:00:50 151000 -- (-1309.859) (-1311.174) (-1310.650) [-1310.492] * (-1312.386) [-1310.727] (-1311.465) (-1310.627) -- 0:00:50 151500 -- (-1313.403) (-1312.167) (-1313.873) [-1317.273] * (-1311.848) [-1315.840] (-1310.898) (-1314.883) -- 0:00:50 152000 -- (-1313.318) (-1311.665) [-1311.086] (-1311.206) * (-1311.569) [-1310.144] (-1311.208) (-1313.436) -- 0:00:50 152500 -- [-1312.394] (-1309.925) (-1311.752) (-1309.720) * (-1315.256) (-1315.721) [-1310.420] (-1314.313) -- 0:00:50 153000 -- (-1313.355) (-1310.515) [-1311.065] (-1311.399) * (-1313.031) [-1313.139] (-1312.446) (-1310.803) -- 0:00:49 153500 -- (-1315.572) (-1310.116) (-1311.507) [-1309.428] * (-1311.986) (-1310.231) [-1314.433] (-1310.711) -- 0:00:49 154000 -- (-1314.323) (-1315.663) (-1312.816) [-1311.108] * (-1312.450) (-1310.227) (-1312.898) [-1310.451] -- 0:00:49 154500 -- (-1314.498) (-1316.476) (-1310.720) [-1311.567] * [-1310.868] (-1313.738) (-1311.888) (-1312.695) -- 0:00:49 155000 -- [-1311.181] (-1315.630) (-1310.559) (-1313.574) * (-1312.651) (-1312.090) (-1312.393) [-1312.047] -- 0:00:49 Average standard deviation of split frequencies: 0.017654 155500 -- (-1312.833) (-1310.620) (-1311.381) [-1313.031] * (-1311.627) (-1314.026) [-1312.007] (-1314.334) -- 0:00:48 156000 -- [-1312.788] (-1309.934) (-1310.102) (-1311.200) * (-1312.467) (-1311.479) (-1316.349) [-1311.346] -- 0:00:48 156500 -- (-1313.652) [-1309.940] (-1312.069) (-1310.220) * (-1312.483) (-1310.709) (-1314.628) [-1309.917] -- 0:00:53 157000 -- (-1315.398) [-1312.456] (-1313.727) (-1311.092) * [-1313.402] (-1311.260) (-1313.756) (-1310.545) -- 0:00:53 157500 -- (-1315.489) (-1318.029) (-1313.073) [-1315.173] * (-1311.706) [-1312.684] (-1314.660) (-1313.839) -- 0:00:53 158000 -- (-1313.998) [-1317.571] (-1310.723) (-1310.724) * (-1311.626) [-1310.246] (-1311.090) (-1313.981) -- 0:00:53 158500 -- [-1310.260] (-1319.852) (-1312.176) (-1310.222) * (-1315.159) (-1313.406) (-1310.253) [-1311.614] -- 0:00:53 159000 -- [-1314.006] (-1314.103) (-1314.502) (-1311.729) * (-1312.649) (-1312.804) [-1315.428] (-1312.737) -- 0:00:52 159500 -- (-1311.067) [-1312.046] (-1313.221) (-1311.467) * (-1310.453) (-1315.124) [-1311.435] (-1315.828) -- 0:00:52 160000 -- (-1314.873) (-1310.531) [-1312.826] (-1311.631) * (-1312.082) [-1315.724] (-1310.512) (-1311.427) -- 0:00:52 Average standard deviation of split frequencies: 0.017777 160500 -- (-1313.116) (-1310.465) (-1313.026) [-1311.042] * (-1313.048) (-1311.799) [-1310.802] (-1310.212) -- 0:00:52 161000 -- (-1313.589) (-1310.536) (-1310.702) [-1312.535] * (-1309.959) [-1312.853] (-1313.405) (-1311.736) -- 0:00:52 161500 -- (-1310.496) (-1310.802) (-1311.072) [-1311.392] * (-1311.896) [-1311.957] (-1312.160) (-1311.304) -- 0:00:51 162000 -- (-1310.172) (-1309.881) [-1314.119] (-1311.474) * [-1310.368] (-1313.789) (-1310.702) (-1310.070) -- 0:00:51 162500 -- (-1310.396) [-1309.779] (-1312.114) (-1311.943) * (-1310.009) (-1311.391) [-1311.055] (-1312.154) -- 0:00:51 163000 -- (-1312.269) [-1309.634] (-1311.349) (-1311.629) * (-1309.906) (-1313.133) (-1312.791) [-1310.144] -- 0:00:51 163500 -- (-1313.523) (-1310.042) (-1312.038) [-1311.771] * (-1310.616) (-1311.637) (-1311.666) [-1310.076] -- 0:00:51 164000 -- (-1311.690) [-1313.479] (-1311.587) (-1315.481) * (-1315.305) [-1310.522] (-1311.158) (-1314.797) -- 0:00:50 164500 -- (-1311.619) [-1309.688] (-1314.613) (-1312.825) * (-1312.223) [-1310.678] (-1310.369) (-1312.529) -- 0:00:50 165000 -- (-1314.386) (-1309.996) [-1314.760] (-1318.157) * (-1311.100) (-1310.096) [-1309.778] (-1312.523) -- 0:00:50 Average standard deviation of split frequencies: 0.015903 165500 -- (-1314.176) (-1311.366) [-1313.317] (-1310.527) * [-1313.531] (-1309.930) (-1311.511) (-1312.327) -- 0:00:50 166000 -- (-1310.692) [-1311.382] (-1311.497) (-1310.091) * (-1314.416) [-1310.431] (-1313.163) (-1310.901) -- 0:00:50 166500 -- (-1323.145) (-1311.070) (-1312.610) [-1310.253] * (-1311.171) (-1310.329) [-1312.342] (-1314.488) -- 0:00:50 167000 -- [-1315.235] (-1311.160) (-1313.982) (-1312.825) * (-1310.073) (-1316.018) [-1310.387] (-1313.695) -- 0:00:49 167500 -- (-1313.556) [-1312.612] (-1315.663) (-1311.975) * (-1310.133) [-1312.066] (-1311.625) (-1309.707) -- 0:00:49 168000 -- (-1310.532) (-1311.286) (-1316.900) [-1313.892] * (-1310.063) (-1312.447) (-1315.863) [-1311.260] -- 0:00:49 168500 -- (-1313.971) (-1310.656) (-1312.512) [-1312.936] * (-1313.032) (-1310.686) (-1315.403) [-1309.641] -- 0:00:49 169000 -- [-1309.985] (-1313.791) (-1313.257) (-1312.185) * [-1310.583] (-1310.426) (-1312.554) (-1309.933) -- 0:00:49 169500 -- (-1310.276) (-1310.434) [-1313.208] (-1312.136) * [-1314.044] (-1310.436) (-1312.941) (-1309.806) -- 0:00:48 170000 -- [-1311.463] (-1310.241) (-1311.690) (-1310.915) * (-1313.700) (-1316.603) (-1312.996) [-1310.183] -- 0:00:48 Average standard deviation of split frequencies: 0.015345 170500 -- (-1312.846) (-1311.981) [-1313.011] (-1311.474) * (-1315.930) (-1310.026) [-1313.381] (-1309.825) -- 0:00:48 171000 -- [-1311.667] (-1311.717) (-1312.428) (-1311.569) * (-1312.494) (-1309.786) (-1314.357) [-1309.874] -- 0:00:48 171500 -- (-1309.728) (-1311.738) [-1312.823] (-1312.111) * (-1310.767) (-1315.331) (-1314.991) [-1310.356] -- 0:00:48 172000 -- (-1313.927) (-1312.472) (-1314.446) [-1312.801] * (-1311.115) (-1315.172) (-1312.053) [-1313.167] -- 0:00:48 172500 -- (-1311.404) (-1310.939) (-1314.777) [-1312.415] * (-1311.293) (-1311.972) [-1315.283] (-1314.230) -- 0:00:52 173000 -- (-1310.342) [-1312.706] (-1317.911) (-1311.645) * (-1310.950) (-1310.394) [-1310.251] (-1316.860) -- 0:00:52 173500 -- [-1311.210] (-1312.370) (-1313.459) (-1313.638) * [-1310.864] (-1312.010) (-1313.820) (-1312.468) -- 0:00:52 174000 -- [-1310.079] (-1310.556) (-1313.441) (-1313.684) * (-1317.048) [-1311.512] (-1316.511) (-1311.840) -- 0:00:52 174500 -- (-1313.275) [-1310.403] (-1311.760) (-1313.117) * (-1315.560) (-1311.362) (-1310.617) [-1311.665] -- 0:00:52 175000 -- (-1311.010) (-1312.213) (-1313.611) [-1311.438] * [-1310.332] (-1310.161) (-1311.802) (-1311.083) -- 0:00:51 Average standard deviation of split frequencies: 0.016666 175500 -- (-1311.343) (-1312.560) [-1310.428] (-1310.427) * [-1312.361] (-1314.095) (-1310.111) (-1312.129) -- 0:00:51 176000 -- (-1313.007) (-1311.054) (-1313.437) [-1310.587] * (-1313.234) (-1312.606) (-1311.847) [-1310.251] -- 0:00:51 176500 -- (-1312.539) (-1312.162) [-1313.172] (-1310.428) * (-1313.867) (-1314.238) [-1311.537] (-1311.947) -- 0:00:51 177000 -- (-1313.664) (-1310.696) (-1311.329) [-1310.191] * (-1310.296) (-1310.594) [-1311.727] (-1310.582) -- 0:00:51 177500 -- [-1311.459] (-1309.521) (-1313.861) (-1312.209) * (-1310.368) (-1313.463) [-1311.814] (-1312.201) -- 0:00:50 178000 -- (-1314.015) [-1311.470] (-1310.824) (-1312.202) * (-1313.805) (-1316.011) (-1311.091) [-1310.655] -- 0:00:50 178500 -- (-1311.704) (-1316.733) (-1311.441) [-1310.244] * [-1309.625] (-1314.297) (-1311.797) (-1310.142) -- 0:00:50 179000 -- [-1309.947] (-1311.191) (-1309.954) (-1310.800) * (-1309.732) [-1312.746] (-1310.004) (-1311.154) -- 0:00:50 179500 -- (-1309.798) (-1311.011) [-1312.155] (-1314.403) * (-1311.296) (-1312.409) (-1312.798) [-1310.124] -- 0:00:50 180000 -- (-1309.798) (-1310.749) (-1312.991) [-1310.668] * (-1310.272) (-1310.977) [-1313.738] (-1312.462) -- 0:00:50 Average standard deviation of split frequencies: 0.015349 180500 -- (-1310.903) (-1310.408) [-1312.079] (-1311.409) * [-1311.062] (-1310.144) (-1311.990) (-1317.240) -- 0:00:49 181000 -- [-1312.308] (-1310.749) (-1312.226) (-1312.354) * [-1314.092] (-1310.569) (-1310.648) (-1314.681) -- 0:00:49 181500 -- (-1316.677) [-1311.195] (-1312.346) (-1312.455) * (-1311.695) [-1309.952] (-1310.620) (-1312.904) -- 0:00:49 182000 -- (-1316.407) (-1317.350) (-1312.127) [-1310.653] * (-1312.451) (-1311.858) (-1311.532) [-1311.065] -- 0:00:49 182500 -- (-1313.663) (-1315.899) (-1313.781) [-1310.694] * (-1311.057) (-1311.730) [-1313.364] (-1312.214) -- 0:00:49 183000 -- (-1313.118) (-1313.476) (-1313.961) [-1310.249] * (-1320.775) [-1312.800] (-1311.251) (-1312.559) -- 0:00:49 183500 -- (-1312.750) [-1310.177] (-1310.140) (-1310.086) * (-1314.393) (-1313.046) [-1312.553] (-1311.590) -- 0:00:48 184000 -- (-1313.035) [-1310.275] (-1309.754) (-1311.344) * (-1311.015) (-1310.819) [-1313.393] (-1310.745) -- 0:00:48 184500 -- (-1310.705) (-1310.753) [-1311.053] (-1311.921) * (-1312.064) [-1312.412] (-1312.605) (-1312.860) -- 0:00:48 185000 -- (-1311.708) [-1310.213] (-1313.386) (-1311.011) * [-1311.097] (-1312.239) (-1317.034) (-1314.017) -- 0:00:48 Average standard deviation of split frequencies: 0.015058 185500 -- [-1311.552] (-1311.240) (-1311.078) (-1311.922) * [-1310.622] (-1313.367) (-1313.598) (-1311.454) -- 0:00:48 186000 -- [-1310.952] (-1311.754) (-1311.102) (-1312.130) * (-1310.720) [-1311.397] (-1313.215) (-1313.651) -- 0:00:48 186500 -- (-1311.624) (-1311.314) [-1310.776] (-1311.843) * (-1311.314) [-1313.111] (-1310.734) (-1312.763) -- 0:00:47 187000 -- (-1312.349) (-1310.982) (-1311.233) [-1310.792] * (-1310.344) [-1314.219] (-1319.639) (-1312.051) -- 0:00:47 187500 -- [-1310.879] (-1313.449) (-1310.021) (-1311.946) * (-1309.891) (-1312.988) (-1310.755) [-1312.367] -- 0:00:47 188000 -- (-1312.453) (-1312.195) (-1311.077) [-1313.034] * (-1313.770) [-1312.012] (-1311.115) (-1310.814) -- 0:00:47 188500 -- (-1313.062) (-1315.183) (-1310.404) [-1311.924] * (-1310.812) [-1313.313] (-1311.978) (-1311.274) -- 0:00:47 189000 -- (-1311.608) (-1315.322) (-1313.057) [-1309.992] * [-1312.774] (-1313.794) (-1310.154) (-1314.067) -- 0:00:51 189500 -- (-1311.517) [-1310.652] (-1311.851) (-1309.975) * (-1313.474) [-1317.124] (-1311.370) (-1315.569) -- 0:00:51 190000 -- (-1314.396) [-1310.853] (-1312.128) (-1310.379) * (-1313.386) (-1316.506) [-1311.453] (-1314.674) -- 0:00:51 Average standard deviation of split frequencies: 0.014980 190500 -- (-1318.055) (-1312.145) (-1314.558) [-1314.421] * (-1312.369) [-1313.259] (-1319.009) (-1313.207) -- 0:00:50 191000 -- (-1312.929) [-1310.739] (-1315.645) (-1310.970) * (-1311.635) (-1311.066) [-1313.355] (-1311.468) -- 0:00:50 191500 -- [-1310.588] (-1309.537) (-1312.865) (-1310.675) * (-1312.088) [-1310.909] (-1312.121) (-1313.706) -- 0:00:50 192000 -- (-1317.049) [-1312.632] (-1313.780) (-1311.595) * [-1311.769] (-1311.967) (-1312.298) (-1312.285) -- 0:00:50 192500 -- (-1311.148) (-1312.284) (-1312.571) [-1311.402] * (-1316.020) (-1310.655) (-1314.453) [-1311.851] -- 0:00:50 193000 -- (-1310.703) (-1310.703) [-1313.833] (-1312.492) * [-1314.656] (-1312.748) (-1313.062) (-1310.975) -- 0:00:50 193500 -- (-1311.857) (-1310.397) (-1312.389) [-1310.521] * (-1312.977) (-1312.532) [-1311.610] (-1310.296) -- 0:00:50 194000 -- [-1312.171] (-1309.826) (-1312.173) (-1312.010) * (-1312.457) (-1312.154) [-1312.830] (-1310.166) -- 0:00:49 194500 -- (-1311.329) (-1309.844) (-1309.882) [-1311.513] * (-1311.722) (-1315.308) [-1313.430] (-1310.217) -- 0:00:49 195000 -- (-1311.452) (-1310.239) [-1310.161] (-1310.368) * (-1312.439) [-1309.418] (-1314.282) (-1311.065) -- 0:00:49 Average standard deviation of split frequencies: 0.013865 195500 -- (-1311.816) (-1310.237) [-1309.929] (-1310.407) * (-1311.292) [-1311.315] (-1310.766) (-1310.730) -- 0:00:49 196000 -- (-1315.884) (-1310.106) (-1316.146) [-1310.087] * (-1313.577) (-1310.305) (-1311.081) [-1312.751] -- 0:00:49 196500 -- (-1313.720) (-1310.590) [-1310.056] (-1311.544) * (-1311.719) (-1310.251) (-1312.543) [-1310.175] -- 0:00:49 197000 -- [-1311.269] (-1310.675) (-1311.888) (-1311.090) * (-1309.748) (-1311.833) (-1312.276) [-1309.831] -- 0:00:48 197500 -- (-1315.946) (-1312.533) (-1313.897) [-1310.675] * (-1309.633) [-1310.032] (-1314.039) (-1309.565) -- 0:00:48 198000 -- [-1317.975] (-1310.507) (-1317.626) (-1309.976) * (-1310.186) [-1309.689] (-1312.607) (-1309.426) -- 0:00:48 198500 -- [-1312.150] (-1310.509) (-1316.341) (-1311.464) * [-1314.264] (-1310.796) (-1315.024) (-1310.249) -- 0:00:48 199000 -- (-1310.843) [-1313.357] (-1315.391) (-1311.044) * (-1314.127) [-1311.605] (-1316.963) (-1310.364) -- 0:00:48 199500 -- (-1311.435) [-1311.017] (-1314.678) (-1310.799) * [-1312.013] (-1311.547) (-1309.887) (-1310.713) -- 0:00:48 200000 -- (-1311.432) (-1311.148) [-1313.837] (-1310.702) * [-1311.771] (-1310.993) (-1310.292) (-1310.456) -- 0:00:48 Average standard deviation of split frequencies: 0.012480 200500 -- (-1310.937) [-1310.962] (-1311.814) (-1310.614) * (-1313.703) (-1310.512) [-1310.667] (-1313.390) -- 0:00:47 201000 -- [-1310.943] (-1310.514) (-1314.022) (-1311.868) * (-1313.575) (-1311.397) [-1312.400] (-1310.913) -- 0:00:47 201500 -- (-1310.144) (-1311.727) (-1311.906) [-1312.546] * (-1314.822) [-1312.649] (-1311.791) (-1311.565) -- 0:00:47 202000 -- (-1311.465) (-1314.637) [-1311.341] (-1311.295) * (-1314.434) (-1315.075) (-1310.847) [-1309.842] -- 0:00:47 202500 -- [-1310.040] (-1314.212) (-1311.341) (-1311.136) * (-1313.082) (-1318.290) (-1313.352) [-1310.440] -- 0:00:47 203000 -- [-1310.387] (-1311.853) (-1314.091) (-1311.309) * (-1313.006) [-1311.513] (-1312.010) (-1312.748) -- 0:00:47 203500 -- (-1314.241) (-1311.677) (-1309.910) [-1309.849] * (-1313.219) (-1312.989) (-1311.844) [-1312.886] -- 0:00:46 204000 -- (-1314.228) (-1310.031) (-1311.243) [-1311.144] * (-1311.702) [-1313.520] (-1310.787) (-1320.342) -- 0:00:46 204500 -- (-1310.919) (-1311.288) (-1311.507) [-1310.241] * (-1315.046) (-1311.946) [-1309.926] (-1314.192) -- 0:00:46 205000 -- (-1311.014) (-1312.499) (-1312.719) [-1312.816] * (-1313.427) [-1311.210] (-1310.648) (-1313.058) -- 0:00:50 Average standard deviation of split frequencies: 0.011711 205500 -- (-1311.826) [-1310.829] (-1310.410) (-1313.476) * (-1311.547) (-1311.464) [-1310.235] (-1315.194) -- 0:00:50 206000 -- (-1310.592) [-1311.105] (-1312.877) (-1311.638) * [-1310.884] (-1309.931) (-1313.663) (-1313.304) -- 0:00:50 206500 -- (-1310.496) [-1312.772] (-1312.587) (-1323.524) * (-1313.492) (-1309.750) (-1317.168) [-1313.733] -- 0:00:49 207000 -- (-1310.685) (-1311.903) [-1311.621] (-1317.483) * (-1311.172) (-1312.590) (-1312.251) [-1312.605] -- 0:00:49 207500 -- (-1310.023) (-1312.627) [-1310.219] (-1315.247) * [-1311.616] (-1312.583) (-1310.592) (-1312.041) -- 0:00:49 208000 -- (-1309.495) (-1310.602) (-1310.971) [-1313.854] * (-1312.280) (-1310.550) [-1311.490] (-1312.836) -- 0:00:49 208500 -- (-1310.736) (-1316.345) [-1311.064] (-1316.579) * (-1312.214) (-1312.463) [-1312.247] (-1312.976) -- 0:00:49 209000 -- (-1313.277) (-1311.394) (-1310.971) [-1315.359] * (-1311.659) (-1316.637) (-1311.818) [-1312.938] -- 0:00:49 209500 -- (-1313.579) [-1310.893] (-1311.887) (-1314.167) * (-1310.739) [-1310.790] (-1314.553) (-1311.458) -- 0:00:49 210000 -- (-1312.554) (-1311.754) (-1310.072) [-1311.980] * (-1310.529) (-1310.149) (-1314.293) [-1310.502] -- 0:00:48 Average standard deviation of split frequencies: 0.013163 210500 -- (-1317.311) (-1313.887) [-1310.755] (-1311.560) * (-1309.669) [-1310.331] (-1310.295) (-1311.914) -- 0:00:48 211000 -- (-1314.918) [-1310.659] (-1310.939) (-1312.533) * (-1309.816) (-1310.857) (-1310.680) [-1310.944] -- 0:00:48 211500 -- (-1310.753) [-1315.298] (-1314.875) (-1311.988) * (-1310.652) [-1310.674] (-1311.020) (-1310.729) -- 0:00:48 212000 -- (-1310.818) (-1315.690) [-1311.828] (-1312.458) * (-1311.379) [-1314.103] (-1311.879) (-1313.155) -- 0:00:48 212500 -- [-1310.841] (-1313.806) (-1312.103) (-1312.459) * (-1309.789) [-1311.791] (-1311.873) (-1326.112) -- 0:00:48 213000 -- [-1312.055] (-1311.182) (-1311.574) (-1311.542) * (-1310.456) (-1313.526) (-1310.722) [-1312.599] -- 0:00:48 213500 -- (-1311.957) (-1309.513) (-1313.050) [-1313.896] * (-1310.029) (-1315.179) [-1312.549] (-1311.970) -- 0:00:47 214000 -- [-1311.006] (-1312.417) (-1312.086) (-1313.123) * (-1312.462) (-1310.379) (-1312.550) [-1310.156] -- 0:00:47 214500 -- (-1314.495) (-1315.242) [-1311.912] (-1311.737) * (-1312.840) (-1310.853) (-1312.597) [-1313.049] -- 0:00:47 215000 -- (-1312.649) (-1317.432) (-1311.165) [-1312.411] * [-1312.161] (-1311.190) (-1314.348) (-1311.669) -- 0:00:47 Average standard deviation of split frequencies: 0.012838 215500 -- (-1311.022) (-1314.410) (-1313.580) [-1310.666] * (-1310.308) (-1314.318) (-1313.730) [-1311.312] -- 0:00:47 216000 -- (-1310.452) (-1311.495) (-1311.033) [-1310.803] * [-1312.001] (-1314.483) (-1315.300) (-1316.080) -- 0:00:47 216500 -- (-1316.069) [-1313.773] (-1311.635) (-1311.714) * (-1312.601) [-1310.417] (-1311.550) (-1311.885) -- 0:00:47 217000 -- (-1315.607) (-1311.084) (-1310.824) [-1312.304] * (-1311.212) (-1309.745) (-1313.404) [-1311.495] -- 0:00:46 217500 -- (-1316.137) (-1310.586) (-1310.555) [-1311.975] * [-1310.274] (-1319.259) (-1312.089) (-1310.109) -- 0:00:46 218000 -- (-1316.216) [-1310.222] (-1315.330) (-1311.159) * [-1310.040] (-1311.780) (-1312.290) (-1312.534) -- 0:00:46 218500 -- (-1313.189) (-1310.725) (-1310.582) [-1311.409] * (-1310.995) [-1313.644] (-1312.399) (-1311.708) -- 0:00:46 219000 -- (-1317.739) (-1311.642) [-1310.928] (-1310.031) * (-1312.292) (-1310.786) (-1315.752) [-1310.521] -- 0:00:46 219500 -- (-1313.813) (-1311.141) (-1314.812) [-1309.839] * (-1311.338) [-1311.124] (-1314.233) (-1311.304) -- 0:00:46 220000 -- (-1314.739) [-1310.613] (-1312.531) (-1310.502) * (-1312.107) (-1311.227) [-1314.332] (-1312.307) -- 0:00:46 Average standard deviation of split frequencies: 0.012692 220500 -- [-1316.241] (-1310.665) (-1312.228) (-1310.530) * (-1311.517) (-1317.899) (-1312.870) [-1311.134] -- 0:00:45 221000 -- (-1311.021) (-1311.406) (-1312.366) [-1310.699] * [-1313.734] (-1311.751) (-1315.418) (-1311.736) -- 0:00:45 221500 -- (-1310.733) (-1311.635) (-1314.559) [-1310.868] * (-1313.511) (-1312.663) (-1316.651) [-1311.706] -- 0:00:49 222000 -- (-1311.371) (-1312.545) [-1316.122] (-1310.602) * (-1310.576) [-1309.634] (-1314.422) (-1312.138) -- 0:00:49 222500 -- (-1311.272) [-1314.624] (-1314.744) (-1311.177) * [-1309.971] (-1310.970) (-1310.272) (-1313.900) -- 0:00:48 223000 -- (-1311.759) [-1312.931] (-1310.617) (-1313.441) * (-1312.862) (-1310.751) (-1312.953) [-1312.397] -- 0:00:48 223500 -- (-1311.629) (-1311.285) (-1313.622) [-1310.300] * [-1311.863] (-1315.797) (-1314.939) (-1312.300) -- 0:00:48 224000 -- [-1310.087] (-1311.560) (-1310.700) (-1312.168) * (-1311.511) (-1310.642) (-1312.419) [-1312.173] -- 0:00:48 224500 -- (-1310.089) [-1310.664] (-1311.069) (-1311.473) * (-1311.762) (-1313.248) [-1312.869] (-1312.245) -- 0:00:48 225000 -- (-1309.904) [-1310.837] (-1312.198) (-1312.063) * (-1310.177) (-1310.955) [-1311.465] (-1311.297) -- 0:00:48 Average standard deviation of split frequencies: 0.013790 225500 -- (-1309.910) (-1310.926) (-1312.859) [-1311.864] * [-1312.073] (-1312.752) (-1313.973) (-1311.348) -- 0:00:48 226000 -- (-1309.732) (-1310.573) [-1311.023] (-1311.632) * (-1314.909) [-1310.539] (-1315.350) (-1311.349) -- 0:00:47 226500 -- [-1310.096] (-1311.715) (-1311.023) (-1312.478) * (-1310.399) (-1312.869) [-1312.693] (-1313.560) -- 0:00:47 227000 -- (-1315.341) [-1312.733] (-1311.411) (-1315.508) * (-1312.690) (-1312.545) [-1309.501] (-1311.325) -- 0:00:47 227500 -- (-1309.960) (-1311.228) (-1311.679) [-1312.389] * (-1314.126) (-1310.554) (-1310.953) [-1311.177] -- 0:00:47 228000 -- (-1309.918) [-1315.297] (-1313.010) (-1314.264) * (-1310.646) (-1314.576) (-1310.345) [-1310.578] -- 0:00:47 228500 -- (-1311.161) (-1310.713) [-1310.608] (-1314.843) * (-1312.655) (-1311.414) [-1310.191] (-1312.977) -- 0:00:47 229000 -- (-1312.726) (-1311.621) (-1310.526) [-1312.105] * (-1311.703) [-1311.446] (-1312.295) (-1310.648) -- 0:00:47 229500 -- [-1314.991] (-1310.715) (-1309.610) (-1312.089) * (-1311.744) (-1316.781) (-1312.373) [-1310.264] -- 0:00:47 230000 -- (-1312.458) (-1312.143) [-1309.876] (-1312.839) * (-1311.120) (-1326.329) (-1309.752) [-1313.624] -- 0:00:46 Average standard deviation of split frequencies: 0.013103 230500 -- (-1310.879) [-1312.809] (-1312.886) (-1315.397) * [-1309.573] (-1312.151) (-1309.575) (-1317.926) -- 0:00:46 231000 -- (-1312.294) (-1316.567) (-1310.055) [-1312.630] * (-1312.584) [-1312.548] (-1309.759) (-1317.868) -- 0:00:46 231500 -- (-1312.152) (-1315.672) [-1312.382] (-1311.837) * (-1312.929) (-1310.025) [-1310.700] (-1312.964) -- 0:00:46 232000 -- (-1310.681) (-1317.420) [-1312.995] (-1312.639) * (-1315.377) (-1311.031) [-1310.835] (-1311.163) -- 0:00:46 232500 -- (-1310.312) (-1317.641) (-1315.723) [-1310.985] * [-1313.315] (-1311.388) (-1311.296) (-1313.806) -- 0:00:46 233000 -- (-1310.298) (-1310.463) [-1317.334] (-1312.843) * [-1313.751] (-1313.106) (-1312.228) (-1313.316) -- 0:00:46 233500 -- (-1315.261) [-1309.847] (-1315.656) (-1312.781) * (-1313.785) (-1311.264) [-1311.219] (-1314.276) -- 0:00:45 234000 -- (-1316.820) [-1310.103] (-1311.081) (-1313.261) * (-1312.093) (-1311.404) [-1311.000] (-1313.173) -- 0:00:45 234500 -- (-1311.966) (-1312.713) (-1314.502) [-1314.721] * [-1311.988] (-1309.803) (-1314.106) (-1310.987) -- 0:00:45 235000 -- [-1312.546] (-1313.945) (-1312.144) (-1315.573) * (-1311.180) [-1317.897] (-1313.921) (-1312.556) -- 0:00:45 Average standard deviation of split frequencies: 0.014100 235500 -- (-1314.592) (-1310.626) [-1311.193] (-1314.515) * [-1313.459] (-1318.245) (-1314.063) (-1312.556) -- 0:00:45 236000 -- (-1312.437) (-1316.533) [-1311.038] (-1315.158) * (-1312.668) [-1311.154] (-1313.402) (-1312.593) -- 0:00:45 236500 -- (-1313.873) (-1311.138) [-1309.792] (-1311.452) * (-1312.767) (-1310.440) [-1313.610] (-1311.170) -- 0:00:45 237000 -- (-1314.308) (-1316.752) [-1311.108] (-1311.556) * (-1315.451) [-1310.084] (-1313.601) (-1311.569) -- 0:00:45 237500 -- (-1313.556) [-1312.409] (-1309.543) (-1313.585) * (-1311.503) [-1309.650] (-1313.470) (-1317.197) -- 0:00:48 238000 -- (-1314.394) [-1311.754] (-1316.513) (-1312.808) * [-1311.785] (-1311.913) (-1311.219) (-1311.864) -- 0:00:48 238500 -- (-1312.020) (-1310.445) [-1313.184] (-1313.007) * (-1310.989) [-1312.285] (-1311.490) (-1314.468) -- 0:00:47 239000 -- [-1312.093] (-1316.705) (-1313.157) (-1310.137) * (-1311.198) [-1310.295] (-1312.629) (-1310.974) -- 0:00:47 239500 -- [-1312.785] (-1310.415) (-1310.835) (-1312.242) * [-1313.165] (-1313.138) (-1309.932) (-1312.938) -- 0:00:47 240000 -- [-1314.297] (-1310.310) (-1311.490) (-1310.751) * (-1312.890) [-1315.217] (-1309.932) (-1313.528) -- 0:00:47 Average standard deviation of split frequencies: 0.013222 240500 -- [-1310.857] (-1310.461) (-1310.371) (-1310.615) * (-1310.515) [-1311.472] (-1311.561) (-1313.448) -- 0:00:47 241000 -- (-1310.286) [-1313.285] (-1312.425) (-1310.280) * [-1311.327] (-1310.938) (-1310.931) (-1316.086) -- 0:00:47 241500 -- (-1313.633) (-1312.474) [-1312.624] (-1310.446) * (-1311.149) (-1310.575) [-1312.918] (-1316.136) -- 0:00:47 242000 -- (-1312.293) (-1312.194) (-1311.588) [-1310.862] * (-1312.332) (-1309.809) [-1312.320] (-1313.906) -- 0:00:46 242500 -- (-1309.947) (-1310.184) [-1315.173] (-1313.920) * [-1312.638] (-1310.036) (-1316.696) (-1313.231) -- 0:00:46 243000 -- (-1310.251) (-1310.556) (-1311.356) [-1314.317] * (-1312.110) [-1310.268] (-1313.197) (-1312.520) -- 0:00:46 243500 -- (-1310.809) [-1311.734] (-1310.221) (-1311.947) * [-1310.659] (-1311.271) (-1312.253) (-1310.457) -- 0:00:46 244000 -- (-1310.288) (-1310.856) (-1311.415) [-1315.401] * (-1310.978) [-1309.680] (-1311.814) (-1310.297) -- 0:00:46 244500 -- (-1314.429) (-1309.682) [-1310.305] (-1311.916) * (-1310.977) [-1310.068] (-1310.425) (-1313.993) -- 0:00:46 245000 -- [-1311.531] (-1313.171) (-1313.853) (-1313.669) * (-1313.473) (-1312.262) (-1310.468) [-1311.273] -- 0:00:46 Average standard deviation of split frequencies: 0.013414 245500 -- (-1310.307) [-1311.551] (-1310.543) (-1318.698) * (-1311.237) (-1311.964) (-1310.924) [-1312.140] -- 0:00:46 246000 -- (-1309.867) (-1313.689) [-1311.349] (-1315.102) * [-1311.237] (-1310.763) (-1310.923) (-1311.383) -- 0:00:45 246500 -- [-1311.385] (-1312.181) (-1314.786) (-1309.982) * (-1311.897) [-1310.064] (-1311.886) (-1310.248) -- 0:00:45 247000 -- (-1312.892) [-1311.753] (-1311.361) (-1312.927) * (-1312.893) (-1310.134) [-1311.362] (-1310.759) -- 0:00:45 247500 -- (-1314.713) (-1310.713) (-1313.643) [-1311.560] * (-1309.930) (-1310.952) [-1312.514] (-1313.996) -- 0:00:45 248000 -- (-1310.140) (-1313.463) (-1312.400) [-1311.578] * (-1311.682) (-1309.975) (-1311.800) [-1310.936] -- 0:00:45 248500 -- (-1310.076) (-1312.438) (-1313.149) [-1311.592] * (-1314.616) (-1311.176) [-1312.416] (-1310.483) -- 0:00:45 249000 -- (-1312.019) [-1311.495] (-1313.561) (-1312.747) * (-1310.313) [-1310.735] (-1310.024) (-1311.096) -- 0:00:45 249500 -- (-1311.762) [-1311.854] (-1311.561) (-1310.543) * [-1311.597] (-1310.723) (-1310.408) (-1312.354) -- 0:00:45 250000 -- (-1313.852) [-1313.061] (-1310.469) (-1310.876) * (-1312.159) (-1311.714) [-1310.802] (-1313.035) -- 0:00:45 Average standard deviation of split frequencies: 0.014209 250500 -- (-1312.868) (-1311.486) (-1311.218) [-1310.597] * (-1316.053) (-1310.166) (-1309.727) [-1312.398] -- 0:00:44 251000 -- [-1311.886] (-1312.936) (-1311.320) (-1313.126) * (-1313.994) (-1311.004) [-1311.346] (-1313.041) -- 0:00:44 251500 -- [-1311.653] (-1312.130) (-1313.069) (-1310.236) * [-1312.250] (-1312.139) (-1313.770) (-1312.652) -- 0:00:44 252000 -- (-1311.045) (-1313.006) [-1312.217] (-1310.542) * (-1310.013) (-1310.727) (-1312.244) [-1313.471] -- 0:00:44 252500 -- (-1313.318) [-1311.648] (-1312.465) (-1312.359) * (-1310.210) (-1312.513) [-1311.461] (-1312.181) -- 0:00:44 253000 -- (-1313.022) (-1310.797) [-1309.689] (-1311.758) * (-1312.189) (-1309.958) (-1311.395) [-1312.879] -- 0:00:44 253500 -- (-1310.911) (-1309.936) (-1311.641) [-1310.782] * (-1311.356) (-1310.657) (-1311.527) [-1310.745] -- 0:00:47 254000 -- (-1312.713) (-1312.715) [-1312.477] (-1311.208) * (-1312.217) (-1313.024) [-1311.426] (-1311.069) -- 0:00:46 254500 -- (-1310.447) (-1313.254) (-1310.709) [-1310.736] * [-1313.191] (-1310.303) (-1310.604) (-1310.747) -- 0:00:46 255000 -- (-1311.931) (-1314.389) [-1311.352] (-1310.338) * [-1312.663] (-1310.446) (-1312.315) (-1311.227) -- 0:00:46 Average standard deviation of split frequencies: 0.014731 255500 -- [-1311.531] (-1313.096) (-1311.653) (-1311.342) * (-1312.902) (-1310.542) [-1311.958] (-1311.737) -- 0:00:46 256000 -- [-1313.815] (-1310.795) (-1312.311) (-1313.723) * (-1310.747) [-1310.491] (-1310.747) (-1314.879) -- 0:00:46 256500 -- (-1315.136) (-1309.630) [-1314.083] (-1313.710) * (-1316.643) [-1311.810] (-1312.678) (-1314.588) -- 0:00:46 257000 -- (-1312.460) (-1310.712) (-1312.024) [-1313.038] * [-1317.679] (-1310.338) (-1313.617) (-1314.578) -- 0:00:46 257500 -- (-1311.972) [-1311.491] (-1313.913) (-1313.711) * (-1311.617) (-1311.113) (-1312.853) [-1312.256] -- 0:00:46 258000 -- (-1310.414) (-1309.582) [-1312.588] (-1315.435) * (-1312.595) (-1313.689) (-1310.975) [-1311.327] -- 0:00:46 258500 -- (-1311.024) [-1311.089] (-1313.793) (-1310.846) * (-1312.811) [-1311.193] (-1310.570) (-1311.330) -- 0:00:45 259000 -- [-1310.786] (-1311.452) (-1315.132) (-1314.833) * (-1313.871) [-1311.432] (-1310.529) (-1310.805) -- 0:00:45 259500 -- (-1312.743) [-1312.449] (-1311.623) (-1314.833) * (-1310.961) (-1310.867) [-1312.390] (-1310.497) -- 0:00:45 260000 -- (-1313.386) (-1311.525) [-1311.793] (-1309.718) * (-1311.346) (-1313.908) [-1312.655] (-1309.428) -- 0:00:45 Average standard deviation of split frequencies: 0.014355 260500 -- (-1312.151) (-1312.454) [-1311.895] (-1310.745) * (-1311.772) [-1310.187] (-1311.919) (-1310.325) -- 0:00:45 261000 -- (-1314.604) (-1312.426) [-1313.938] (-1314.315) * (-1309.935) (-1310.406) (-1311.060) [-1311.031] -- 0:00:45 261500 -- (-1311.791) (-1312.881) [-1312.399] (-1310.191) * (-1312.027) (-1315.098) (-1310.970) [-1311.590] -- 0:00:45 262000 -- [-1312.691] (-1312.881) (-1310.637) (-1311.444) * (-1310.206) (-1311.597) [-1311.034] (-1315.253) -- 0:00:45 262500 -- (-1311.888) (-1311.784) [-1313.980] (-1311.112) * (-1321.112) [-1310.165] (-1309.511) (-1311.333) -- 0:00:44 263000 -- (-1314.275) (-1311.894) (-1312.971) [-1310.500] * (-1310.544) (-1310.231) (-1311.377) [-1310.647] -- 0:00:44 263500 -- (-1313.890) (-1314.847) (-1312.746) [-1310.730] * (-1309.894) (-1313.115) (-1311.586) [-1313.174] -- 0:00:44 264000 -- [-1310.808] (-1311.389) (-1311.383) (-1312.152) * (-1315.205) [-1312.271] (-1310.590) (-1311.613) -- 0:00:44 264500 -- (-1310.572) (-1315.502) (-1312.599) [-1310.699] * (-1312.913) (-1317.202) (-1317.845) [-1314.317] -- 0:00:44 265000 -- [-1309.966] (-1313.910) (-1312.600) (-1315.353) * (-1311.393) [-1314.401] (-1315.748) (-1313.838) -- 0:00:44 Average standard deviation of split frequencies: 0.015950 265500 -- (-1310.797) (-1312.855) (-1313.248) [-1319.731] * (-1312.270) (-1313.391) [-1312.230] (-1315.595) -- 0:00:44 266000 -- (-1310.797) (-1315.623) [-1313.138] (-1319.011) * [-1310.905] (-1310.559) (-1314.202) (-1313.281) -- 0:00:44 266500 -- (-1311.248) (-1311.512) (-1312.572) [-1310.202] * (-1310.394) (-1311.047) [-1313.132] (-1312.391) -- 0:00:44 267000 -- (-1310.936) [-1310.377] (-1311.994) (-1313.184) * (-1312.729) [-1310.654] (-1312.430) (-1314.194) -- 0:00:43 267500 -- (-1309.951) [-1313.370] (-1312.594) (-1311.539) * (-1316.786) (-1313.915) [-1311.274] (-1311.977) -- 0:00:43 268000 -- (-1310.029) (-1313.867) (-1314.776) [-1310.542] * (-1312.000) (-1313.205) (-1311.136) [-1311.304] -- 0:00:43 268500 -- (-1309.955) (-1315.145) (-1310.577) [-1313.287] * [-1310.917] (-1313.140) (-1315.612) (-1310.814) -- 0:00:43 269000 -- [-1315.477] (-1311.011) (-1310.532) (-1310.249) * (-1313.269) (-1314.561) [-1311.084] (-1310.827) -- 0:00:43 269500 -- (-1311.929) (-1312.307) (-1312.022) [-1311.682] * [-1312.264] (-1310.520) (-1310.935) (-1313.966) -- 0:00:43 270000 -- [-1311.893] (-1310.465) (-1310.800) (-1312.573) * [-1313.365] (-1311.458) (-1316.874) (-1315.262) -- 0:00:45 Average standard deviation of split frequencies: 0.014804 270500 -- (-1311.934) (-1311.475) [-1310.786] (-1310.542) * (-1313.962) (-1315.815) (-1312.894) [-1313.403] -- 0:00:45 271000 -- (-1314.063) (-1310.071) (-1311.863) [-1310.559] * [-1312.324] (-1312.606) (-1311.522) (-1312.524) -- 0:00:45 271500 -- (-1311.976) [-1310.965] (-1310.090) (-1309.502) * (-1313.247) [-1312.842] (-1311.254) (-1312.375) -- 0:00:45 272000 -- (-1311.990) (-1310.252) [-1310.015] (-1315.858) * (-1313.772) [-1314.230] (-1311.882) (-1309.771) -- 0:00:45 272500 -- [-1310.198] (-1312.068) (-1317.936) (-1313.977) * (-1312.040) [-1311.533] (-1322.360) (-1314.375) -- 0:00:45 273000 -- (-1310.300) [-1312.653] (-1314.954) (-1312.894) * (-1313.749) (-1311.092) (-1310.583) [-1311.334] -- 0:00:45 273500 -- (-1312.516) (-1313.049) (-1312.677) [-1313.014] * (-1313.037) [-1311.500] (-1313.400) (-1312.038) -- 0:00:45 274000 -- (-1312.669) (-1312.990) [-1313.946] (-1311.277) * (-1310.031) (-1311.562) [-1310.563] (-1310.854) -- 0:00:45 274500 -- (-1313.412) (-1314.410) (-1314.736) [-1313.554] * (-1310.429) (-1311.846) (-1315.956) [-1310.728] -- 0:00:44 275000 -- (-1310.861) [-1312.471] (-1311.228) (-1312.933) * (-1310.410) (-1311.964) (-1313.284) [-1312.329] -- 0:00:44 Average standard deviation of split frequencies: 0.014625 275500 -- (-1312.075) (-1312.375) [-1312.942] (-1311.985) * (-1310.754) (-1312.559) [-1312.946] (-1310.455) -- 0:00:44 276000 -- (-1314.214) [-1311.523] (-1311.873) (-1310.344) * (-1314.292) (-1313.624) [-1312.917] (-1310.408) -- 0:00:44 276500 -- [-1314.142] (-1311.123) (-1311.659) (-1309.959) * (-1310.698) (-1311.806) [-1311.825] (-1310.494) -- 0:00:44 277000 -- (-1312.530) [-1311.497] (-1311.048) (-1314.675) * [-1310.812] (-1312.228) (-1311.509) (-1310.892) -- 0:00:44 277500 -- (-1310.132) (-1316.169) [-1310.251] (-1312.022) * (-1310.826) (-1310.261) (-1310.369) [-1311.873] -- 0:00:44 278000 -- [-1311.433] (-1312.519) (-1310.892) (-1311.594) * (-1310.692) (-1310.215) (-1311.871) [-1312.840] -- 0:00:44 278500 -- (-1311.233) [-1312.012] (-1311.592) (-1315.921) * (-1314.244) (-1309.904) (-1311.986) [-1312.383] -- 0:00:44 279000 -- (-1312.481) (-1313.240) [-1311.137] (-1314.115) * (-1313.056) (-1311.275) [-1311.342] (-1313.303) -- 0:00:43 279500 -- (-1314.291) (-1313.917) (-1310.024) [-1315.391] * (-1315.966) (-1311.805) [-1310.879] (-1310.105) -- 0:00:43 280000 -- (-1311.015) (-1313.733) [-1309.545] (-1314.455) * (-1312.247) [-1311.630] (-1313.277) (-1311.962) -- 0:00:43 Average standard deviation of split frequencies: 0.015641 280500 -- (-1310.455) (-1310.702) [-1309.549] (-1314.759) * (-1310.754) (-1313.650) (-1312.327) [-1311.531] -- 0:00:43 281000 -- (-1311.793) (-1310.996) (-1317.001) [-1312.134] * (-1310.652) [-1310.840] (-1312.486) (-1311.693) -- 0:00:43 281500 -- (-1312.094) [-1315.104] (-1312.173) (-1318.896) * (-1318.242) (-1311.172) (-1315.997) [-1311.513] -- 0:00:43 282000 -- [-1312.757] (-1312.090) (-1313.621) (-1313.913) * (-1312.649) (-1312.466) (-1312.248) [-1310.678] -- 0:00:43 282500 -- (-1314.868) (-1312.193) [-1312.020] (-1314.664) * [-1314.865] (-1309.988) (-1312.072) (-1310.115) -- 0:00:43 283000 -- (-1312.718) [-1311.582] (-1311.133) (-1311.469) * (-1310.666) (-1309.955) (-1312.351) [-1309.938] -- 0:00:43 283500 -- [-1311.129] (-1311.132) (-1311.517) (-1309.919) * (-1310.958) (-1310.258) [-1311.684] (-1313.827) -- 0:00:42 284000 -- (-1314.400) [-1310.444] (-1310.980) (-1311.784) * [-1310.965] (-1310.320) (-1312.206) (-1312.986) -- 0:00:42 284500 -- (-1312.563) (-1311.468) (-1316.852) [-1311.320] * (-1311.015) (-1310.107) (-1312.856) [-1310.908] -- 0:00:42 285000 -- (-1310.032) [-1311.603] (-1314.244) (-1309.785) * (-1313.221) [-1315.966] (-1313.358) (-1310.335) -- 0:00:42 Average standard deviation of split frequencies: 0.014544 285500 -- (-1313.198) (-1311.552) (-1311.458) [-1309.482] * (-1310.450) [-1313.876] (-1311.976) (-1310.184) -- 0:00:45 286000 -- [-1311.512] (-1311.653) (-1311.929) (-1312.976) * (-1313.754) (-1310.040) [-1312.085] (-1312.356) -- 0:00:44 286500 -- (-1311.301) (-1312.661) (-1309.946) [-1311.218] * (-1312.103) [-1310.208] (-1313.191) (-1312.398) -- 0:00:44 287000 -- (-1314.027) (-1313.444) (-1313.120) [-1313.475] * (-1312.184) (-1309.944) [-1311.603] (-1311.458) -- 0:00:44 287500 -- (-1311.559) (-1311.650) (-1309.783) [-1312.639] * [-1313.827] (-1311.860) (-1310.838) (-1313.621) -- 0:00:44 288000 -- [-1311.191] (-1311.087) (-1314.313) (-1310.821) * [-1311.490] (-1311.601) (-1312.247) (-1315.201) -- 0:00:44 288500 -- (-1311.081) [-1310.587] (-1315.282) (-1310.378) * (-1310.065) (-1314.073) [-1310.961] (-1311.101) -- 0:00:44 289000 -- [-1310.045] (-1311.260) (-1313.131) (-1310.221) * (-1313.123) (-1312.836) (-1310.963) [-1310.750] -- 0:00:44 289500 -- (-1312.503) (-1315.292) [-1312.608] (-1311.257) * (-1313.605) (-1312.976) [-1309.886] (-1311.109) -- 0:00:44 290000 -- (-1310.889) (-1310.652) [-1312.577] (-1310.143) * (-1313.573) (-1312.550) (-1313.193) [-1310.281] -- 0:00:44 Average standard deviation of split frequencies: 0.015264 290500 -- (-1310.148) (-1313.354) [-1312.032] (-1310.092) * (-1311.871) (-1310.650) [-1311.437] (-1311.085) -- 0:00:43 291000 -- (-1313.473) (-1313.799) [-1313.174] (-1310.815) * (-1311.529) (-1311.414) [-1312.952] (-1313.801) -- 0:00:43 291500 -- (-1317.431) (-1318.709) [-1316.530] (-1310.654) * (-1313.360) (-1311.717) (-1311.235) [-1312.952] -- 0:00:43 292000 -- (-1314.660) [-1317.293] (-1313.297) (-1311.138) * (-1314.006) (-1310.731) (-1310.904) [-1313.645] -- 0:00:43 292500 -- [-1311.970] (-1315.510) (-1315.535) (-1311.984) * (-1311.987) (-1310.443) [-1309.947] (-1310.885) -- 0:00:43 293000 -- [-1311.140] (-1312.233) (-1313.645) (-1311.930) * (-1309.618) [-1310.429] (-1310.898) (-1312.224) -- 0:00:43 293500 -- (-1313.691) [-1313.438] (-1311.075) (-1311.702) * (-1312.507) [-1310.836] (-1310.064) (-1311.218) -- 0:00:43 294000 -- (-1309.792) (-1310.329) [-1310.633] (-1312.035) * (-1312.647) (-1311.229) [-1310.086] (-1310.953) -- 0:00:43 294500 -- (-1314.658) [-1311.718] (-1312.957) (-1316.139) * [-1316.268] (-1310.411) (-1311.929) (-1311.187) -- 0:00:43 295000 -- (-1311.223) [-1311.780] (-1312.322) (-1313.297) * (-1314.485) (-1313.632) (-1312.902) [-1311.333] -- 0:00:43 Average standard deviation of split frequencies: 0.015832 295500 -- (-1311.868) (-1311.012) [-1311.351] (-1312.682) * (-1311.045) (-1314.689) [-1311.020] (-1311.755) -- 0:00:42 296000 -- (-1312.510) [-1309.909] (-1310.344) (-1315.598) * [-1313.010] (-1315.087) (-1310.999) (-1311.788) -- 0:00:42 296500 -- [-1314.445] (-1310.419) (-1309.790) (-1311.229) * (-1312.739) (-1312.828) (-1313.516) [-1311.969] -- 0:00:42 297000 -- (-1314.503) (-1312.440) [-1310.042] (-1310.678) * (-1312.731) (-1312.472) (-1312.395) [-1310.433] -- 0:00:42 297500 -- (-1312.679) (-1312.430) [-1311.136] (-1310.639) * [-1313.336] (-1310.559) (-1313.538) (-1314.615) -- 0:00:42 298000 -- (-1312.624) [-1312.476] (-1310.176) (-1309.813) * [-1310.956] (-1311.937) (-1312.364) (-1313.254) -- 0:00:42 298500 -- [-1313.835] (-1312.496) (-1310.198) (-1312.664) * (-1310.555) [-1316.743] (-1312.553) (-1315.567) -- 0:00:42 299000 -- [-1311.158] (-1311.571) (-1309.746) (-1319.587) * [-1312.647] (-1313.343) (-1312.275) (-1310.469) -- 0:00:42 299500 -- [-1311.607] (-1313.165) (-1310.194) (-1313.443) * (-1310.418) [-1310.677] (-1312.976) (-1311.070) -- 0:00:42 300000 -- (-1310.896) (-1313.431) (-1310.906) [-1311.967] * [-1317.954] (-1311.860) (-1312.513) (-1317.485) -- 0:00:42 Average standard deviation of split frequencies: 0.016785 300500 -- (-1311.735) (-1312.179) [-1311.925] (-1313.813) * [-1310.634] (-1313.981) (-1311.094) (-1313.747) -- 0:00:41 301000 -- (-1310.199) (-1311.964) (-1311.105) [-1311.697] * (-1310.313) (-1311.554) [-1311.202] (-1312.459) -- 0:00:41 301500 -- [-1310.021] (-1312.191) (-1311.415) (-1311.121) * (-1310.268) (-1310.523) [-1313.644] (-1314.609) -- 0:00:44 302000 -- (-1309.948) (-1312.007) (-1312.493) [-1311.001] * (-1311.026) (-1312.846) [-1314.399] (-1310.867) -- 0:00:43 302500 -- (-1309.744) [-1311.273] (-1315.745) (-1312.464) * (-1310.538) [-1309.585] (-1312.526) (-1318.340) -- 0:00:43 303000 -- [-1311.947] (-1311.502) (-1313.620) (-1315.466) * (-1311.296) (-1309.797) (-1312.055) [-1317.419] -- 0:00:43 303500 -- (-1311.794) (-1315.516) [-1313.530] (-1312.057) * (-1309.929) (-1310.559) [-1312.088] (-1311.809) -- 0:00:43 304000 -- (-1310.594) (-1314.747) (-1313.630) [-1311.433] * [-1315.328] (-1311.812) (-1311.790) (-1311.220) -- 0:00:43 304500 -- (-1309.966) [-1311.583] (-1313.971) (-1314.336) * (-1314.107) (-1310.139) (-1311.787) [-1312.315] -- 0:00:43 305000 -- (-1317.401) (-1313.315) [-1313.238] (-1310.931) * (-1314.980) [-1310.142] (-1312.713) (-1311.313) -- 0:00:43 Average standard deviation of split frequencies: 0.016402 305500 -- (-1312.105) [-1312.756] (-1311.557) (-1311.754) * [-1310.450] (-1314.332) (-1309.737) (-1311.325) -- 0:00:43 306000 -- (-1312.134) (-1312.667) (-1312.354) [-1312.041] * (-1310.692) (-1314.241) [-1314.210] (-1314.934) -- 0:00:43 306500 -- (-1310.459) (-1312.392) [-1310.995] (-1315.600) * (-1309.793) (-1312.124) (-1312.893) [-1315.817] -- 0:00:42 307000 -- (-1311.131) (-1313.991) [-1313.245] (-1312.296) * (-1310.638) [-1311.032] (-1309.860) (-1312.079) -- 0:00:42 307500 -- [-1311.350] (-1315.800) (-1311.588) (-1315.948) * (-1310.640) [-1309.848] (-1309.846) (-1314.177) -- 0:00:42 308000 -- (-1312.412) (-1316.239) [-1312.225] (-1313.941) * (-1311.769) (-1310.395) [-1309.965] (-1314.645) -- 0:00:42 308500 -- (-1310.458) [-1312.517] (-1311.767) (-1312.084) * (-1312.356) (-1310.384) (-1311.190) [-1313.234] -- 0:00:42 309000 -- (-1312.852) [-1315.196] (-1309.615) (-1312.356) * (-1311.757) (-1310.155) (-1313.048) [-1311.339] -- 0:00:42 309500 -- (-1314.244) (-1312.139) [-1309.644] (-1313.130) * (-1313.854) [-1310.770] (-1312.504) (-1317.910) -- 0:00:42 310000 -- (-1314.208) [-1312.194] (-1311.599) (-1310.137) * (-1313.474) (-1310.859) (-1311.121) [-1313.175] -- 0:00:42 Average standard deviation of split frequencies: 0.016101 310500 -- (-1312.735) (-1314.832) (-1312.793) [-1310.028] * (-1314.747) [-1312.696] (-1315.535) (-1311.497) -- 0:00:42 311000 -- (-1311.610) (-1311.801) (-1309.705) [-1311.368] * (-1316.321) [-1313.879] (-1313.056) (-1310.506) -- 0:00:42 311500 -- [-1310.361] (-1312.211) (-1312.116) (-1310.609) * (-1313.383) (-1312.520) (-1310.900) [-1310.504] -- 0:00:41 312000 -- (-1311.334) [-1311.225] (-1312.009) (-1312.178) * (-1312.520) (-1310.970) [-1310.262] (-1313.436) -- 0:00:41 312500 -- (-1314.771) (-1312.671) [-1313.871] (-1314.403) * (-1310.886) [-1310.157] (-1314.272) (-1311.845) -- 0:00:41 313000 -- (-1311.016) (-1310.261) (-1313.431) [-1311.340] * (-1312.497) [-1312.551] (-1312.366) (-1311.251) -- 0:00:41 313500 -- (-1313.219) (-1310.776) (-1312.533) [-1311.766] * (-1314.030) [-1312.038] (-1313.765) (-1313.731) -- 0:00:41 314000 -- (-1312.235) (-1310.469) [-1313.001] (-1310.719) * [-1310.922] (-1310.861) (-1312.610) (-1314.871) -- 0:00:41 314500 -- [-1310.554] (-1309.750) (-1310.840) (-1311.119) * (-1310.336) (-1310.445) [-1309.952] (-1315.245) -- 0:00:41 315000 -- (-1310.486) [-1312.361] (-1310.407) (-1311.390) * [-1312.867] (-1311.023) (-1310.689) (-1312.965) -- 0:00:41 Average standard deviation of split frequencies: 0.014421 315500 -- (-1311.997) [-1309.645] (-1312.690) (-1310.584) * [-1311.575] (-1311.481) (-1314.668) (-1311.986) -- 0:00:41 316000 -- (-1311.608) (-1311.280) [-1312.740] (-1310.781) * [-1311.798] (-1310.470) (-1313.997) (-1310.733) -- 0:00:41 316500 -- [-1310.932] (-1313.345) (-1312.183) (-1312.277) * [-1310.353] (-1310.478) (-1311.045) (-1310.029) -- 0:00:41 317000 -- (-1310.819) (-1311.772) (-1311.707) [-1312.115] * (-1311.123) [-1311.103] (-1313.011) (-1311.530) -- 0:00:40 317500 -- (-1311.946) (-1313.179) (-1311.501) [-1313.704] * (-1313.213) [-1311.852] (-1313.629) (-1315.101) -- 0:00:42 318000 -- (-1313.168) (-1313.630) [-1311.500] (-1313.086) * (-1316.120) [-1315.203] (-1321.990) (-1311.730) -- 0:00:42 318500 -- [-1313.265] (-1311.998) (-1313.705) (-1313.966) * (-1313.694) (-1312.014) (-1313.200) [-1309.858] -- 0:00:42 319000 -- (-1313.373) (-1309.629) [-1310.069] (-1310.614) * [-1314.062] (-1312.579) (-1310.983) (-1314.921) -- 0:00:42 319500 -- [-1311.529] (-1310.042) (-1310.069) (-1311.899) * (-1314.461) (-1312.505) [-1310.330] (-1313.226) -- 0:00:42 320000 -- (-1311.872) (-1310.046) (-1309.979) [-1311.432] * (-1314.662) (-1316.597) [-1310.828] (-1314.564) -- 0:00:42 Average standard deviation of split frequencies: 0.014787 320500 -- (-1311.988) [-1309.922] (-1310.060) (-1310.798) * [-1311.632] (-1311.434) (-1310.036) (-1314.884) -- 0:00:42 321000 -- (-1313.944) (-1310.117) [-1310.917] (-1311.049) * (-1314.177) (-1312.743) [-1310.027] (-1310.388) -- 0:00:42 321500 -- (-1315.944) (-1313.588) (-1311.433) [-1311.049] * (-1310.737) [-1309.944] (-1312.822) (-1310.257) -- 0:00:42 322000 -- (-1310.352) (-1314.380) (-1310.597) [-1311.868] * (-1311.705) (-1309.729) (-1312.069) [-1313.957] -- 0:00:42 322500 -- (-1310.420) (-1312.162) [-1311.807] (-1309.898) * (-1310.584) (-1313.780) [-1312.113] (-1312.506) -- 0:00:42 323000 -- (-1310.317) (-1311.931) [-1310.615] (-1313.051) * [-1310.137] (-1313.294) (-1311.551) (-1315.520) -- 0:00:41 323500 -- (-1315.389) [-1312.294] (-1314.258) (-1314.355) * (-1312.180) (-1312.249) [-1311.969] (-1312.159) -- 0:00:41 324000 -- [-1313.604] (-1310.379) (-1314.185) (-1314.525) * (-1312.743) [-1311.964] (-1310.811) (-1310.154) -- 0:00:41 324500 -- (-1312.051) [-1312.327] (-1311.228) (-1315.337) * (-1314.923) (-1311.964) (-1310.110) [-1314.444] -- 0:00:41 325000 -- (-1314.258) (-1311.554) [-1310.283] (-1312.876) * [-1313.277] (-1314.610) (-1310.205) (-1312.454) -- 0:00:41 Average standard deviation of split frequencies: 0.015103 325500 -- (-1317.143) [-1310.057] (-1310.438) (-1311.368) * (-1316.616) (-1309.732) (-1310.804) [-1311.914] -- 0:00:41 326000 -- [-1312.357] (-1310.518) (-1310.323) (-1310.468) * [-1311.962] (-1312.234) (-1314.613) (-1312.962) -- 0:00:41 326500 -- (-1313.409) [-1311.915] (-1310.095) (-1310.789) * (-1311.521) (-1309.512) [-1314.213] (-1315.360) -- 0:00:41 327000 -- (-1312.120) [-1311.440] (-1311.354) (-1310.711) * [-1311.776] (-1310.742) (-1310.872) (-1311.929) -- 0:00:41 327500 -- (-1312.656) (-1314.657) [-1310.642] (-1310.169) * (-1311.529) (-1310.468) (-1312.982) [-1314.495] -- 0:00:41 328000 -- (-1314.987) (-1317.969) [-1310.468] (-1309.913) * (-1313.099) [-1312.080] (-1311.566) (-1314.901) -- 0:00:40 328500 -- (-1312.912) (-1314.434) [-1310.436] (-1309.882) * (-1311.295) (-1313.962) [-1311.608] (-1314.272) -- 0:00:40 329000 -- [-1313.705] (-1315.311) (-1311.693) (-1310.624) * (-1313.463) (-1309.690) (-1312.593) [-1311.965] -- 0:00:40 329500 -- [-1312.797] (-1316.738) (-1310.480) (-1310.878) * (-1311.818) (-1309.845) [-1311.476] (-1313.157) -- 0:00:40 330000 -- (-1313.599) (-1315.772) [-1310.070] (-1311.369) * (-1315.341) (-1311.456) [-1314.084] (-1312.291) -- 0:00:40 Average standard deviation of split frequencies: 0.014508 330500 -- [-1311.627] (-1312.215) (-1309.856) (-1311.315) * [-1315.055] (-1311.480) (-1311.771) (-1312.140) -- 0:00:40 331000 -- (-1312.626) (-1312.019) [-1311.010] (-1313.459) * (-1315.909) (-1313.667) [-1311.899] (-1311.640) -- 0:00:40 331500 -- [-1313.310] (-1310.395) (-1313.473) (-1312.098) * (-1312.374) (-1310.724) (-1310.772) [-1311.821] -- 0:00:40 332000 -- (-1311.413) (-1310.634) (-1313.367) [-1312.796] * (-1317.059) [-1313.418] (-1311.966) (-1310.765) -- 0:00:40 332500 -- (-1310.129) [-1313.503] (-1315.266) (-1311.623) * (-1311.161) [-1313.114] (-1315.841) (-1310.326) -- 0:00:40 333000 -- [-1310.635] (-1315.826) (-1317.064) (-1312.985) * (-1314.524) [-1310.847] (-1314.198) (-1310.430) -- 0:00:40 333500 -- (-1310.980) [-1310.666] (-1310.731) (-1312.551) * (-1312.509) (-1314.145) (-1312.155) [-1310.686] -- 0:00:41 334000 -- (-1311.428) [-1312.362] (-1315.269) (-1312.784) * (-1313.116) [-1313.883] (-1312.265) (-1312.363) -- 0:00:41 334500 -- (-1313.378) (-1310.304) [-1311.684] (-1311.220) * (-1313.498) [-1310.003] (-1312.291) (-1312.083) -- 0:00:41 335000 -- (-1310.287) [-1311.984] (-1311.598) (-1310.996) * [-1312.277] (-1312.295) (-1312.009) (-1312.575) -- 0:00:41 Average standard deviation of split frequencies: 0.014965 335500 -- (-1310.336) (-1313.074) (-1312.841) [-1310.831] * [-1312.888] (-1313.382) (-1312.188) (-1313.823) -- 0:00:41 336000 -- (-1313.532) (-1312.800) [-1309.690] (-1310.180) * (-1314.613) (-1311.353) [-1309.559] (-1318.726) -- 0:00:41 336500 -- [-1312.579] (-1310.198) (-1310.735) (-1311.467) * [-1313.563] (-1312.627) (-1311.502) (-1315.348) -- 0:00:41 337000 -- (-1316.025) (-1313.211) [-1311.147] (-1310.998) * (-1314.590) (-1311.302) [-1314.094] (-1315.522) -- 0:00:41 337500 -- (-1315.463) (-1310.189) [-1310.223] (-1311.140) * [-1312.311] (-1310.128) (-1311.675) (-1312.152) -- 0:00:41 338000 -- (-1311.376) (-1311.107) [-1310.614] (-1312.862) * (-1310.654) (-1313.263) [-1310.639] (-1315.938) -- 0:00:41 338500 -- (-1311.168) [-1312.507] (-1312.558) (-1312.587) * [-1315.095] (-1310.792) (-1312.322) (-1310.351) -- 0:00:41 339000 -- (-1311.796) [-1312.953] (-1311.600) (-1312.503) * [-1312.025] (-1310.001) (-1314.289) (-1310.544) -- 0:00:40 339500 -- [-1311.395] (-1312.187) (-1310.943) (-1312.298) * (-1315.291) [-1310.301] (-1315.547) (-1311.456) -- 0:00:40 340000 -- (-1312.413) (-1313.014) (-1311.524) [-1312.483] * (-1316.798) (-1311.667) [-1316.378] (-1310.681) -- 0:00:40 Average standard deviation of split frequencies: 0.015760 340500 -- (-1313.981) (-1310.514) [-1311.009] (-1314.470) * (-1311.096) (-1311.366) [-1311.333] (-1310.182) -- 0:00:40 341000 -- (-1309.712) (-1312.913) (-1310.954) [-1312.238] * (-1312.559) [-1312.616] (-1310.564) (-1310.584) -- 0:00:40 341500 -- (-1311.390) (-1312.911) (-1311.350) [-1312.287] * (-1312.541) (-1311.099) [-1310.214] (-1316.417) -- 0:00:40 342000 -- (-1310.319) [-1313.232] (-1311.302) (-1311.526) * [-1312.559] (-1317.213) (-1312.009) (-1310.105) -- 0:00:40 342500 -- (-1310.218) (-1315.705) (-1309.656) [-1311.928] * (-1311.401) (-1313.781) [-1312.688] (-1312.584) -- 0:00:40 343000 -- (-1310.216) [-1312.752] (-1309.497) (-1312.044) * [-1310.488] (-1315.939) (-1313.247) (-1312.332) -- 0:00:40 343500 -- (-1311.757) [-1314.324] (-1310.283) (-1313.355) * (-1312.132) (-1311.791) (-1315.646) [-1312.122] -- 0:00:40 344000 -- (-1309.914) (-1312.747) (-1309.883) [-1312.932] * (-1311.159) [-1312.093] (-1320.750) (-1312.208) -- 0:00:40 344500 -- (-1310.894) (-1309.996) (-1313.721) [-1314.692] * [-1313.134] (-1311.656) (-1312.046) (-1312.291) -- 0:00:39 345000 -- (-1309.867) (-1310.704) [-1310.717] (-1312.481) * (-1315.127) [-1311.094] (-1311.559) (-1313.084) -- 0:00:39 Average standard deviation of split frequencies: 0.016425 345500 -- (-1310.723) (-1310.674) (-1313.786) [-1311.402] * (-1318.375) (-1311.572) (-1312.052) [-1310.915] -- 0:00:39 346000 -- (-1310.113) [-1309.793] (-1313.417) (-1311.099) * [-1310.856] (-1316.613) (-1311.617) (-1310.993) -- 0:00:39 346500 -- [-1312.205] (-1310.097) (-1313.227) (-1310.486) * (-1311.674) (-1312.911) (-1312.305) [-1311.117] -- 0:00:39 347000 -- (-1312.252) [-1311.213] (-1312.098) (-1310.939) * [-1313.162] (-1312.677) (-1312.826) (-1310.129) -- 0:00:39 347500 -- (-1312.630) (-1311.949) (-1310.997) [-1310.862] * (-1313.166) [-1312.565] (-1312.391) (-1310.124) -- 0:00:39 348000 -- (-1309.962) [-1312.251] (-1311.875) (-1313.574) * [-1313.232] (-1310.144) (-1312.648) (-1311.073) -- 0:00:39 348500 -- (-1309.959) [-1318.120] (-1312.423) (-1314.016) * (-1312.474) [-1309.651] (-1313.236) (-1310.334) -- 0:00:41 349000 -- [-1311.417] (-1310.743) (-1312.159) (-1311.440) * (-1313.967) [-1309.704] (-1311.638) (-1314.523) -- 0:00:41 349500 -- (-1310.200) (-1314.153) [-1312.209] (-1312.167) * [-1311.562] (-1310.560) (-1312.268) (-1312.708) -- 0:00:40 350000 -- (-1310.164) (-1313.909) (-1313.107) [-1312.727] * (-1310.031) (-1309.931) [-1309.771] (-1311.590) -- 0:00:40 Average standard deviation of split frequencies: 0.016206 350500 -- (-1311.306) [-1312.114] (-1312.373) (-1311.702) * (-1310.993) (-1310.344) (-1312.567) [-1311.844] -- 0:00:40 351000 -- (-1311.459) (-1310.979) [-1312.257] (-1315.460) * [-1311.035] (-1311.051) (-1318.615) (-1310.427) -- 0:00:40 351500 -- (-1316.467) (-1311.344) [-1310.463] (-1312.428) * (-1311.328) (-1309.725) (-1311.868) [-1311.692] -- 0:00:40 352000 -- (-1311.953) (-1311.292) [-1312.173] (-1311.624) * (-1315.815) (-1312.817) (-1312.192) [-1313.694] -- 0:00:40 352500 -- (-1310.941) [-1310.487] (-1311.179) (-1311.181) * [-1313.247] (-1311.324) (-1313.599) (-1319.348) -- 0:00:40 353000 -- (-1312.730) (-1312.470) [-1311.698] (-1311.093) * (-1311.102) (-1311.561) (-1312.938) [-1314.619] -- 0:00:40 353500 -- [-1312.539] (-1314.159) (-1311.903) (-1310.302) * (-1311.583) (-1309.695) [-1318.750] (-1315.511) -- 0:00:40 354000 -- (-1310.487) (-1310.652) [-1311.418] (-1310.202) * (-1316.429) (-1315.026) [-1311.463] (-1311.547) -- 0:00:40 354500 -- (-1312.227) [-1311.716] (-1310.102) (-1311.941) * (-1312.023) (-1315.235) [-1311.369] (-1314.904) -- 0:00:40 355000 -- (-1313.744) (-1312.748) [-1310.262] (-1312.315) * (-1311.425) (-1314.647) [-1309.740] (-1311.003) -- 0:00:39 Average standard deviation of split frequencies: 0.016258 355500 -- (-1314.169) (-1310.601) [-1310.586] (-1312.816) * (-1310.683) (-1313.318) [-1310.697] (-1315.465) -- 0:00:39 356000 -- [-1312.489] (-1312.615) (-1309.832) (-1314.040) * (-1314.051) (-1314.731) [-1309.541] (-1318.276) -- 0:00:39 356500 -- (-1312.185) (-1310.903) [-1311.474] (-1311.878) * (-1310.485) (-1311.996) (-1313.991) [-1311.274] -- 0:00:39 357000 -- (-1311.088) (-1311.170) (-1312.016) [-1313.797] * (-1310.086) (-1312.972) (-1314.640) [-1310.861] -- 0:00:39 357500 -- (-1310.383) (-1310.772) (-1310.492) [-1313.883] * [-1310.661] (-1309.937) (-1312.054) (-1311.185) -- 0:00:39 358000 -- (-1310.727) (-1312.001) (-1312.021) [-1314.044] * (-1311.366) (-1310.563) [-1311.056] (-1314.009) -- 0:00:39 358500 -- (-1310.471) [-1312.193] (-1312.233) (-1311.846) * (-1310.549) (-1312.547) (-1313.065) [-1312.779] -- 0:00:39 359000 -- (-1310.182) (-1317.343) (-1311.836) [-1311.294] * [-1316.943] (-1309.693) (-1310.779) (-1311.632) -- 0:00:39 359500 -- (-1313.099) (-1311.065) (-1310.209) [-1311.953] * [-1313.378] (-1309.778) (-1309.927) (-1315.058) -- 0:00:39 360000 -- (-1313.743) [-1309.910] (-1310.498) (-1311.020) * (-1313.942) (-1312.454) [-1311.068] (-1312.093) -- 0:00:39 Average standard deviation of split frequencies: 0.016991 360500 -- (-1314.103) (-1311.300) [-1313.046] (-1311.224) * (-1312.458) [-1311.292] (-1309.921) (-1313.374) -- 0:00:39 361000 -- (-1311.953) [-1312.393] (-1311.941) (-1311.658) * (-1313.314) (-1313.667) (-1312.559) [-1312.485] -- 0:00:38 361500 -- [-1312.928] (-1311.918) (-1311.367) (-1312.935) * (-1312.340) (-1312.432) [-1310.144] (-1311.626) -- 0:00:38 362000 -- (-1313.723) [-1312.195] (-1310.951) (-1312.860) * [-1313.160] (-1311.954) (-1310.858) (-1312.843) -- 0:00:38 362500 -- (-1313.725) [-1311.304] (-1310.128) (-1310.065) * (-1316.059) (-1312.864) (-1311.429) [-1312.425] -- 0:00:38 363000 -- (-1310.771) (-1310.943) (-1311.054) [-1309.620] * (-1312.222) [-1312.905] (-1310.291) (-1312.665) -- 0:00:38 363500 -- (-1313.639) (-1312.641) [-1313.302] (-1309.690) * (-1311.572) [-1313.219] (-1310.285) (-1313.134) -- 0:00:40 364000 -- [-1313.115] (-1312.949) (-1316.731) (-1312.371) * [-1312.853] (-1313.296) (-1310.753) (-1312.952) -- 0:00:40 364500 -- [-1315.420] (-1314.107) (-1316.915) (-1311.399) * [-1311.898] (-1311.878) (-1310.903) (-1312.843) -- 0:00:40 365000 -- (-1310.782) (-1313.379) [-1313.060] (-1312.369) * (-1313.254) (-1311.483) [-1311.631] (-1310.695) -- 0:00:40 Average standard deviation of split frequencies: 0.016386 365500 -- (-1312.920) [-1311.912] (-1314.978) (-1313.440) * (-1310.483) (-1310.585) (-1312.884) [-1310.298] -- 0:00:39 366000 -- (-1310.400) [-1309.361] (-1314.268) (-1312.204) * (-1310.972) [-1313.044] (-1310.913) (-1313.687) -- 0:00:39 366500 -- (-1311.039) (-1309.901) [-1311.512] (-1310.819) * (-1311.081) [-1315.704] (-1309.425) (-1313.758) -- 0:00:39 367000 -- [-1310.822] (-1309.737) (-1311.958) (-1310.985) * (-1311.844) (-1312.814) (-1310.705) [-1313.661] -- 0:00:39 367500 -- (-1311.515) (-1309.722) [-1311.199] (-1311.275) * (-1312.594) [-1312.112] (-1311.288) (-1316.828) -- 0:00:39 368000 -- (-1311.321) (-1309.728) (-1312.019) [-1311.049] * (-1312.811) (-1314.341) [-1310.118] (-1316.169) -- 0:00:39 368500 -- [-1310.508] (-1311.408) (-1311.803) (-1311.190) * (-1311.419) (-1311.081) [-1311.143] (-1316.919) -- 0:00:39 369000 -- (-1310.875) (-1313.026) (-1312.201) [-1310.866] * (-1311.704) (-1315.244) [-1311.717] (-1316.395) -- 0:00:39 369500 -- (-1310.045) (-1313.245) [-1310.823] (-1312.745) * [-1312.513] (-1315.198) (-1311.464) (-1316.023) -- 0:00:39 370000 -- (-1315.528) [-1314.987] (-1309.790) (-1316.740) * (-1312.024) (-1312.544) [-1311.811] (-1311.799) -- 0:00:39 Average standard deviation of split frequencies: 0.016462 370500 -- (-1312.391) (-1312.264) (-1310.043) [-1316.649] * [-1311.838] (-1313.580) (-1313.652) (-1310.518) -- 0:00:39 371000 -- (-1314.111) [-1311.564] (-1309.693) (-1313.121) * (-1310.068) [-1313.258] (-1314.191) (-1311.114) -- 0:00:38 371500 -- (-1310.662) (-1311.451) (-1316.141) [-1310.468] * (-1312.688) [-1312.879] (-1311.886) (-1311.444) -- 0:00:38 372000 -- (-1311.247) (-1312.386) (-1312.411) [-1311.260] * (-1311.655) (-1312.646) (-1311.610) [-1311.205] -- 0:00:38 372500 -- (-1315.771) [-1311.649] (-1312.691) (-1311.959) * (-1310.974) (-1312.818) [-1310.992] (-1311.850) -- 0:00:38 373000 -- (-1316.127) [-1311.362] (-1310.829) (-1313.704) * [-1310.571] (-1313.020) (-1310.143) (-1310.985) -- 0:00:38 373500 -- (-1312.775) (-1311.214) (-1311.247) [-1312.789] * (-1312.033) (-1311.946) [-1310.665] (-1310.343) -- 0:00:38 374000 -- (-1311.098) (-1311.772) [-1310.241] (-1310.381) * (-1310.334) (-1311.081) (-1309.875) [-1310.577] -- 0:00:38 374500 -- (-1311.934) (-1312.776) [-1311.729] (-1309.983) * (-1309.715) (-1313.673) [-1312.017] (-1310.278) -- 0:00:38 375000 -- (-1312.772) (-1312.717) [-1311.421] (-1310.962) * (-1312.721) (-1310.849) (-1312.569) [-1309.696] -- 0:00:38 Average standard deviation of split frequencies: 0.017065 375500 -- [-1312.753] (-1311.419) (-1312.979) (-1312.619) * (-1315.118) (-1312.329) [-1311.438] (-1309.778) -- 0:00:38 376000 -- (-1310.366) (-1310.260) (-1311.050) [-1309.562] * (-1312.434) (-1309.611) (-1311.016) [-1311.402] -- 0:00:38 376500 -- [-1310.858] (-1310.935) (-1312.648) (-1312.072) * (-1310.315) (-1310.981) (-1310.920) [-1310.494] -- 0:00:38 377000 -- (-1312.278) [-1312.107] (-1310.638) (-1312.076) * (-1312.181) (-1311.891) (-1310.162) [-1309.664] -- 0:00:38 377500 -- [-1312.999] (-1310.719) (-1311.413) (-1311.402) * (-1311.443) (-1311.244) [-1310.698] (-1310.922) -- 0:00:37 378000 -- (-1309.547) (-1312.199) [-1313.014] (-1311.521) * (-1310.832) (-1310.414) [-1312.679] (-1314.142) -- 0:00:37 378500 -- (-1313.943) (-1312.656) [-1311.799] (-1310.660) * (-1312.923) (-1312.432) [-1312.769] (-1309.915) -- 0:00:39 379000 -- (-1312.656) (-1310.852) [-1312.809] (-1312.397) * [-1312.666] (-1310.069) (-1312.677) (-1310.678) -- 0:00:39 379500 -- (-1311.231) (-1313.262) [-1313.973] (-1311.973) * [-1311.936] (-1310.841) (-1316.499) (-1310.854) -- 0:00:39 380000 -- (-1312.180) (-1312.279) [-1313.884] (-1312.423) * (-1320.765) (-1310.763) (-1314.820) [-1313.702] -- 0:00:39 Average standard deviation of split frequencies: 0.016787 380500 -- (-1315.138) [-1310.386] (-1313.667) (-1314.429) * (-1314.520) (-1313.511) (-1312.611) [-1312.543] -- 0:00:39 381000 -- (-1310.259) (-1310.227) (-1314.177) [-1313.541] * (-1313.288) (-1310.905) (-1311.256) [-1310.263] -- 0:00:38 381500 -- (-1310.492) [-1310.278] (-1315.518) (-1311.066) * (-1311.262) (-1311.666) (-1312.164) [-1310.482] -- 0:00:38 382000 -- [-1311.935] (-1312.424) (-1312.236) (-1310.557) * (-1312.270) (-1310.138) (-1310.303) [-1310.781] -- 0:00:38 382500 -- [-1312.738] (-1321.189) (-1317.054) (-1313.705) * (-1312.545) (-1312.028) (-1310.601) [-1311.080] -- 0:00:38 383000 -- (-1318.331) (-1312.809) [-1315.021] (-1311.647) * [-1312.468] (-1314.346) (-1312.755) (-1312.089) -- 0:00:38 383500 -- (-1313.203) (-1312.091) (-1311.331) [-1309.681] * (-1311.604) [-1313.342] (-1312.971) (-1311.969) -- 0:00:38 384000 -- (-1315.364) (-1311.289) [-1311.170] (-1311.634) * [-1311.256] (-1311.024) (-1311.977) (-1314.723) -- 0:00:38 384500 -- (-1312.734) (-1313.354) [-1310.314] (-1313.717) * (-1311.867) (-1312.487) (-1313.246) [-1311.598] -- 0:00:38 385000 -- [-1310.353] (-1312.298) (-1311.543) (-1312.775) * (-1311.002) (-1312.276) [-1311.979] (-1313.455) -- 0:00:38 Average standard deviation of split frequencies: 0.016419 385500 -- (-1314.324) (-1311.599) (-1312.880) [-1311.369] * [-1312.334] (-1312.963) (-1312.685) (-1312.752) -- 0:00:38 386000 -- [-1310.940] (-1311.541) (-1311.575) (-1310.458) * (-1310.072) (-1309.980) (-1311.107) [-1312.649] -- 0:00:38 386500 -- [-1311.408] (-1318.365) (-1310.337) (-1311.660) * (-1311.742) (-1310.037) [-1309.362] (-1312.413) -- 0:00:38 387000 -- (-1311.970) (-1318.953) [-1309.360] (-1314.078) * [-1311.856] (-1310.955) (-1311.461) (-1311.495) -- 0:00:38 387500 -- [-1310.942] (-1310.912) (-1309.853) (-1314.314) * (-1313.456) [-1310.807] (-1312.940) (-1309.744) -- 0:00:37 388000 -- (-1310.513) [-1309.973] (-1310.361) (-1310.978) * (-1311.301) [-1312.207] (-1311.772) (-1310.084) -- 0:00:37 388500 -- (-1312.367) (-1310.050) [-1312.588] (-1312.371) * (-1309.800) (-1312.610) (-1311.731) [-1312.015] -- 0:00:37 389000 -- (-1310.317) [-1313.674] (-1311.506) (-1312.276) * (-1310.883) [-1312.484] (-1311.336) (-1311.055) -- 0:00:37 389500 -- (-1309.882) [-1312.595] (-1313.126) (-1313.033) * (-1313.185) (-1313.182) (-1310.781) [-1311.120] -- 0:00:37 390000 -- (-1311.276) (-1312.939) (-1317.118) [-1310.190] * (-1312.117) (-1312.261) [-1312.017] (-1311.579) -- 0:00:37 Average standard deviation of split frequencies: 0.016113 390500 -- (-1310.883) [-1311.812] (-1315.343) (-1309.623) * (-1313.507) (-1311.387) (-1311.413) [-1310.478] -- 0:00:37 391000 -- (-1310.922) [-1310.393] (-1313.349) (-1309.605) * (-1315.565) [-1314.826] (-1310.484) (-1309.646) -- 0:00:37 391500 -- [-1312.069] (-1312.798) (-1310.288) (-1315.757) * (-1312.058) [-1311.859] (-1312.053) (-1311.224) -- 0:00:37 392000 -- (-1311.946) (-1310.719) [-1310.761] (-1313.655) * [-1310.363] (-1311.701) (-1313.491) (-1312.656) -- 0:00:38 392500 -- (-1311.420) (-1311.430) (-1314.088) [-1314.575] * (-1313.062) [-1312.907] (-1315.987) (-1315.795) -- 0:00:38 393000 -- (-1311.445) (-1310.404) (-1313.134) [-1310.048] * (-1313.657) (-1315.247) [-1319.967] (-1316.090) -- 0:00:38 393500 -- [-1311.473] (-1311.330) (-1314.657) (-1310.311) * (-1313.053) (-1314.377) (-1316.233) [-1314.467] -- 0:00:38 394000 -- [-1311.151] (-1315.980) (-1313.484) (-1313.789) * [-1312.537] (-1309.981) (-1311.968) (-1310.727) -- 0:00:38 394500 -- (-1310.281) (-1313.157) [-1312.197] (-1312.391) * (-1315.182) (-1312.501) (-1311.294) [-1311.599] -- 0:00:38 395000 -- (-1310.321) [-1310.480] (-1316.294) (-1314.074) * (-1312.163) (-1312.733) [-1309.748] (-1310.933) -- 0:00:38 Average standard deviation of split frequencies: 0.016806 395500 -- (-1313.606) [-1309.899] (-1313.650) (-1311.426) * (-1314.878) (-1315.715) (-1310.945) [-1311.845] -- 0:00:38 396000 -- (-1310.993) [-1310.140] (-1313.304) (-1312.724) * (-1312.468) [-1313.633] (-1313.922) (-1310.826) -- 0:00:38 396500 -- (-1310.211) (-1310.633) [-1313.088] (-1310.614) * (-1310.441) (-1311.577) (-1311.790) [-1310.557] -- 0:00:38 397000 -- (-1312.415) (-1311.315) (-1310.050) [-1314.523] * [-1310.414] (-1313.775) (-1310.139) (-1310.003) -- 0:00:37 397500 -- (-1312.407) (-1310.894) (-1310.842) [-1311.889] * (-1309.903) (-1313.893) (-1311.325) [-1311.699] -- 0:00:37 398000 -- [-1309.915] (-1313.093) (-1314.729) (-1312.085) * (-1311.003) [-1311.199] (-1313.198) (-1310.940) -- 0:00:37 398500 -- [-1311.289] (-1311.393) (-1310.726) (-1317.290) * (-1310.775) [-1312.772] (-1310.985) (-1313.571) -- 0:00:37 399000 -- (-1310.394) [-1311.325] (-1315.084) (-1311.961) * [-1310.271] (-1312.608) (-1311.670) (-1311.781) -- 0:00:37 399500 -- (-1310.737) [-1310.585] (-1314.266) (-1310.610) * (-1310.915) [-1310.649] (-1312.856) (-1314.462) -- 0:00:37 400000 -- (-1310.725) (-1311.100) [-1318.096] (-1310.526) * (-1311.940) [-1311.985] (-1310.609) (-1309.825) -- 0:00:37 Average standard deviation of split frequencies: 0.016402 400500 -- (-1310.735) (-1315.032) [-1314.558] (-1309.651) * (-1311.103) [-1311.587] (-1310.274) (-1309.851) -- 0:00:37 401000 -- [-1311.875] (-1312.962) (-1314.747) (-1310.169) * (-1312.451) (-1311.985) [-1313.071] (-1310.368) -- 0:00:37 401500 -- [-1316.932] (-1312.467) (-1311.109) (-1312.350) * (-1314.989) (-1311.146) [-1312.699] (-1313.298) -- 0:00:37 402000 -- (-1313.877) (-1310.660) (-1310.302) [-1312.881] * (-1310.813) (-1312.085) [-1311.724] (-1312.956) -- 0:00:37 402500 -- (-1310.533) [-1310.087] (-1309.895) (-1313.696) * (-1310.408) (-1310.926) [-1313.211] (-1310.406) -- 0:00:37 403000 -- (-1311.518) (-1311.585) [-1310.021] (-1315.221) * [-1309.971] (-1311.477) (-1309.995) (-1310.806) -- 0:00:37 403500 -- [-1311.503] (-1312.034) (-1310.772) (-1313.716) * (-1311.269) (-1314.261) (-1312.347) [-1309.906] -- 0:00:36 404000 -- (-1312.672) (-1311.620) [-1309.815] (-1310.585) * (-1311.632) (-1314.996) (-1311.133) [-1309.832] -- 0:00:36 404500 -- (-1311.202) (-1309.637) [-1310.514] (-1312.203) * (-1311.949) [-1312.352] (-1313.233) (-1310.042) -- 0:00:36 405000 -- (-1311.058) (-1310.492) [-1310.416] (-1315.467) * (-1311.756) (-1312.361) (-1311.327) [-1310.051] -- 0:00:36 Average standard deviation of split frequencies: 0.016870 405500 -- [-1310.909] (-1310.330) (-1310.344) (-1313.167) * (-1311.091) [-1310.881] (-1312.035) (-1310.669) -- 0:00:38 406000 -- (-1310.060) (-1311.286) (-1311.040) [-1310.070] * [-1311.004] (-1310.343) (-1312.394) (-1310.531) -- 0:00:38 406500 -- (-1312.374) (-1314.113) (-1313.590) [-1310.693] * (-1310.898) (-1311.227) (-1312.002) [-1311.436] -- 0:00:37 407000 -- (-1311.238) [-1311.920] (-1311.678) (-1309.507) * (-1311.530) [-1312.582] (-1312.479) (-1311.018) -- 0:00:37 407500 -- (-1311.525) (-1311.848) (-1310.715) [-1310.603] * (-1312.723) [-1313.733] (-1310.669) (-1315.716) -- 0:00:37 408000 -- [-1311.246] (-1311.371) (-1309.952) (-1314.257) * (-1312.723) (-1317.691) (-1310.288) [-1311.072] -- 0:00:37 408500 -- (-1312.645) (-1310.496) (-1311.227) [-1314.279] * [-1311.628] (-1314.661) (-1312.827) (-1312.497) -- 0:00:37 409000 -- [-1312.340] (-1313.883) (-1310.981) (-1314.439) * (-1311.130) [-1313.006] (-1312.722) (-1317.767) -- 0:00:37 409500 -- (-1310.282) (-1313.444) [-1309.900] (-1312.767) * (-1311.270) (-1312.412) (-1312.744) [-1312.981] -- 0:00:37 410000 -- (-1309.985) (-1311.619) [-1309.979] (-1312.321) * (-1312.946) (-1311.867) (-1311.252) [-1312.858] -- 0:00:37 Average standard deviation of split frequencies: 0.017624 410500 -- (-1311.749) (-1310.510) [-1311.554] (-1311.703) * (-1310.402) (-1311.428) [-1310.728] (-1311.031) -- 0:00:37 411000 -- (-1311.967) (-1310.510) (-1311.535) [-1312.933] * (-1311.182) (-1310.262) (-1312.546) [-1309.732] -- 0:00:37 411500 -- [-1312.271] (-1310.964) (-1311.821) (-1311.742) * (-1315.905) (-1312.841) (-1311.682) [-1310.594] -- 0:00:37 412000 -- (-1312.035) [-1311.150] (-1311.520) (-1310.900) * (-1310.203) (-1314.445) [-1313.083] (-1312.092) -- 0:00:37 412500 -- (-1311.601) [-1310.930] (-1311.138) (-1311.795) * (-1313.572) [-1312.336] (-1311.423) (-1313.336) -- 0:00:37 413000 -- (-1312.475) (-1311.580) (-1311.523) [-1313.175] * (-1312.583) (-1310.607) [-1310.076] (-1310.615) -- 0:00:36 413500 -- [-1312.423] (-1310.359) (-1313.985) (-1311.228) * [-1311.854] (-1310.584) (-1314.333) (-1315.251) -- 0:00:36 414000 -- (-1309.872) [-1310.554] (-1310.387) (-1313.258) * (-1312.857) (-1315.578) (-1311.929) [-1311.712] -- 0:00:36 414500 -- (-1310.898) (-1310.554) [-1310.695] (-1311.100) * (-1311.945) [-1312.498] (-1310.217) (-1311.730) -- 0:00:36 415000 -- (-1311.550) (-1310.116) [-1316.170] (-1309.450) * (-1314.494) (-1311.261) (-1313.075) [-1317.241] -- 0:00:36 Average standard deviation of split frequencies: 0.017464 415500 -- (-1311.890) [-1309.819] (-1313.651) (-1310.269) * [-1312.680] (-1314.313) (-1311.351) (-1311.641) -- 0:00:36 416000 -- (-1311.537) (-1309.775) (-1313.712) [-1314.494] * (-1313.892) (-1310.280) (-1311.301) [-1311.585] -- 0:00:36 416500 -- (-1312.680) [-1309.704] (-1312.740) (-1312.185) * (-1311.383) (-1313.409) (-1310.465) [-1311.525] -- 0:00:36 417000 -- (-1310.706) (-1310.493) [-1310.242] (-1311.886) * (-1315.662) (-1313.273) [-1310.801] (-1311.942) -- 0:00:36 417500 -- (-1314.330) (-1310.385) (-1312.134) [-1311.775] * (-1314.733) (-1313.405) [-1311.503] (-1312.267) -- 0:00:36 418000 -- (-1310.245) [-1310.064] (-1312.536) (-1311.803) * (-1310.591) [-1311.838] (-1310.890) (-1312.062) -- 0:00:36 418500 -- (-1311.660) (-1314.072) [-1312.109] (-1311.210) * (-1310.487) [-1314.616] (-1315.340) (-1312.330) -- 0:00:36 419000 -- (-1311.283) (-1315.800) (-1310.876) [-1311.073] * (-1310.949) [-1310.605] (-1315.166) (-1312.354) -- 0:00:36 419500 -- [-1312.152] (-1311.193) (-1309.978) (-1311.554) * [-1310.041] (-1313.595) (-1312.662) (-1313.381) -- 0:00:35 420000 -- (-1314.922) [-1310.656] (-1309.585) (-1311.523) * (-1313.626) (-1313.365) (-1312.705) [-1312.968] -- 0:00:35 Average standard deviation of split frequencies: 0.017600 420500 -- (-1313.306) (-1309.722) (-1309.570) [-1310.394] * (-1314.583) (-1311.227) [-1312.087] (-1310.679) -- 0:00:37 421000 -- (-1311.312) [-1310.458] (-1312.519) (-1315.817) * (-1315.769) [-1311.486] (-1311.725) (-1310.798) -- 0:00:37 421500 -- (-1312.767) (-1313.420) [-1312.325] (-1319.930) * (-1313.607) [-1313.645] (-1311.971) (-1310.895) -- 0:00:37 422000 -- (-1311.884) (-1313.213) [-1311.656] (-1313.164) * (-1313.882) (-1313.333) [-1313.253] (-1310.955) -- 0:00:36 422500 -- (-1312.688) (-1313.711) (-1310.522) [-1313.743] * (-1312.337) [-1312.255] (-1316.755) (-1312.332) -- 0:00:36 423000 -- [-1310.715] (-1318.825) (-1310.166) (-1311.355) * (-1316.678) (-1311.359) [-1311.832] (-1311.938) -- 0:00:36 423500 -- (-1311.378) (-1312.553) [-1313.806] (-1311.488) * (-1313.664) (-1313.895) (-1312.647) [-1310.124] -- 0:00:36 424000 -- (-1311.860) (-1313.222) (-1311.976) [-1310.838] * (-1309.784) (-1311.857) [-1309.572] (-1310.071) -- 0:00:36 424500 -- (-1310.128) (-1315.112) [-1310.005] (-1311.403) * (-1312.643) (-1309.580) (-1310.553) [-1312.805] -- 0:00:36 425000 -- (-1314.605) (-1312.730) (-1310.914) [-1309.760] * (-1311.954) [-1310.017] (-1311.957) (-1314.567) -- 0:00:36 Average standard deviation of split frequencies: 0.017836 425500 -- [-1311.272] (-1315.175) (-1310.072) (-1310.813) * (-1311.786) (-1315.342) (-1312.221) [-1315.852] -- 0:00:36 426000 -- [-1311.174] (-1313.508) (-1313.545) (-1311.484) * (-1312.331) (-1310.830) (-1313.320) [-1313.044] -- 0:00:36 426500 -- (-1311.697) (-1312.581) (-1310.285) [-1311.775] * (-1311.175) (-1311.925) (-1313.322) [-1313.213] -- 0:00:36 427000 -- (-1312.583) (-1312.601) [-1316.203] (-1309.927) * (-1310.711) (-1309.862) [-1311.010] (-1309.819) -- 0:00:36 427500 -- (-1316.640) (-1312.010) [-1316.204] (-1309.717) * [-1311.516] (-1309.908) (-1311.866) (-1309.670) -- 0:00:36 428000 -- (-1316.649) (-1316.623) [-1310.220] (-1310.291) * (-1311.040) (-1310.209) (-1309.794) [-1310.044] -- 0:00:36 428500 -- [-1312.079] (-1318.800) (-1312.841) (-1311.496) * [-1311.086] (-1310.564) (-1311.439) (-1312.670) -- 0:00:36 429000 -- (-1312.084) (-1312.251) (-1310.476) [-1309.979] * [-1311.009] (-1311.836) (-1310.302) (-1310.167) -- 0:00:35 429500 -- (-1316.755) (-1312.844) (-1310.029) [-1310.171] * [-1311.009] (-1314.334) (-1310.384) (-1310.914) -- 0:00:35 430000 -- (-1314.243) (-1312.338) [-1313.061] (-1311.179) * [-1309.465] (-1314.463) (-1310.957) (-1314.175) -- 0:00:35 Average standard deviation of split frequencies: 0.017771 430500 -- (-1311.409) [-1310.669] (-1312.140) (-1313.511) * (-1311.555) [-1312.888] (-1311.708) (-1312.308) -- 0:00:35 431000 -- (-1312.889) [-1311.037] (-1310.346) (-1314.000) * (-1311.480) [-1310.189] (-1310.990) (-1312.290) -- 0:00:35 431500 -- [-1311.633] (-1313.280) (-1310.704) (-1312.691) * (-1312.845) (-1309.973) (-1317.086) [-1311.439] -- 0:00:35 432000 -- (-1314.093) (-1311.869) [-1311.109] (-1313.429) * (-1313.166) [-1309.597] (-1314.667) (-1312.312) -- 0:00:35 432500 -- (-1309.501) [-1311.211] (-1310.313) (-1311.154) * (-1313.671) [-1309.555] (-1313.152) (-1312.048) -- 0:00:35 433000 -- [-1310.149] (-1312.330) (-1310.547) (-1313.408) * (-1313.842) (-1310.205) [-1315.220] (-1311.199) -- 0:00:35 433500 -- [-1310.150] (-1314.803) (-1311.889) (-1313.179) * (-1313.134) (-1312.427) (-1316.731) [-1310.160] -- 0:00:35 434000 -- (-1313.358) (-1311.095) (-1311.889) [-1311.712] * [-1310.797] (-1312.058) (-1310.710) (-1311.203) -- 0:00:35 434500 -- (-1313.251) (-1314.435) [-1311.889] (-1311.345) * (-1311.547) (-1310.723) [-1310.165] (-1313.761) -- 0:00:35 435000 -- [-1313.166] (-1312.886) (-1314.024) (-1311.875) * (-1311.355) (-1311.436) [-1310.321] (-1311.203) -- 0:00:35 Average standard deviation of split frequencies: 0.017744 435500 -- (-1313.166) (-1310.791) (-1313.764) [-1311.390] * (-1310.001) (-1316.726) (-1310.144) [-1309.464] -- 0:00:34 436000 -- [-1312.247] (-1316.400) (-1312.400) (-1312.363) * (-1312.107) [-1311.234] (-1313.047) (-1309.635) -- 0:00:34 436500 -- (-1311.490) [-1312.925] (-1312.036) (-1311.629) * (-1311.789) (-1310.671) [-1310.991] (-1310.169) -- 0:00:36 437000 -- (-1315.119) (-1310.326) (-1317.674) [-1309.882] * (-1311.464) [-1311.927] (-1310.451) (-1311.622) -- 0:00:36 437500 -- (-1313.926) (-1310.811) [-1311.518] (-1310.356) * [-1311.411] (-1312.843) (-1312.734) (-1318.394) -- 0:00:36 438000 -- (-1310.112) (-1310.807) [-1310.395] (-1310.455) * (-1309.838) [-1310.784] (-1311.574) (-1310.529) -- 0:00:35 438500 -- (-1311.282) (-1310.674) [-1310.189] (-1310.381) * [-1310.026] (-1315.930) (-1311.173) (-1311.719) -- 0:00:35 439000 -- (-1312.936) (-1312.032) [-1311.754] (-1310.502) * (-1309.812) (-1313.745) [-1311.712] (-1311.544) -- 0:00:35 439500 -- (-1316.193) [-1312.597] (-1313.012) (-1310.929) * [-1310.905] (-1314.717) (-1312.869) (-1311.222) -- 0:00:35 440000 -- (-1310.685) (-1312.260) [-1311.213] (-1311.418) * (-1310.078) (-1312.382) (-1310.886) [-1311.308] -- 0:00:35 Average standard deviation of split frequencies: 0.017305 440500 -- [-1312.532] (-1310.668) (-1312.471) (-1312.727) * (-1310.267) [-1311.066] (-1309.825) (-1311.590) -- 0:00:35 441000 -- [-1312.549] (-1312.953) (-1312.533) (-1314.859) * (-1311.274) (-1310.522) [-1310.660] (-1311.394) -- 0:00:35 441500 -- (-1312.900) (-1310.875) (-1311.528) [-1310.257] * (-1310.429) (-1311.540) (-1310.643) [-1311.740] -- 0:00:35 442000 -- (-1311.314) (-1310.608) [-1313.464] (-1310.327) * (-1312.364) (-1311.090) (-1311.262) [-1309.950] -- 0:00:35 442500 -- (-1311.900) (-1312.042) [-1315.493] (-1313.349) * (-1314.807) (-1310.146) [-1312.523] (-1309.596) -- 0:00:35 443000 -- (-1312.740) [-1310.719] (-1312.005) (-1313.626) * (-1313.074) [-1309.727] (-1316.053) (-1310.655) -- 0:00:35 443500 -- (-1316.487) (-1310.928) (-1311.094) [-1314.021] * (-1311.144) (-1310.220) [-1320.244] (-1309.645) -- 0:00:35 444000 -- (-1315.560) [-1310.575] (-1311.095) (-1314.762) * (-1310.425) (-1310.383) [-1309.747] (-1313.133) -- 0:00:35 444500 -- (-1314.251) (-1313.666) [-1312.733] (-1314.754) * (-1310.979) [-1310.355] (-1311.231) (-1314.796) -- 0:00:34 445000 -- (-1310.617) (-1310.996) (-1312.901) [-1310.477] * (-1310.435) [-1311.019] (-1309.800) (-1316.303) -- 0:00:34 Average standard deviation of split frequencies: 0.017098 445500 -- (-1311.117) (-1311.246) (-1311.886) [-1310.245] * [-1310.174] (-1313.975) (-1309.929) (-1316.450) -- 0:00:34 446000 -- [-1312.643] (-1315.143) (-1310.557) (-1310.455) * (-1312.249) [-1313.474] (-1316.516) (-1310.655) -- 0:00:34 446500 -- [-1311.549] (-1318.086) (-1310.436) (-1311.288) * (-1317.720) [-1310.916] (-1313.392) (-1312.147) -- 0:00:34 447000 -- (-1313.495) (-1314.469) (-1311.507) [-1312.138] * (-1310.861) (-1311.077) (-1310.317) [-1311.156] -- 0:00:34 447500 -- (-1315.975) (-1316.026) (-1309.856) [-1312.308] * [-1311.749] (-1311.022) (-1313.790) (-1311.535) -- 0:00:34 448000 -- [-1312.334] (-1310.903) (-1309.750) (-1312.530) * [-1310.970] (-1314.455) (-1314.767) (-1311.608) -- 0:00:34 448500 -- [-1311.391] (-1309.958) (-1310.165) (-1313.355) * (-1312.574) (-1312.781) [-1315.747] (-1311.891) -- 0:00:34 449000 -- (-1312.726) [-1309.958] (-1311.965) (-1313.155) * (-1310.188) (-1312.388) [-1320.035] (-1313.115) -- 0:00:34 449500 -- (-1311.622) (-1311.078) [-1312.200] (-1315.192) * (-1313.070) (-1315.340) (-1313.660) [-1315.226] -- 0:00:34 450000 -- (-1313.081) (-1311.024) [-1312.000] (-1310.434) * [-1311.206] (-1315.226) (-1311.308) (-1311.031) -- 0:00:34 Average standard deviation of split frequencies: 0.017536 450500 -- (-1313.461) (-1310.086) (-1312.394) [-1313.692] * (-1311.539) (-1309.585) [-1309.782] (-1311.650) -- 0:00:34 451000 -- (-1310.174) [-1310.660] (-1313.436) (-1310.244) * (-1310.973) [-1311.318] (-1311.986) (-1312.822) -- 0:00:34 451500 -- (-1313.004) (-1311.283) (-1314.515) [-1310.336] * (-1312.797) (-1311.102) (-1312.245) [-1311.513] -- 0:00:34 452000 -- (-1310.237) [-1310.757] (-1314.530) (-1310.366) * [-1311.546] (-1310.436) (-1314.648) (-1311.877) -- 0:00:33 452500 -- [-1310.412] (-1311.952) (-1314.149) (-1311.946) * (-1311.539) [-1311.822] (-1309.927) (-1311.440) -- 0:00:35 453000 -- (-1312.868) (-1310.464) (-1317.194) [-1313.485] * (-1311.626) [-1312.174] (-1311.028) (-1310.251) -- 0:00:35 453500 -- [-1311.358] (-1313.804) (-1319.818) (-1310.395) * (-1312.380) (-1315.274) [-1310.458] (-1310.641) -- 0:00:34 454000 -- (-1310.238) (-1311.199) (-1311.779) [-1310.236] * (-1312.920) (-1313.767) (-1313.659) [-1314.104] -- 0:00:34 454500 -- (-1310.385) [-1312.300] (-1315.591) (-1310.032) * (-1311.563) (-1316.122) (-1310.130) [-1310.167] -- 0:00:34 455000 -- (-1310.839) [-1312.305] (-1311.724) (-1310.033) * (-1312.533) (-1313.662) (-1320.694) [-1311.353] -- 0:00:34 Average standard deviation of split frequencies: 0.017878 455500 -- (-1312.417) [-1311.825] (-1310.573) (-1312.398) * (-1311.433) [-1311.265] (-1312.355) (-1310.823) -- 0:00:34 456000 -- (-1312.622) [-1312.629] (-1314.263) (-1313.572) * (-1311.722) [-1313.928] (-1313.935) (-1310.412) -- 0:00:34 456500 -- [-1311.264] (-1315.205) (-1309.817) (-1310.041) * (-1309.910) [-1314.692] (-1312.095) (-1311.088) -- 0:00:34 457000 -- (-1310.316) (-1312.766) [-1311.136] (-1310.794) * (-1312.551) (-1314.686) (-1312.850) [-1310.236] -- 0:00:34 457500 -- (-1310.545) (-1311.973) [-1311.340] (-1311.288) * (-1313.421) (-1312.433) [-1311.518] (-1311.653) -- 0:00:34 458000 -- (-1311.512) (-1314.245) [-1309.558] (-1310.340) * (-1310.271) [-1311.484] (-1312.840) (-1316.657) -- 0:00:34 458500 -- (-1310.532) [-1313.658] (-1310.011) (-1312.349) * (-1310.770) (-1311.906) [-1313.592] (-1312.003) -- 0:00:34 459000 -- (-1311.244) [-1313.342] (-1311.190) (-1313.581) * (-1310.737) (-1312.653) (-1314.198) [-1311.951] -- 0:00:34 459500 -- (-1312.316) (-1312.780) [-1311.631] (-1312.740) * [-1310.826] (-1310.748) (-1311.351) (-1314.484) -- 0:00:34 460000 -- (-1309.827) (-1314.600) [-1311.720] (-1317.021) * (-1311.514) (-1310.321) [-1311.341] (-1315.195) -- 0:00:34 Average standard deviation of split frequencies: 0.017456 460500 -- (-1312.598) (-1314.790) (-1311.592) [-1311.665] * [-1313.863] (-1311.528) (-1314.768) (-1312.294) -- 0:00:33 461000 -- (-1312.644) (-1315.192) (-1312.403) [-1310.640] * [-1313.340] (-1315.944) (-1311.884) (-1313.620) -- 0:00:33 461500 -- [-1318.155] (-1311.230) (-1315.280) (-1312.499) * [-1310.996] (-1309.852) (-1311.578) (-1311.343) -- 0:00:33 462000 -- (-1313.623) [-1311.554] (-1314.361) (-1311.941) * [-1310.261] (-1309.515) (-1310.494) (-1311.024) -- 0:00:33 462500 -- (-1312.871) [-1310.128] (-1310.518) (-1312.779) * (-1312.626) (-1314.204) [-1311.261] (-1311.283) -- 0:00:33 463000 -- (-1313.970) (-1310.254) [-1311.772] (-1312.457) * (-1311.144) (-1310.521) (-1311.271) [-1311.853] -- 0:00:33 463500 -- (-1314.474) [-1310.079] (-1311.432) (-1311.172) * (-1312.303) (-1310.230) [-1310.251] (-1310.120) -- 0:00:33 464000 -- (-1312.818) [-1311.107] (-1315.686) (-1311.444) * (-1312.588) (-1317.716) [-1312.698] (-1310.151) -- 0:00:33 464500 -- [-1310.544] (-1313.553) (-1310.970) (-1311.811) * (-1318.900) (-1311.947) (-1311.098) [-1311.594] -- 0:00:33 465000 -- (-1311.844) (-1311.806) (-1313.183) [-1312.421] * (-1313.213) (-1312.867) (-1313.474) [-1311.499] -- 0:00:33 Average standard deviation of split frequencies: 0.017078 465500 -- (-1315.481) (-1313.281) [-1311.076] (-1311.004) * (-1310.586) (-1313.034) [-1314.667] (-1310.632) -- 0:00:33 466000 -- (-1312.672) (-1311.105) (-1311.518) [-1312.920] * (-1311.909) (-1312.887) [-1311.153] (-1313.308) -- 0:00:33 466500 -- (-1310.808) (-1313.278) (-1313.018) [-1313.954] * (-1311.686) (-1318.903) [-1311.932] (-1309.405) -- 0:00:33 467000 -- (-1312.385) (-1310.509) (-1312.518) [-1312.900] * [-1312.582] (-1318.689) (-1310.744) (-1311.168) -- 0:00:33 467500 -- [-1310.753] (-1310.536) (-1313.351) (-1311.418) * (-1310.280) (-1312.721) (-1310.326) [-1309.587] -- 0:00:33 468000 -- [-1310.443] (-1311.706) (-1312.239) (-1315.792) * (-1311.289) (-1310.352) (-1309.914) [-1309.587] -- 0:00:34 468500 -- (-1309.668) [-1310.048] (-1312.937) (-1310.921) * (-1310.933) (-1312.575) (-1309.859) [-1313.145] -- 0:00:34 469000 -- (-1309.669) [-1311.432] (-1312.389) (-1311.844) * (-1310.705) (-1311.650) (-1309.604) [-1311.802] -- 0:00:33 469500 -- (-1311.088) (-1312.124) [-1312.382] (-1311.100) * [-1310.064] (-1311.043) (-1310.736) (-1315.674) -- 0:00:33 470000 -- (-1310.581) (-1311.721) (-1311.683) [-1311.804] * [-1311.306] (-1312.510) (-1312.118) (-1312.867) -- 0:00:33 Average standard deviation of split frequencies: 0.017027 470500 -- (-1311.860) [-1310.210] (-1310.613) (-1315.659) * (-1310.719) (-1312.775) (-1310.468) [-1315.237] -- 0:00:33 471000 -- (-1312.225) (-1315.214) (-1312.304) [-1310.924] * (-1311.240) [-1311.521] (-1311.987) (-1316.478) -- 0:00:33 471500 -- (-1312.007) (-1313.708) (-1309.793) [-1310.442] * (-1314.083) (-1311.937) (-1311.498) [-1311.029] -- 0:00:33 472000 -- (-1312.804) (-1315.011) [-1313.041] (-1314.758) * [-1310.383] (-1311.660) (-1321.054) (-1315.561) -- 0:00:33 472500 -- (-1314.669) [-1313.058] (-1312.160) (-1313.128) * (-1309.804) (-1311.096) (-1317.176) [-1317.356] -- 0:00:33 473000 -- (-1312.318) (-1315.030) (-1313.928) [-1313.918] * [-1310.435] (-1315.706) (-1311.982) (-1313.200) -- 0:00:33 473500 -- (-1313.765) (-1311.424) (-1317.238) [-1311.524] * (-1311.952) [-1318.226] (-1317.805) (-1313.298) -- 0:00:33 474000 -- [-1312.711] (-1310.795) (-1315.413) (-1309.791) * [-1310.133] (-1312.605) (-1316.928) (-1312.478) -- 0:00:33 474500 -- (-1312.165) (-1313.891) [-1311.282] (-1310.281) * (-1310.371) (-1313.184) (-1313.125) [-1314.705] -- 0:00:33 475000 -- (-1318.861) (-1312.717) (-1310.403) [-1311.300] * (-1312.561) (-1315.164) (-1312.065) [-1312.009] -- 0:00:33 Average standard deviation of split frequencies: 0.017418 475500 -- [-1310.096] (-1310.183) (-1310.529) (-1310.118) * (-1310.438) [-1312.740] (-1314.421) (-1312.827) -- 0:00:33 476000 -- (-1310.096) (-1310.648) (-1312.191) [-1310.953] * (-1310.783) [-1311.080] (-1312.555) (-1314.469) -- 0:00:33 476500 -- (-1310.705) [-1311.558] (-1314.331) (-1310.860) * (-1310.084) [-1312.378] (-1312.030) (-1312.935) -- 0:00:32 477000 -- (-1313.805) [-1311.009] (-1311.010) (-1317.070) * (-1311.872) (-1316.350) [-1310.716] (-1313.102) -- 0:00:32 477500 -- (-1311.617) [-1312.544] (-1314.755) (-1316.240) * [-1310.920] (-1314.111) (-1315.268) (-1315.393) -- 0:00:32 478000 -- (-1310.287) (-1313.838) [-1314.372] (-1311.925) * (-1311.203) (-1312.814) [-1310.767] (-1313.478) -- 0:00:32 478500 -- [-1311.209] (-1312.059) (-1317.504) (-1310.176) * [-1310.588] (-1317.051) (-1310.404) (-1312.325) -- 0:00:32 479000 -- [-1313.502] (-1310.856) (-1316.742) (-1311.176) * (-1310.509) (-1316.271) (-1311.130) [-1310.951] -- 0:00:32 479500 -- (-1311.167) (-1310.036) [-1310.773] (-1313.961) * (-1312.514) [-1310.631] (-1311.532) (-1310.705) -- 0:00:32 480000 -- (-1310.926) (-1314.470) [-1311.785] (-1312.893) * (-1311.708) [-1312.020] (-1313.017) (-1311.276) -- 0:00:32 Average standard deviation of split frequencies: 0.018327 480500 -- (-1312.080) [-1313.249] (-1310.623) (-1316.567) * (-1310.670) [-1310.906] (-1315.176) (-1312.278) -- 0:00:32 481000 -- (-1311.414) (-1315.261) [-1310.434] (-1316.494) * (-1312.205) (-1312.951) [-1310.179] (-1312.092) -- 0:00:32 481500 -- [-1311.455] (-1313.204) (-1311.732) (-1312.792) * (-1309.609) [-1311.246] (-1312.176) (-1312.757) -- 0:00:32 482000 -- [-1314.736] (-1315.932) (-1311.501) (-1311.847) * [-1312.459] (-1309.863) (-1316.079) (-1315.727) -- 0:00:32 482500 -- [-1310.895] (-1314.047) (-1315.021) (-1310.002) * (-1311.962) (-1315.777) [-1310.357] (-1312.108) -- 0:00:32 483000 -- [-1309.841] (-1310.486) (-1316.983) (-1310.466) * [-1310.979] (-1317.548) (-1312.969) (-1309.707) -- 0:00:32 483500 -- (-1310.228) [-1310.859] (-1310.223) (-1311.192) * (-1311.322) [-1313.852] (-1310.825) (-1310.276) -- 0:00:32 484000 -- (-1311.601) [-1310.870] (-1312.600) (-1310.115) * (-1313.693) [-1310.435] (-1310.903) (-1313.387) -- 0:00:31 484500 -- (-1311.958) (-1310.268) [-1311.345] (-1309.971) * (-1312.401) (-1310.482) [-1311.636] (-1311.223) -- 0:00:32 485000 -- (-1311.827) [-1310.411] (-1320.332) (-1313.815) * (-1316.031) (-1313.254) (-1312.852) [-1311.938] -- 0:00:32 Average standard deviation of split frequencies: 0.017745 485500 -- (-1310.342) (-1310.405) (-1309.867) [-1311.744] * (-1314.530) (-1310.539) [-1312.017] (-1312.679) -- 0:00:32 486000 -- (-1311.748) (-1310.914) (-1314.213) [-1312.177] * (-1312.158) [-1311.587] (-1310.922) (-1311.449) -- 0:00:32 486500 -- [-1312.709] (-1312.925) (-1314.153) (-1310.376) * (-1310.439) [-1310.821] (-1312.562) (-1310.788) -- 0:00:32 487000 -- [-1310.153] (-1314.938) (-1318.922) (-1310.560) * (-1309.712) (-1311.546) (-1311.344) [-1310.343] -- 0:00:32 487500 -- [-1309.861] (-1315.723) (-1312.318) (-1310.124) * (-1310.676) [-1311.914] (-1310.340) (-1310.102) -- 0:00:32 488000 -- [-1312.449] (-1312.231) (-1313.927) (-1311.287) * (-1311.179) (-1310.906) [-1311.090] (-1313.211) -- 0:00:32 488500 -- (-1316.163) (-1313.553) (-1311.567) [-1312.712] * [-1309.963] (-1316.517) (-1316.275) (-1312.497) -- 0:00:32 489000 -- (-1312.215) (-1316.264) (-1314.801) [-1310.191] * (-1311.935) [-1312.603] (-1317.145) (-1312.726) -- 0:00:32 489500 -- (-1310.481) (-1312.115) [-1310.257] (-1310.192) * (-1312.950) [-1313.996] (-1310.532) (-1312.127) -- 0:00:32 490000 -- (-1311.031) [-1310.270] (-1309.679) (-1317.948) * [-1309.882] (-1315.291) (-1310.322) (-1314.076) -- 0:00:32 Average standard deviation of split frequencies: 0.017894 490500 -- (-1313.220) (-1310.426) [-1313.115] (-1317.105) * [-1311.284] (-1312.645) (-1310.342) (-1312.356) -- 0:00:32 491000 -- [-1313.332] (-1310.429) (-1318.129) (-1312.295) * [-1310.986] (-1310.959) (-1310.925) (-1311.289) -- 0:00:32 491500 -- [-1315.899] (-1312.118) (-1317.222) (-1310.801) * [-1310.084] (-1309.992) (-1312.161) (-1310.858) -- 0:00:32 492000 -- [-1312.148] (-1313.566) (-1316.873) (-1311.256) * (-1312.356) (-1311.724) (-1312.163) [-1311.002] -- 0:00:32 492500 -- [-1310.814] (-1316.666) (-1316.181) (-1313.581) * (-1310.390) [-1311.233] (-1312.163) (-1310.991) -- 0:00:31 493000 -- (-1311.300) (-1316.506) [-1309.898] (-1312.641) * (-1310.868) (-1310.141) [-1310.886] (-1312.650) -- 0:00:31 493500 -- (-1311.538) (-1313.243) (-1312.039) [-1310.411] * (-1312.051) (-1311.293) [-1313.316] (-1314.837) -- 0:00:31 494000 -- (-1313.113) [-1311.832] (-1311.570) (-1310.996) * [-1311.576] (-1312.532) (-1311.481) (-1313.868) -- 0:00:31 494500 -- (-1312.748) (-1312.269) (-1313.329) [-1310.855] * [-1312.874] (-1309.725) (-1315.824) (-1311.746) -- 0:00:31 495000 -- [-1316.700] (-1311.484) (-1310.784) (-1310.609) * (-1312.494) (-1310.344) [-1315.509] (-1311.746) -- 0:00:31 Average standard deviation of split frequencies: 0.017167 495500 -- (-1313.007) (-1311.700) [-1311.017] (-1313.277) * (-1311.300) [-1310.621] (-1316.097) (-1311.153) -- 0:00:31 496000 -- (-1310.364) (-1312.098) [-1311.251] (-1310.558) * [-1309.407] (-1310.793) (-1314.075) (-1311.147) -- 0:00:31 496500 -- (-1310.743) (-1315.978) [-1313.085] (-1312.325) * [-1311.451] (-1311.989) (-1310.013) (-1311.001) -- 0:00:31 497000 -- (-1310.438) [-1314.790] (-1309.763) (-1312.527) * (-1310.537) [-1311.102] (-1312.677) (-1310.255) -- 0:00:31 497500 -- (-1310.759) (-1310.837) [-1310.733] (-1309.887) * (-1310.686) [-1313.372] (-1311.689) (-1310.663) -- 0:00:31 498000 -- (-1314.492) (-1312.190) (-1312.245) [-1309.941] * (-1311.573) (-1310.585) [-1311.477] (-1310.764) -- 0:00:31 498500 -- (-1312.523) (-1310.825) (-1311.197) [-1310.696] * [-1312.371] (-1309.964) (-1310.533) (-1310.910) -- 0:00:31 499000 -- [-1310.950] (-1311.605) (-1311.977) (-1309.872) * (-1315.014) [-1310.414] (-1310.437) (-1316.381) -- 0:00:31 499500 -- (-1312.189) (-1313.549) [-1312.517] (-1315.601) * (-1311.743) (-1310.310) (-1312.249) [-1314.739] -- 0:00:31 500000 -- (-1310.944) (-1314.829) (-1313.354) [-1313.730] * (-1314.016) (-1309.756) [-1312.410] (-1311.929) -- 0:00:32 Average standard deviation of split frequencies: 0.017360 500500 -- (-1309.860) (-1311.989) (-1315.528) [-1314.394] * (-1311.751) [-1309.763] (-1311.238) (-1314.258) -- 0:00:31 501000 -- (-1311.899) [-1314.505] (-1316.210) (-1313.067) * (-1313.093) [-1311.955] (-1310.638) (-1310.910) -- 0:00:31 501500 -- [-1310.827] (-1313.190) (-1316.554) (-1312.359) * (-1316.113) (-1310.362) [-1317.120] (-1314.763) -- 0:00:31 502000 -- [-1311.898] (-1312.229) (-1312.444) (-1313.020) * (-1313.597) (-1311.727) (-1310.199) [-1312.210] -- 0:00:31 502500 -- (-1313.747) (-1311.312) [-1311.504] (-1313.249) * [-1311.590] (-1313.841) (-1313.041) (-1310.430) -- 0:00:31 503000 -- (-1315.331) (-1311.120) [-1310.726] (-1315.238) * (-1312.785) [-1311.817] (-1311.192) (-1311.081) -- 0:00:31 503500 -- (-1311.513) (-1309.598) [-1311.021] (-1310.984) * (-1313.447) [-1311.857] (-1311.404) (-1310.925) -- 0:00:31 504000 -- (-1310.701) (-1314.836) (-1315.651) [-1310.996] * (-1311.553) (-1313.025) [-1310.405] (-1316.424) -- 0:00:31 504500 -- (-1311.004) [-1318.652] (-1312.780) (-1310.265) * (-1312.494) (-1313.617) [-1310.807] (-1313.750) -- 0:00:31 505000 -- (-1311.805) (-1316.032) (-1311.931) [-1310.172] * (-1310.834) [-1311.115] (-1312.619) (-1312.680) -- 0:00:31 Average standard deviation of split frequencies: 0.016386 505500 -- (-1310.656) [-1312.188] (-1311.383) (-1315.858) * (-1310.472) (-1312.471) [-1310.221] (-1310.143) -- 0:00:31 506000 -- (-1311.152) [-1313.860] (-1310.377) (-1316.286) * (-1312.878) (-1315.400) [-1311.584] (-1312.386) -- 0:00:31 506500 -- (-1310.113) [-1309.859] (-1310.377) (-1313.412) * (-1309.826) (-1312.697) [-1310.492] (-1312.306) -- 0:00:31 507000 -- (-1310.113) (-1313.927) [-1312.508] (-1314.752) * [-1310.572] (-1309.758) (-1309.624) (-1315.785) -- 0:00:31 507500 -- (-1313.490) [-1310.271] (-1312.772) (-1314.310) * [-1310.990] (-1310.315) (-1310.139) (-1311.442) -- 0:00:31 508000 -- [-1316.012] (-1310.164) (-1312.796) (-1312.002) * (-1310.044) [-1311.030] (-1312.405) (-1313.330) -- 0:00:30 508500 -- (-1315.740) (-1310.898) (-1310.509) [-1310.751] * [-1312.749] (-1312.560) (-1310.287) (-1312.701) -- 0:00:30 509000 -- (-1312.359) [-1311.180] (-1311.656) (-1313.233) * [-1309.902] (-1311.687) (-1309.761) (-1313.141) -- 0:00:30 509500 -- (-1313.663) (-1311.610) [-1311.078] (-1312.820) * [-1311.290] (-1314.648) (-1311.477) (-1311.432) -- 0:00:30 510000 -- (-1316.160) (-1311.418) (-1310.957) [-1314.048] * (-1315.257) (-1311.335) (-1311.929) [-1311.932] -- 0:00:30 Average standard deviation of split frequencies: 0.016385 510500 -- (-1316.767) (-1314.794) [-1311.365] (-1311.618) * (-1315.916) [-1310.026] (-1311.350) (-1310.966) -- 0:00:30 511000 -- (-1312.632) [-1310.159] (-1314.258) (-1310.298) * (-1312.109) (-1310.283) [-1313.456] (-1310.965) -- 0:00:30 511500 -- (-1311.641) (-1313.358) (-1312.331) [-1312.472] * (-1313.143) (-1310.366) (-1315.554) [-1313.143] -- 0:00:30 512000 -- (-1310.385) [-1310.378] (-1313.970) (-1312.472) * (-1310.139) (-1310.373) (-1312.913) [-1314.065] -- 0:00:30 512500 -- (-1309.784) (-1312.607) [-1312.563] (-1309.456) * (-1312.773) [-1314.610] (-1310.362) (-1312.856) -- 0:00:30 513000 -- [-1309.848] (-1311.127) (-1314.509) (-1314.039) * [-1311.202] (-1312.718) (-1310.512) (-1312.744) -- 0:00:30 513500 -- (-1312.099) [-1311.912] (-1314.875) (-1313.319) * (-1312.035) (-1310.680) (-1311.519) [-1310.835] -- 0:00:30 514000 -- (-1310.811) [-1310.394] (-1311.517) (-1310.614) * [-1311.944] (-1310.683) (-1315.991) (-1310.022) -- 0:00:30 514500 -- (-1310.381) (-1310.010) (-1310.597) [-1312.003] * [-1311.899] (-1312.556) (-1314.186) (-1313.121) -- 0:00:30 515000 -- [-1312.879] (-1311.821) (-1313.099) (-1312.288) * (-1316.115) (-1310.064) (-1312.900) [-1310.528] -- 0:00:30 Average standard deviation of split frequencies: 0.015477 515500 -- (-1311.239) (-1312.718) [-1311.283] (-1311.667) * (-1312.376) [-1310.062] (-1315.536) (-1310.611) -- 0:00:31 516000 -- (-1315.025) [-1310.651] (-1311.699) (-1310.884) * (-1314.061) (-1313.070) [-1312.031] (-1311.592) -- 0:00:30 516500 -- (-1313.704) (-1314.821) (-1312.492) [-1310.215] * (-1315.540) (-1313.506) [-1312.767] (-1310.117) -- 0:00:30 517000 -- (-1311.440) (-1315.134) [-1310.396] (-1310.081) * [-1312.666] (-1311.460) (-1312.503) (-1310.031) -- 0:00:30 517500 -- (-1311.156) [-1310.570] (-1311.742) (-1310.094) * [-1311.133] (-1312.229) (-1311.561) (-1309.851) -- 0:00:30 518000 -- [-1311.270] (-1311.006) (-1312.327) (-1312.765) * [-1310.989] (-1310.870) (-1311.896) (-1309.908) -- 0:00:30 518500 -- (-1311.504) (-1314.075) [-1312.332] (-1311.764) * (-1317.034) [-1310.001] (-1313.311) (-1317.434) -- 0:00:30 519000 -- (-1311.162) (-1313.900) (-1314.786) [-1310.219] * [-1313.842] (-1309.796) (-1312.029) (-1311.142) -- 0:00:30 519500 -- (-1313.358) [-1311.682] (-1316.687) (-1311.068) * [-1316.914] (-1310.951) (-1311.352) (-1310.793) -- 0:00:30 520000 -- (-1310.648) (-1311.673) [-1311.571] (-1310.939) * (-1311.534) [-1312.994] (-1312.249) (-1316.077) -- 0:00:30 Average standard deviation of split frequencies: 0.016184 520500 -- (-1311.323) (-1313.199) [-1310.428] (-1310.377) * (-1310.657) (-1315.529) [-1314.891] (-1310.939) -- 0:00:30 521000 -- (-1312.736) (-1310.986) (-1310.761) [-1311.900] * [-1317.281] (-1315.984) (-1313.833) (-1311.397) -- 0:00:30 521500 -- [-1313.102] (-1311.031) (-1310.736) (-1315.327) * (-1316.610) (-1313.761) (-1310.260) [-1310.802] -- 0:00:30 522000 -- (-1309.627) [-1309.747] (-1312.361) (-1312.670) * (-1315.251) (-1315.286) [-1313.805] (-1311.310) -- 0:00:30 522500 -- [-1311.909] (-1313.152) (-1312.942) (-1313.677) * (-1310.795) (-1314.743) (-1313.985) [-1311.880] -- 0:00:30 523000 -- (-1310.992) (-1312.109) (-1310.882) [-1311.406] * [-1311.539] (-1311.592) (-1311.326) (-1310.868) -- 0:00:30 523500 -- (-1311.230) (-1312.412) (-1311.294) [-1310.844] * (-1313.271) (-1311.087) [-1312.420] (-1311.239) -- 0:00:30 524000 -- [-1312.432] (-1316.003) (-1313.321) (-1310.404) * (-1312.114) (-1309.888) [-1312.147] (-1312.210) -- 0:00:29 524500 -- (-1313.393) (-1313.819) (-1310.589) [-1310.684] * (-1315.190) [-1311.288] (-1311.241) (-1313.734) -- 0:00:29 525000 -- (-1311.429) (-1310.232) [-1309.996] (-1311.809) * (-1309.584) (-1311.320) (-1310.323) [-1310.602] -- 0:00:29 Average standard deviation of split frequencies: 0.015628 525500 -- (-1312.318) (-1312.305) [-1310.633] (-1312.171) * [-1311.819] (-1310.257) (-1310.425) (-1310.375) -- 0:00:29 526000 -- [-1312.624] (-1312.162) (-1310.209) (-1311.627) * (-1316.378) [-1309.924] (-1312.139) (-1309.799) -- 0:00:29 526500 -- (-1311.149) (-1311.969) (-1312.609) [-1312.175] * (-1312.066) (-1309.597) (-1311.899) [-1314.105] -- 0:00:29 527000 -- (-1309.847) (-1315.937) [-1311.068] (-1312.310) * [-1312.070] (-1309.726) (-1310.876) (-1315.299) -- 0:00:29 527500 -- [-1309.834] (-1314.168) (-1312.674) (-1310.915) * (-1312.737) (-1311.675) (-1312.697) [-1313.939] -- 0:00:29 528000 -- (-1309.840) (-1310.757) (-1315.259) [-1311.354] * [-1315.254] (-1315.284) (-1311.272) (-1313.737) -- 0:00:29 528500 -- (-1310.805) [-1314.622] (-1311.232) (-1311.618) * [-1317.440] (-1311.866) (-1312.906) (-1314.079) -- 0:00:29 529000 -- (-1311.972) (-1310.843) (-1313.784) [-1312.368] * (-1319.153) (-1311.226) [-1312.149] (-1310.709) -- 0:00:29 529500 -- (-1313.257) (-1311.288) (-1312.111) [-1311.743] * (-1313.719) (-1309.520) [-1313.269] (-1311.394) -- 0:00:29 530000 -- [-1312.577] (-1312.137) (-1314.694) (-1315.590) * (-1315.667) [-1309.989] (-1311.442) (-1311.552) -- 0:00:29 Average standard deviation of split frequencies: 0.015379 530500 -- (-1313.682) [-1309.565] (-1312.444) (-1310.893) * [-1312.471] (-1309.789) (-1312.163) (-1309.849) -- 0:00:29 531000 -- (-1314.045) [-1310.172] (-1312.777) (-1310.257) * [-1312.589] (-1311.841) (-1310.666) (-1309.699) -- 0:00:29 531500 -- [-1311.525] (-1311.444) (-1311.789) (-1310.560) * (-1313.462) (-1312.456) (-1313.665) [-1314.897] -- 0:00:29 532000 -- (-1312.355) [-1311.447] (-1311.951) (-1311.542) * (-1310.070) [-1312.977] (-1312.043) (-1312.942) -- 0:00:29 532500 -- (-1312.242) (-1310.419) (-1317.369) [-1310.168] * [-1311.566] (-1313.087) (-1311.681) (-1311.185) -- 0:00:29 533000 -- (-1312.749) [-1310.774] (-1310.849) (-1311.652) * (-1310.931) [-1317.741] (-1310.690) (-1312.441) -- 0:00:29 533500 -- (-1313.828) (-1310.940) (-1319.287) [-1312.485] * (-1314.117) (-1312.418) [-1310.479] (-1312.186) -- 0:00:29 534000 -- [-1311.430] (-1310.537) (-1310.325) (-1311.784) * (-1314.104) (-1311.882) [-1309.750] (-1313.470) -- 0:00:29 534500 -- (-1310.993) [-1310.568] (-1310.380) (-1312.601) * (-1310.861) (-1312.873) [-1310.402] (-1311.528) -- 0:00:29 535000 -- (-1311.719) (-1311.823) (-1312.382) [-1312.428] * (-1311.699) [-1310.492] (-1311.022) (-1310.659) -- 0:00:29 Average standard deviation of split frequencies: 0.015171 535500 -- (-1310.711) [-1310.039] (-1312.755) (-1312.588) * (-1312.736) (-1309.900) (-1312.309) [-1310.613] -- 0:00:29 536000 -- (-1311.712) [-1311.539] (-1312.153) (-1317.500) * (-1313.402) (-1316.001) (-1312.141) [-1312.909] -- 0:00:29 536500 -- [-1309.736] (-1311.985) (-1315.050) (-1316.746) * (-1312.179) (-1312.040) (-1311.987) [-1312.415] -- 0:00:29 537000 -- (-1310.705) (-1313.711) (-1312.954) [-1311.846] * (-1314.080) (-1311.585) [-1311.911] (-1312.964) -- 0:00:29 537500 -- (-1313.078) (-1315.311) (-1315.106) [-1310.545] * [-1312.281] (-1320.777) (-1309.911) (-1314.819) -- 0:00:29 538000 -- (-1315.223) [-1313.567] (-1313.308) (-1312.267) * (-1311.475) (-1315.609) (-1309.767) [-1311.222] -- 0:00:29 538500 -- (-1310.813) (-1312.790) [-1313.191] (-1312.004) * (-1315.319) (-1313.218) [-1309.759] (-1314.410) -- 0:00:29 539000 -- (-1310.868) (-1314.828) (-1310.487) [-1314.626] * (-1309.784) (-1313.581) (-1310.336) [-1311.243] -- 0:00:29 539500 -- (-1315.161) (-1313.498) [-1311.083] (-1310.382) * (-1313.525) (-1312.743) [-1310.331] (-1312.398) -- 0:00:29 540000 -- [-1315.304] (-1315.076) (-1310.020) (-1313.060) * [-1317.360] (-1313.344) (-1312.146) (-1312.831) -- 0:00:28 Average standard deviation of split frequencies: 0.014877 540500 -- (-1310.884) (-1312.294) (-1312.534) [-1310.143] * [-1314.236] (-1311.419) (-1311.780) (-1311.774) -- 0:00:28 541000 -- [-1311.358] (-1310.386) (-1312.742) (-1312.169) * (-1314.544) (-1311.706) [-1309.925] (-1310.630) -- 0:00:28 541500 -- (-1311.215) [-1310.019] (-1314.912) (-1311.731) * (-1313.247) [-1310.134] (-1310.013) (-1310.395) -- 0:00:28 542000 -- (-1311.121) (-1310.977) (-1312.116) [-1311.857] * (-1313.606) [-1309.465] (-1311.810) (-1313.750) -- 0:00:28 542500 -- (-1311.540) [-1311.379] (-1311.092) (-1314.378) * (-1312.467) [-1309.811] (-1310.508) (-1311.628) -- 0:00:28 543000 -- (-1311.704) (-1313.174) (-1313.102) [-1313.051] * (-1311.467) (-1309.845) [-1309.590] (-1310.288) -- 0:00:28 543500 -- (-1312.721) [-1311.027] (-1312.080) (-1313.179) * (-1312.859) (-1311.157) [-1310.898] (-1310.168) -- 0:00:28 544000 -- (-1313.618) (-1310.509) (-1310.274) [-1313.105] * [-1311.513] (-1310.440) (-1313.633) (-1311.932) -- 0:00:28 544500 -- [-1311.893] (-1310.736) (-1310.457) (-1312.413) * (-1311.513) (-1309.519) (-1312.035) [-1311.876] -- 0:00:28 545000 -- (-1310.257) (-1312.832) [-1312.905] (-1310.518) * (-1311.352) (-1311.998) (-1312.560) [-1312.645] -- 0:00:28 Average standard deviation of split frequencies: 0.014893 545500 -- (-1310.983) (-1311.431) [-1314.209] (-1313.000) * (-1311.649) [-1314.829] (-1311.393) (-1313.171) -- 0:00:28 546000 -- (-1310.814) (-1310.088) (-1312.594) [-1313.413] * (-1312.939) (-1313.217) [-1314.897] (-1311.847) -- 0:00:28 546500 -- (-1311.619) (-1312.424) (-1311.182) [-1309.444] * [-1309.951] (-1312.568) (-1313.322) (-1313.334) -- 0:00:28 547000 -- [-1313.190] (-1312.452) (-1311.556) (-1313.492) * (-1311.964) [-1310.228] (-1314.506) (-1312.679) -- 0:00:28 547500 -- (-1309.860) [-1312.395] (-1310.044) (-1313.195) * (-1312.720) (-1312.924) (-1311.783) [-1310.373] -- 0:00:28 548000 -- [-1309.506] (-1312.618) (-1310.320) (-1311.242) * [-1311.772] (-1312.892) (-1310.135) (-1312.308) -- 0:00:28 548500 -- (-1311.531) [-1311.529] (-1312.002) (-1310.758) * (-1312.275) [-1312.545] (-1315.964) (-1315.886) -- 0:00:28 549000 -- [-1313.584] (-1310.981) (-1311.950) (-1312.872) * [-1311.338] (-1313.169) (-1312.229) (-1310.318) -- 0:00:28 549500 -- (-1311.613) [-1310.208] (-1312.711) (-1315.386) * (-1311.428) (-1317.982) [-1313.709] (-1311.942) -- 0:00:28 550000 -- (-1311.668) [-1311.322] (-1311.086) (-1315.971) * [-1311.202] (-1313.708) (-1313.803) (-1311.550) -- 0:00:28 Average standard deviation of split frequencies: 0.014553 550500 -- (-1313.635) (-1310.182) [-1311.053] (-1312.912) * (-1310.599) [-1314.900] (-1310.372) (-1310.067) -- 0:00:28 551000 -- (-1309.883) (-1313.379) (-1310.961) [-1313.409] * (-1311.631) (-1316.209) (-1312.503) [-1309.876] -- 0:00:28 551500 -- (-1313.381) (-1313.696) [-1311.913] (-1309.756) * (-1311.494) [-1309.632] (-1311.660) (-1311.425) -- 0:00:28 552000 -- [-1312.462] (-1313.965) (-1312.654) (-1314.370) * (-1311.060) (-1312.322) [-1313.607] (-1311.133) -- 0:00:28 552500 -- (-1310.909) (-1313.296) [-1313.202] (-1315.857) * (-1312.257) (-1310.393) (-1315.163) [-1309.916] -- 0:00:28 553000 -- (-1309.819) (-1313.155) [-1313.127] (-1313.902) * [-1311.976] (-1311.605) (-1313.286) (-1311.246) -- 0:00:28 553500 -- (-1312.288) (-1310.512) [-1312.618] (-1317.659) * (-1314.209) (-1311.867) [-1311.620] (-1311.686) -- 0:00:28 554000 -- [-1312.431] (-1313.327) (-1315.162) (-1311.538) * (-1314.629) (-1310.662) (-1312.386) [-1312.485] -- 0:00:28 554500 -- [-1313.663] (-1310.535) (-1312.604) (-1310.682) * (-1312.192) [-1309.490] (-1310.995) (-1311.026) -- 0:00:28 555000 -- (-1313.928) [-1310.399] (-1311.856) (-1313.203) * (-1311.721) (-1310.571) [-1309.967] (-1312.354) -- 0:00:28 Average standard deviation of split frequencies: 0.013516 555500 -- (-1313.116) [-1311.895] (-1311.935) (-1311.271) * (-1316.938) (-1312.664) (-1310.896) [-1312.198] -- 0:00:28 556000 -- (-1312.148) (-1310.813) [-1311.950] (-1311.858) * (-1310.688) (-1309.713) [-1312.265] (-1317.160) -- 0:00:27 556500 -- [-1318.026] (-1312.778) (-1312.987) (-1311.833) * (-1313.076) (-1312.044) [-1311.783] (-1310.276) -- 0:00:27 557000 -- (-1314.431) [-1310.721] (-1311.537) (-1310.903) * (-1310.403) (-1311.438) (-1313.426) [-1310.410] -- 0:00:27 557500 -- (-1314.737) (-1311.709) [-1314.449] (-1312.255) * (-1310.505) (-1313.574) (-1310.086) [-1313.999] -- 0:00:27 558000 -- [-1313.783] (-1310.303) (-1313.827) (-1311.681) * (-1312.953) [-1311.385] (-1312.081) (-1310.205) -- 0:00:27 558500 -- [-1311.142] (-1314.282) (-1313.448) (-1312.252) * (-1312.676) (-1310.660) (-1310.989) [-1310.532] -- 0:00:27 559000 -- (-1312.272) (-1309.938) [-1311.848] (-1311.032) * (-1313.393) (-1310.865) [-1313.158] (-1317.427) -- 0:00:27 559500 -- (-1313.731) (-1311.217) (-1309.936) [-1309.902] * [-1310.926] (-1311.172) (-1312.388) (-1311.309) -- 0:00:27 560000 -- (-1313.022) (-1311.172) [-1312.111] (-1312.696) * [-1310.104] (-1312.120) (-1310.472) (-1311.523) -- 0:00:27 Average standard deviation of split frequencies: 0.013926 560500 -- (-1313.109) [-1312.036] (-1312.311) (-1312.195) * (-1312.162) [-1310.749] (-1311.890) (-1312.159) -- 0:00:27 561000 -- (-1310.761) (-1309.696) [-1313.365] (-1310.561) * [-1311.253] (-1312.283) (-1309.776) (-1311.907) -- 0:00:27 561500 -- [-1312.254] (-1310.457) (-1313.544) (-1309.918) * (-1311.865) [-1309.780] (-1312.716) (-1310.394) -- 0:00:27 562000 -- [-1312.480] (-1310.051) (-1312.830) (-1310.531) * (-1311.172) (-1310.754) (-1311.072) [-1310.573] -- 0:00:27 562500 -- (-1313.172) (-1311.081) (-1313.280) [-1310.677] * (-1315.812) (-1313.308) (-1313.414) [-1311.852] -- 0:00:27 563000 -- (-1312.767) (-1314.153) (-1311.526) [-1311.699] * (-1313.496) [-1310.447] (-1309.895) (-1312.422) -- 0:00:27 563500 -- [-1313.802] (-1313.180) (-1311.511) (-1310.514) * (-1311.722) (-1315.729) [-1310.501] (-1311.570) -- 0:00:27 564000 -- [-1310.120] (-1312.154) (-1311.903) (-1309.956) * (-1311.817) (-1312.711) (-1310.536) [-1310.135] -- 0:00:27 564500 -- (-1309.758) (-1311.750) (-1311.242) [-1310.139] * (-1315.188) [-1312.540] (-1314.559) (-1313.043) -- 0:00:27 565000 -- (-1312.641) [-1311.494] (-1316.999) (-1309.811) * [-1310.194] (-1310.896) (-1318.427) (-1313.089) -- 0:00:27 Average standard deviation of split frequencies: 0.013534 565500 -- (-1311.166) [-1313.932] (-1312.779) (-1315.897) * (-1311.316) (-1310.553) (-1312.539) [-1310.990] -- 0:00:27 566000 -- (-1312.418) (-1313.979) [-1316.868] (-1312.258) * (-1311.252) (-1310.307) (-1313.798) [-1312.565] -- 0:00:27 566500 -- (-1309.754) (-1310.404) [-1313.088] (-1314.833) * (-1313.608) (-1309.833) (-1313.870) [-1314.321] -- 0:00:27 567000 -- (-1311.538) (-1310.747) (-1314.837) [-1312.614] * [-1310.479] (-1312.389) (-1310.523) (-1315.706) -- 0:00:27 567500 -- (-1313.490) [-1310.653] (-1313.942) (-1312.045) * (-1311.284) (-1312.196) [-1310.441] (-1317.205) -- 0:00:27 568000 -- [-1311.282] (-1310.420) (-1314.334) (-1311.890) * (-1310.790) [-1311.818] (-1313.708) (-1316.052) -- 0:00:27 568500 -- (-1311.564) (-1314.627) (-1310.495) [-1312.605] * (-1311.841) (-1311.178) [-1310.358] (-1314.201) -- 0:00:27 569000 -- (-1314.726) (-1311.736) [-1310.018] (-1311.754) * (-1310.496) [-1312.169] (-1309.898) (-1310.993) -- 0:00:27 569500 -- (-1311.195) (-1310.660) (-1312.636) [-1313.941] * (-1312.150) [-1310.777] (-1310.301) (-1313.636) -- 0:00:27 570000 -- [-1311.330] (-1312.287) (-1310.815) (-1311.895) * [-1313.381] (-1310.850) (-1312.372) (-1314.007) -- 0:00:27 Average standard deviation of split frequencies: 0.013269 570500 -- (-1313.253) (-1311.928) [-1310.815] (-1312.101) * (-1314.509) (-1312.235) (-1313.337) [-1314.001] -- 0:00:27 571000 -- [-1310.839] (-1311.718) (-1310.562) (-1310.578) * (-1313.197) (-1312.711) [-1312.478] (-1313.915) -- 0:00:27 571500 -- (-1310.902) (-1309.615) (-1310.413) [-1313.771] * [-1312.709] (-1313.641) (-1313.271) (-1312.286) -- 0:00:26 572000 -- [-1312.536] (-1315.362) (-1310.531) (-1311.476) * (-1310.962) [-1311.097] (-1311.902) (-1315.965) -- 0:00:26 572500 -- [-1310.553] (-1311.490) (-1309.694) (-1310.871) * (-1313.330) [-1310.539] (-1312.077) (-1316.620) -- 0:00:26 573000 -- (-1317.990) (-1312.187) (-1310.885) [-1312.254] * (-1311.975) [-1311.683] (-1315.863) (-1317.318) -- 0:00:26 573500 -- [-1312.175] (-1311.363) (-1314.962) (-1312.672) * [-1311.606] (-1313.353) (-1314.577) (-1318.828) -- 0:00:26 574000 -- [-1310.414] (-1312.367) (-1312.185) (-1311.501) * [-1310.563] (-1311.964) (-1317.007) (-1312.402) -- 0:00:26 574500 -- (-1312.426) [-1312.346] (-1317.159) (-1313.677) * [-1310.479] (-1313.353) (-1311.687) (-1312.291) -- 0:00:26 575000 -- (-1312.356) [-1311.421] (-1315.051) (-1311.646) * (-1311.055) (-1314.128) (-1312.117) [-1312.680] -- 0:00:26 Average standard deviation of split frequencies: 0.013248 575500 -- (-1311.998) [-1312.339] (-1315.433) (-1311.769) * [-1311.339] (-1315.268) (-1312.466) (-1312.885) -- 0:00:26 576000 -- [-1310.206] (-1311.202) (-1315.432) (-1312.145) * [-1311.771] (-1315.863) (-1312.617) (-1311.407) -- 0:00:26 576500 -- [-1313.580] (-1310.814) (-1313.904) (-1316.706) * (-1319.919) (-1311.864) (-1312.259) [-1309.940] -- 0:00:26 577000 -- (-1314.129) [-1312.360] (-1316.079) (-1315.513) * [-1311.914] (-1312.178) (-1314.294) (-1311.770) -- 0:00:26 577500 -- (-1311.715) (-1311.842) [-1317.743] (-1316.726) * (-1312.467) (-1309.883) [-1311.153] (-1311.937) -- 0:00:26 578000 -- [-1312.260] (-1311.412) (-1311.547) (-1315.092) * (-1310.010) [-1310.516] (-1314.001) (-1310.367) -- 0:00:26 578500 -- [-1312.179] (-1309.525) (-1312.982) (-1315.213) * (-1310.232) (-1312.798) [-1310.069] (-1313.293) -- 0:00:26 579000 -- (-1310.804) [-1311.363] (-1314.046) (-1315.659) * (-1310.693) (-1312.589) [-1310.401] (-1311.302) -- 0:00:26 579500 -- [-1309.757] (-1310.491) (-1311.931) (-1311.249) * (-1313.874) (-1310.903) [-1313.955] (-1311.235) -- 0:00:26 580000 -- (-1310.947) (-1311.160) [-1313.040] (-1311.289) * [-1312.766] (-1310.197) (-1309.871) (-1311.460) -- 0:00:26 Average standard deviation of split frequencies: 0.013700 580500 -- (-1309.780) [-1310.989] (-1317.367) (-1314.857) * (-1313.613) [-1311.168] (-1312.988) (-1313.820) -- 0:00:26 581000 -- [-1309.772] (-1309.783) (-1311.020) (-1312.803) * (-1312.172) (-1313.575) [-1312.902] (-1310.483) -- 0:00:26 581500 -- [-1310.282] (-1313.984) (-1311.485) (-1313.186) * (-1312.021) (-1313.157) (-1310.393) [-1310.514] -- 0:00:26 582000 -- (-1311.688) (-1310.622) (-1311.162) [-1314.991] * (-1311.053) [-1313.175] (-1310.462) (-1311.083) -- 0:00:26 582500 -- (-1313.067) (-1310.443) [-1311.105] (-1312.229) * (-1310.463) [-1310.669] (-1313.445) (-1309.778) -- 0:00:26 583000 -- (-1311.597) (-1311.419) (-1310.026) [-1311.325] * (-1310.717) (-1311.462) (-1313.865) [-1310.623] -- 0:00:26 583500 -- [-1310.814] (-1311.426) (-1312.495) (-1312.821) * (-1312.325) (-1310.910) (-1312.390) [-1312.262] -- 0:00:26 584000 -- [-1310.565] (-1311.388) (-1309.894) (-1317.554) * (-1310.247) (-1312.722) [-1313.311] (-1310.418) -- 0:00:26 584500 -- (-1313.399) (-1311.407) (-1313.599) [-1312.031] * (-1314.163) [-1315.075] (-1315.911) (-1310.261) -- 0:00:26 585000 -- (-1311.161) (-1314.822) [-1316.978] (-1311.275) * (-1316.251) [-1312.988] (-1312.349) (-1311.398) -- 0:00:26 Average standard deviation of split frequencies: 0.013173 585500 -- (-1313.045) (-1313.604) [-1309.650] (-1319.582) * [-1312.405] (-1310.308) (-1311.985) (-1312.186) -- 0:00:26 586000 -- (-1311.330) (-1311.326) [-1310.384] (-1310.475) * (-1313.875) (-1311.302) [-1312.424] (-1312.260) -- 0:00:26 586500 -- [-1313.931] (-1311.168) (-1314.361) (-1312.693) * [-1312.738] (-1312.936) (-1313.786) (-1312.779) -- 0:00:26 587000 -- [-1314.518] (-1313.341) (-1315.090) (-1319.330) * [-1311.995] (-1311.633) (-1312.771) (-1310.028) -- 0:00:26 587500 -- (-1310.439) (-1312.042) [-1312.011] (-1316.540) * (-1310.751) [-1310.763] (-1313.559) (-1314.032) -- 0:00:25 588000 -- (-1311.994) (-1310.813) (-1313.088) [-1314.023] * [-1310.751] (-1310.792) (-1314.636) (-1312.409) -- 0:00:25 588500 -- (-1312.788) [-1313.087] (-1315.046) (-1310.667) * [-1311.062] (-1310.633) (-1314.691) (-1315.260) -- 0:00:25 589000 -- (-1311.845) [-1311.378] (-1320.870) (-1315.034) * [-1310.786] (-1311.808) (-1313.357) (-1315.792) -- 0:00:25 589500 -- (-1311.196) (-1316.169) [-1314.975] (-1313.922) * (-1311.038) (-1310.910) (-1314.194) [-1311.635] -- 0:00:25 590000 -- [-1310.742] (-1312.145) (-1314.841) (-1309.642) * (-1310.189) [-1310.055] (-1311.529) (-1311.752) -- 0:00:25 Average standard deviation of split frequencies: 0.012769 590500 -- (-1311.595) (-1310.095) [-1312.239] (-1310.767) * (-1311.691) (-1311.768) [-1315.254] (-1312.009) -- 0:00:25 591000 -- [-1310.671] (-1310.309) (-1310.886) (-1314.041) * (-1311.982) [-1316.095] (-1312.034) (-1310.333) -- 0:00:25 591500 -- (-1309.537) [-1312.123] (-1311.490) (-1311.271) * [-1311.434] (-1311.300) (-1313.129) (-1312.606) -- 0:00:25 592000 -- (-1309.536) [-1312.359] (-1310.396) (-1312.519) * (-1312.430) [-1310.683] (-1310.581) (-1313.067) -- 0:00:25 592500 -- (-1310.534) [-1310.906] (-1311.354) (-1313.219) * [-1311.542] (-1311.184) (-1312.254) (-1310.410) -- 0:00:25 593000 -- [-1312.242] (-1311.184) (-1311.968) (-1309.498) * (-1318.893) (-1313.589) [-1312.563] (-1313.083) -- 0:00:25 593500 -- [-1309.971] (-1312.076) (-1319.238) (-1309.492) * [-1311.074] (-1311.223) (-1310.917) (-1313.523) -- 0:00:25 594000 -- (-1312.030) (-1310.954) [-1315.310] (-1312.966) * [-1313.006] (-1312.414) (-1313.207) (-1313.874) -- 0:00:25 594500 -- (-1309.547) (-1312.711) (-1309.987) [-1315.337] * (-1314.442) [-1312.903] (-1312.801) (-1313.639) -- 0:00:25 595000 -- (-1310.454) [-1312.671] (-1310.752) (-1315.473) * (-1310.095) (-1312.656) (-1312.775) [-1314.281] -- 0:00:25 Average standard deviation of split frequencies: 0.012359 595500 -- (-1310.957) (-1313.104) [-1310.472] (-1311.080) * (-1311.073) [-1311.288] (-1312.694) (-1311.996) -- 0:00:25 596000 -- (-1310.759) (-1313.472) [-1312.042] (-1310.688) * (-1311.436) (-1313.011) [-1312.271] (-1310.596) -- 0:00:25 596500 -- (-1311.409) [-1312.572] (-1311.905) (-1310.471) * (-1310.398) [-1314.599] (-1311.305) (-1313.722) -- 0:00:25 597000 -- (-1313.478) (-1310.995) (-1310.866) [-1314.236] * (-1311.198) [-1310.550] (-1313.125) (-1315.568) -- 0:00:25 597500 -- (-1311.810) (-1310.309) [-1311.965] (-1312.106) * (-1313.262) [-1313.206] (-1311.054) (-1311.464) -- 0:00:25 598000 -- (-1311.852) (-1312.778) (-1310.954) [-1310.438] * (-1312.040) (-1311.270) (-1310.349) [-1310.628] -- 0:00:25 598500 -- [-1311.179] (-1312.385) (-1310.117) (-1310.866) * (-1314.766) (-1310.763) (-1312.333) [-1311.909] -- 0:00:25 599000 -- [-1312.968] (-1309.900) (-1310.244) (-1312.195) * (-1310.068) (-1312.676) (-1311.369) [-1314.789] -- 0:00:25 599500 -- (-1311.816) [-1311.271] (-1311.739) (-1313.167) * (-1313.061) (-1311.712) (-1312.732) [-1314.746] -- 0:00:25 600000 -- (-1312.622) (-1313.497) (-1310.469) [-1310.481] * [-1313.686] (-1310.383) (-1310.515) (-1312.488) -- 0:00:25 Average standard deviation of split frequencies: 0.011929 600500 -- (-1313.730) (-1311.132) [-1312.276] (-1310.509) * (-1314.032) [-1312.285] (-1319.510) (-1311.048) -- 0:00:25 601000 -- (-1311.946) [-1311.132] (-1311.564) (-1311.301) * (-1314.030) (-1309.979) [-1311.442] (-1310.748) -- 0:00:25 601500 -- [-1311.588] (-1310.709) (-1311.207) (-1313.641) * (-1310.149) [-1318.548] (-1315.248) (-1312.692) -- 0:00:25 602000 -- (-1314.219) [-1310.149] (-1311.706) (-1311.052) * (-1309.509) (-1313.937) (-1310.540) [-1313.234] -- 0:00:25 602500 -- (-1311.418) [-1310.474] (-1312.335) (-1312.487) * (-1310.019) (-1311.998) (-1317.397) [-1310.372] -- 0:00:25 603000 -- [-1313.369] (-1310.454) (-1311.859) (-1311.865) * (-1310.743) (-1311.632) (-1313.371) [-1310.241] -- 0:00:25 603500 -- [-1318.479] (-1311.602) (-1313.594) (-1310.965) * (-1311.393) (-1312.338) [-1312.973] (-1310.705) -- 0:00:24 604000 -- (-1313.379) (-1312.193) [-1311.453] (-1312.398) * (-1318.692) (-1315.296) (-1311.892) [-1311.033] -- 0:00:24 604500 -- (-1311.926) (-1312.483) [-1310.336] (-1312.781) * [-1311.779] (-1312.674) (-1310.745) (-1311.215) -- 0:00:24 605000 -- (-1312.086) (-1312.917) (-1311.820) [-1310.946] * (-1314.269) (-1313.725) [-1311.699] (-1311.634) -- 0:00:24 Average standard deviation of split frequencies: 0.012300 605500 -- (-1313.013) (-1311.638) [-1311.166] (-1310.937) * (-1313.524) (-1310.654) (-1311.739) [-1311.049] -- 0:00:24 606000 -- (-1311.217) (-1313.494) [-1311.060] (-1310.105) * (-1312.492) (-1310.464) [-1313.456] (-1314.693) -- 0:00:24 606500 -- (-1315.985) (-1312.305) (-1311.209) [-1310.847] * [-1310.454] (-1311.479) (-1311.549) (-1311.167) -- 0:00:24 607000 -- [-1310.387] (-1311.341) (-1309.675) (-1310.974) * (-1312.519) [-1311.328] (-1310.777) (-1309.427) -- 0:00:24 607500 -- [-1312.237] (-1310.905) (-1310.085) (-1311.511) * (-1309.685) (-1310.205) (-1311.289) [-1311.548] -- 0:00:24 608000 -- (-1310.690) [-1310.788] (-1310.099) (-1311.000) * (-1310.284) [-1312.365] (-1311.691) (-1309.439) -- 0:00:24 608500 -- (-1310.499) (-1312.437) [-1309.645] (-1310.230) * [-1311.591] (-1310.403) (-1311.867) (-1311.126) -- 0:00:24 609000 -- [-1310.620] (-1309.872) (-1310.743) (-1310.682) * [-1311.039] (-1311.889) (-1311.833) (-1312.065) -- 0:00:24 609500 -- [-1310.612] (-1311.868) (-1312.016) (-1310.231) * (-1314.631) [-1310.404] (-1310.619) (-1313.771) -- 0:00:24 610000 -- (-1310.658) [-1310.916] (-1312.809) (-1310.698) * (-1310.331) (-1310.959) (-1311.153) [-1311.485] -- 0:00:24 Average standard deviation of split frequencies: 0.012197 610500 -- [-1310.609] (-1310.645) (-1312.555) (-1311.277) * [-1310.331] (-1310.878) (-1311.539) (-1313.583) -- 0:00:24 611000 -- (-1311.076) [-1311.664] (-1313.726) (-1312.476) * (-1312.538) [-1311.458] (-1311.743) (-1311.119) -- 0:00:24 611500 -- (-1309.653) (-1311.861) (-1312.089) [-1312.889] * (-1312.938) (-1314.615) [-1311.295] (-1311.189) -- 0:00:24 612000 -- [-1312.196] (-1312.342) (-1310.559) (-1311.785) * (-1310.674) [-1311.994] (-1311.121) (-1312.457) -- 0:00:24 612500 -- (-1312.428) (-1310.886) (-1311.525) [-1314.498] * (-1311.517) [-1311.920] (-1313.403) (-1314.137) -- 0:00:24 613000 -- (-1310.371) (-1312.256) (-1312.868) [-1312.699] * (-1311.811) [-1311.292] (-1313.411) (-1316.209) -- 0:00:24 613500 -- (-1310.642) (-1311.642) [-1312.501] (-1311.331) * (-1310.410) [-1312.174] (-1310.436) (-1312.471) -- 0:00:24 614000 -- (-1313.476) (-1311.492) (-1313.976) [-1310.713] * (-1315.348) (-1311.767) [-1312.876] (-1312.580) -- 0:00:24 614500 -- (-1312.320) (-1311.236) (-1317.366) [-1309.698] * [-1310.016] (-1311.248) (-1313.376) (-1311.197) -- 0:00:24 615000 -- (-1311.546) (-1313.088) [-1313.159] (-1310.473) * [-1310.082] (-1309.787) (-1310.905) (-1312.751) -- 0:00:24 Average standard deviation of split frequencies: 0.011581 615500 -- (-1311.119) (-1314.561) (-1313.232) [-1311.128] * (-1312.379) [-1310.845] (-1310.705) (-1311.695) -- 0:00:24 616000 -- (-1310.980) (-1317.979) (-1312.694) [-1311.014] * (-1312.129) (-1309.665) (-1310.031) [-1311.203] -- 0:00:24 616500 -- (-1310.122) (-1310.539) (-1311.895) [-1310.850] * [-1309.397] (-1311.257) (-1311.158) (-1313.521) -- 0:00:24 617000 -- (-1311.058) [-1311.043] (-1309.795) (-1310.496) * (-1309.804) (-1310.333) [-1313.126] (-1314.122) -- 0:00:24 617500 -- (-1313.981) [-1313.358] (-1312.135) (-1310.510) * (-1309.728) (-1312.335) [-1309.666] (-1315.119) -- 0:00:24 618000 -- (-1309.840) [-1311.609] (-1313.310) (-1311.777) * (-1311.280) (-1312.627) [-1310.746] (-1313.777) -- 0:00:24 618500 -- [-1310.068] (-1311.295) (-1311.709) (-1310.963) * [-1310.552] (-1309.867) (-1312.837) (-1312.345) -- 0:00:24 619000 -- (-1311.523) (-1313.704) [-1311.315] (-1311.557) * [-1310.342] (-1309.363) (-1313.923) (-1311.568) -- 0:00:24 619500 -- (-1312.197) (-1314.018) [-1309.842] (-1312.306) * (-1311.131) (-1314.207) (-1313.758) [-1314.450] -- 0:00:23 620000 -- (-1311.545) (-1312.214) [-1310.740] (-1311.950) * (-1310.556) (-1314.236) (-1314.622) [-1311.834] -- 0:00:23 Average standard deviation of split frequencies: 0.010785 620500 -- (-1310.940) (-1310.907) [-1311.393] (-1310.701) * (-1310.130) (-1313.147) (-1315.992) [-1314.792] -- 0:00:23 621000 -- (-1310.289) (-1310.631) [-1312.835] (-1311.574) * [-1313.238] (-1310.743) (-1315.581) (-1314.515) -- 0:00:23 621500 -- [-1312.420] (-1312.854) (-1312.509) (-1311.766) * (-1317.702) (-1313.048) [-1313.518] (-1309.877) -- 0:00:23 622000 -- (-1312.489) (-1311.319) (-1311.466) [-1311.981] * [-1315.626] (-1312.731) (-1311.367) (-1309.967) -- 0:00:23 622500 -- (-1312.692) (-1311.630) [-1312.398] (-1313.429) * [-1310.071] (-1314.614) (-1312.966) (-1309.937) -- 0:00:23 623000 -- [-1311.637] (-1310.994) (-1315.107) (-1310.880) * (-1319.108) [-1310.960] (-1313.549) (-1311.549) -- 0:00:23 623500 -- (-1310.330) [-1310.727] (-1309.518) (-1310.522) * (-1316.564) [-1311.782] (-1313.916) (-1311.875) -- 0:00:23 624000 -- (-1309.907) (-1313.491) (-1309.518) [-1310.520] * (-1311.661) [-1310.643] (-1310.904) (-1312.353) -- 0:00:23 624500 -- (-1310.750) (-1310.965) (-1310.200) [-1309.516] * (-1310.097) (-1310.643) (-1313.929) [-1311.152] -- 0:00:23 625000 -- (-1312.090) (-1311.077) [-1312.435] (-1316.616) * (-1312.944) (-1310.385) (-1311.308) [-1311.992] -- 0:00:24 Average standard deviation of split frequencies: 0.010543 625500 -- (-1314.018) (-1311.090) (-1313.578) [-1312.220] * (-1310.350) (-1310.728) [-1309.961] (-1312.757) -- 0:00:23 626000 -- [-1311.986] (-1312.588) (-1312.146) (-1312.208) * (-1310.280) (-1312.083) (-1316.357) [-1313.265] -- 0:00:23 626500 -- [-1315.127] (-1310.412) (-1316.295) (-1310.360) * (-1310.978) (-1313.666) (-1319.314) [-1311.435] -- 0:00:23 627000 -- (-1311.025) [-1309.487] (-1313.234) (-1310.476) * (-1310.492) (-1310.689) (-1310.164) [-1309.866] -- 0:00:23 627500 -- (-1311.497) (-1310.277) (-1313.502) [-1314.487] * (-1311.375) [-1311.038] (-1310.286) (-1309.866) -- 0:00:23 628000 -- [-1311.666] (-1311.647) (-1312.620) (-1313.542) * [-1310.980] (-1312.862) (-1311.123) (-1311.483) -- 0:00:23 628500 -- (-1312.426) (-1310.500) (-1314.047) [-1311.884] * (-1314.159) [-1313.554] (-1312.922) (-1313.233) -- 0:00:23 629000 -- (-1311.827) (-1311.466) (-1313.193) [-1310.748] * (-1312.902) (-1312.586) (-1310.255) [-1311.128] -- 0:00:23 629500 -- (-1311.220) (-1312.003) [-1313.823] (-1309.851) * [-1310.593] (-1312.310) (-1310.452) (-1311.265) -- 0:00:23 630000 -- [-1313.421] (-1310.516) (-1315.669) (-1311.643) * [-1311.274] (-1316.334) (-1309.417) (-1311.958) -- 0:00:23 Average standard deviation of split frequencies: 0.010044 630500 -- (-1312.877) (-1311.630) [-1315.508] (-1310.440) * (-1310.115) (-1311.182) (-1312.226) [-1311.277] -- 0:00:23 631000 -- (-1313.427) [-1310.258] (-1312.053) (-1310.987) * (-1315.656) (-1315.214) (-1312.347) [-1311.866] -- 0:00:23 631500 -- (-1314.985) (-1310.718) [-1310.403] (-1309.842) * (-1313.337) [-1311.586] (-1312.070) (-1311.528) -- 0:00:23 632000 -- [-1311.171] (-1312.991) (-1311.916) (-1311.308) * (-1316.777) [-1310.231] (-1315.768) (-1311.831) -- 0:00:23 632500 -- (-1312.825) (-1313.024) [-1311.208] (-1311.307) * (-1312.035) (-1312.290) [-1313.128] (-1313.503) -- 0:00:23 633000 -- (-1319.347) (-1312.314) (-1313.073) [-1311.213] * (-1312.590) [-1314.620] (-1313.302) (-1312.474) -- 0:00:23 633500 -- (-1321.096) [-1309.992] (-1311.231) (-1311.263) * (-1310.626) (-1312.612) [-1310.047] (-1314.622) -- 0:00:23 634000 -- (-1318.161) (-1312.836) (-1310.891) [-1310.866] * (-1312.391) (-1310.218) (-1311.966) [-1310.689] -- 0:00:23 634500 -- (-1313.214) (-1310.712) [-1313.295] (-1311.415) * (-1312.820) [-1312.623] (-1310.903) (-1312.110) -- 0:00:23 635000 -- (-1310.610) (-1313.747) (-1313.781) [-1311.138] * (-1310.419) (-1313.549) (-1312.715) [-1312.834] -- 0:00:22 Average standard deviation of split frequencies: 0.010772 635500 -- (-1310.464) (-1311.139) [-1315.054] (-1312.852) * (-1312.686) (-1310.848) [-1312.828] (-1313.052) -- 0:00:22 636000 -- (-1309.999) (-1311.181) (-1311.039) [-1311.178] * [-1313.242] (-1311.342) (-1314.411) (-1310.870) -- 0:00:22 636500 -- (-1309.951) [-1313.387] (-1310.391) (-1311.210) * (-1314.491) [-1311.212] (-1310.371) (-1310.870) -- 0:00:22 637000 -- [-1309.825] (-1310.362) (-1312.586) (-1315.288) * (-1316.114) (-1313.599) [-1310.265] (-1310.748) -- 0:00:22 637500 -- [-1311.896] (-1313.101) (-1312.132) (-1311.364) * (-1310.244) (-1311.234) (-1311.130) [-1313.195] -- 0:00:22 638000 -- [-1311.091] (-1310.468) (-1310.328) (-1314.438) * [-1312.080] (-1311.995) (-1310.977) (-1319.012) -- 0:00:22 638500 -- (-1311.522) (-1311.362) [-1312.422] (-1314.627) * (-1316.082) (-1315.831) (-1313.129) [-1314.474] -- 0:00:23 639000 -- (-1313.032) (-1311.051) (-1311.960) [-1317.574] * (-1318.368) [-1311.757] (-1310.091) (-1315.369) -- 0:00:23 639500 -- [-1310.412] (-1311.468) (-1311.427) (-1311.097) * (-1310.010) (-1311.312) [-1312.154] (-1314.418) -- 0:00:23 640000 -- (-1310.965) [-1310.239] (-1311.269) (-1311.631) * (-1312.227) (-1311.157) [-1312.659] (-1313.694) -- 0:00:23 Average standard deviation of split frequencies: 0.010117 640500 -- [-1310.656] (-1312.949) (-1313.601) (-1313.791) * [-1311.842] (-1310.335) (-1310.835) (-1310.916) -- 0:00:23 641000 -- (-1309.727) (-1312.606) [-1312.987] (-1313.904) * (-1312.895) (-1312.358) (-1310.958) [-1311.354] -- 0:00:22 641500 -- [-1309.697] (-1312.875) (-1319.407) (-1313.634) * (-1312.468) [-1311.056] (-1313.196) (-1313.243) -- 0:00:22 642000 -- [-1310.119] (-1317.550) (-1317.678) (-1313.522) * (-1312.859) [-1314.020] (-1312.151) (-1310.221) -- 0:00:22 642500 -- (-1310.114) (-1314.306) [-1310.816] (-1313.538) * (-1310.285) [-1315.329] (-1312.408) (-1310.809) -- 0:00:22 643000 -- [-1309.677] (-1311.519) (-1310.856) (-1312.122) * (-1311.203) (-1311.532) [-1310.991] (-1313.393) -- 0:00:22 643500 -- (-1309.656) [-1309.562] (-1313.709) (-1310.955) * [-1311.245] (-1311.915) (-1310.727) (-1310.304) -- 0:00:22 644000 -- [-1310.641] (-1314.642) (-1311.592) (-1310.557) * [-1311.488] (-1311.999) (-1311.435) (-1310.261) -- 0:00:22 644500 -- (-1313.480) (-1315.906) [-1311.980] (-1310.400) * (-1310.268) [-1312.366] (-1315.586) (-1310.696) -- 0:00:22 645000 -- [-1310.952] (-1312.826) (-1312.793) (-1310.952) * (-1312.386) (-1311.781) (-1314.667) [-1310.391] -- 0:00:22 Average standard deviation of split frequencies: 0.010605 645500 -- (-1312.138) [-1311.175] (-1311.744) (-1310.724) * (-1312.020) (-1312.355) (-1312.860) [-1310.733] -- 0:00:22 646000 -- (-1313.048) (-1313.171) [-1311.778] (-1312.826) * [-1310.630] (-1317.555) (-1310.775) (-1310.708) -- 0:00:22 646500 -- (-1314.203) (-1314.738) [-1311.217] (-1313.849) * [-1309.834] (-1309.967) (-1314.590) (-1311.390) -- 0:00:22 647000 -- (-1316.886) (-1318.862) [-1310.771] (-1314.036) * (-1309.829) (-1314.101) (-1310.102) [-1312.918] -- 0:00:22 647500 -- (-1312.584) [-1312.926] (-1310.251) (-1313.179) * (-1311.791) [-1311.153] (-1310.982) (-1309.602) -- 0:00:22 648000 -- (-1317.030) [-1309.780] (-1313.757) (-1310.107) * (-1313.282) [-1314.283] (-1314.354) (-1310.259) -- 0:00:22 648500 -- [-1313.436] (-1312.523) (-1310.575) (-1310.064) * (-1311.795) [-1313.267] (-1322.328) (-1311.702) -- 0:00:22 649000 -- [-1317.250] (-1314.038) (-1310.578) (-1314.049) * [-1311.105] (-1314.785) (-1312.237) (-1315.483) -- 0:00:22 649500 -- [-1312.096] (-1311.940) (-1310.787) (-1317.606) * (-1311.419) (-1309.365) [-1310.166] (-1316.398) -- 0:00:22 650000 -- [-1311.514] (-1313.026) (-1310.506) (-1320.841) * (-1314.108) (-1312.160) (-1313.827) [-1314.005] -- 0:00:22 Average standard deviation of split frequencies: 0.010143 650500 -- (-1310.111) (-1313.505) (-1314.396) [-1315.421] * (-1310.450) (-1312.245) (-1312.251) [-1311.457] -- 0:00:22 651000 -- [-1310.010] (-1314.710) (-1314.459) (-1311.808) * [-1311.761] (-1315.805) (-1312.996) (-1311.098) -- 0:00:21 651500 -- [-1310.979] (-1311.211) (-1311.620) (-1310.524) * [-1311.398] (-1313.692) (-1315.546) (-1311.668) -- 0:00:21 652000 -- (-1313.341) (-1310.883) [-1311.282] (-1313.739) * (-1314.635) (-1317.073) (-1311.618) [-1310.514] -- 0:00:21 652500 -- [-1310.757] (-1310.461) (-1311.174) (-1310.816) * (-1311.919) [-1311.885] (-1312.188) (-1313.499) -- 0:00:21 653000 -- (-1311.076) (-1313.641) [-1309.996] (-1313.249) * [-1311.401] (-1310.462) (-1310.475) (-1314.128) -- 0:00:21 653500 -- (-1311.565) [-1310.647] (-1309.923) (-1309.935) * [-1310.684] (-1314.436) (-1310.176) (-1314.018) -- 0:00:21 654000 -- (-1310.886) (-1310.375) (-1314.678) [-1309.789] * [-1311.338] (-1311.443) (-1310.428) (-1310.160) -- 0:00:21 654500 -- [-1311.062] (-1309.969) (-1311.423) (-1309.931) * (-1318.245) [-1310.204] (-1311.025) (-1309.344) -- 0:00:22 655000 -- [-1311.166] (-1310.193) (-1311.996) (-1311.304) * [-1310.849] (-1309.988) (-1311.855) (-1310.164) -- 0:00:22 Average standard deviation of split frequencies: 0.009533 655500 -- (-1310.877) [-1309.725] (-1316.875) (-1310.822) * [-1311.852] (-1312.348) (-1310.408) (-1311.918) -- 0:00:22 656000 -- (-1313.093) (-1309.763) [-1310.292] (-1312.075) * [-1312.220] (-1311.188) (-1311.718) (-1312.840) -- 0:00:22 656500 -- [-1310.960] (-1309.818) (-1310.320) (-1312.062) * (-1312.255) [-1310.840] (-1310.386) (-1312.541) -- 0:00:21 657000 -- (-1310.457) (-1315.236) [-1310.681] (-1311.725) * (-1312.320) (-1311.323) (-1310.714) [-1312.264] -- 0:00:21 657500 -- (-1311.880) (-1311.067) (-1312.778) [-1311.438] * (-1313.862) (-1315.926) [-1312.149] (-1309.906) -- 0:00:21 658000 -- [-1311.839] (-1311.673) (-1312.457) (-1311.243) * (-1310.643) (-1315.699) (-1310.069) [-1311.336] -- 0:00:21 658500 -- (-1312.359) [-1310.642] (-1311.018) (-1310.200) * (-1310.229) (-1317.130) [-1310.304] (-1317.160) -- 0:00:21 659000 -- (-1313.067) (-1310.819) (-1314.513) [-1310.502] * (-1312.272) (-1312.406) [-1310.788] (-1310.903) -- 0:00:21 659500 -- [-1312.744] (-1310.722) (-1310.605) (-1312.289) * (-1313.722) (-1317.131) [-1312.862] (-1312.326) -- 0:00:21 660000 -- [-1310.604] (-1314.282) (-1313.404) (-1318.542) * [-1312.525] (-1316.946) (-1314.065) (-1313.391) -- 0:00:21 Average standard deviation of split frequencies: 0.009894 660500 -- [-1310.876] (-1313.555) (-1310.404) (-1313.382) * [-1311.842] (-1311.821) (-1310.473) (-1311.406) -- 0:00:21 661000 -- (-1310.790) (-1317.838) (-1310.378) [-1312.202] * [-1314.553] (-1312.366) (-1310.972) (-1311.456) -- 0:00:21 661500 -- [-1309.572] (-1312.410) (-1310.657) (-1312.402) * (-1310.499) (-1312.597) (-1313.097) [-1310.326] -- 0:00:21 662000 -- (-1311.003) [-1310.361] (-1310.400) (-1312.232) * [-1311.344] (-1313.630) (-1314.984) (-1309.789) -- 0:00:21 662500 -- (-1310.797) [-1310.704] (-1311.723) (-1311.007) * [-1311.589] (-1310.534) (-1312.131) (-1310.929) -- 0:00:21 663000 -- (-1311.127) (-1309.701) (-1312.267) [-1314.691] * (-1309.946) (-1310.353) [-1312.488] (-1311.374) -- 0:00:21 663500 -- (-1311.625) (-1309.896) [-1313.862] (-1316.549) * [-1310.796] (-1313.081) (-1310.743) (-1312.332) -- 0:00:21 664000 -- (-1312.240) (-1312.750) (-1313.167) [-1316.644] * (-1310.949) [-1313.163] (-1313.959) (-1315.196) -- 0:00:21 664500 -- (-1311.047) (-1314.224) (-1310.697) [-1311.935] * (-1310.278) (-1310.821) (-1312.615) [-1311.440] -- 0:00:21 665000 -- (-1311.781) [-1312.923] (-1311.877) (-1310.852) * (-1316.076) (-1316.714) [-1310.039] (-1311.774) -- 0:00:21 Average standard deviation of split frequencies: 0.010334 665500 -- (-1311.506) (-1312.908) [-1311.390] (-1311.175) * [-1310.992] (-1313.032) (-1310.870) (-1310.219) -- 0:00:21 666000 -- (-1313.083) [-1313.705] (-1309.993) (-1311.552) * [-1310.131] (-1311.748) (-1312.723) (-1312.623) -- 0:00:21 666500 -- [-1312.027] (-1315.397) (-1309.841) (-1315.002) * (-1310.676) [-1312.630] (-1313.063) (-1319.760) -- 0:00:21 667000 -- (-1311.247) (-1311.110) [-1309.795] (-1314.433) * (-1311.567) [-1310.483] (-1310.970) (-1311.859) -- 0:00:20 667500 -- (-1314.387) (-1313.389) [-1310.023] (-1312.429) * (-1313.282) [-1310.786] (-1312.991) (-1312.522) -- 0:00:20 668000 -- (-1313.392) (-1314.480) (-1310.515) [-1310.907] * (-1312.146) [-1310.458] (-1314.253) (-1311.380) -- 0:00:20 668500 -- [-1312.123] (-1314.358) (-1314.651) (-1312.181) * [-1313.376] (-1310.599) (-1314.201) (-1313.370) -- 0:00:20 669000 -- (-1310.687) (-1313.779) (-1311.848) [-1311.536] * [-1311.410] (-1311.759) (-1309.852) (-1311.204) -- 0:00:20 669500 -- (-1312.398) (-1313.271) (-1311.837) [-1311.940] * [-1311.393] (-1311.767) (-1311.651) (-1310.974) -- 0:00:21 670000 -- (-1310.987) (-1313.878) [-1312.321] (-1310.816) * (-1309.622) (-1312.448) [-1310.726] (-1311.527) -- 0:00:21 Average standard deviation of split frequencies: 0.010403 670500 -- (-1311.650) [-1311.392] (-1312.585) (-1310.228) * [-1309.605] (-1314.418) (-1311.451) (-1314.321) -- 0:00:21 671000 -- (-1310.332) (-1312.471) [-1313.040] (-1312.197) * [-1309.707] (-1311.439) (-1314.111) (-1310.559) -- 0:00:21 671500 -- (-1309.957) (-1315.307) [-1313.145] (-1309.485) * (-1309.499) (-1310.912) [-1315.369] (-1310.242) -- 0:00:21 672000 -- (-1312.920) [-1311.638] (-1311.674) (-1311.755) * (-1310.393) [-1314.015] (-1312.767) (-1311.127) -- 0:00:20 672500 -- [-1310.863] (-1315.979) (-1311.461) (-1311.758) * [-1309.875] (-1311.659) (-1310.010) (-1311.605) -- 0:00:20 673000 -- [-1310.988] (-1310.909) (-1311.465) (-1310.415) * [-1310.541] (-1310.363) (-1311.233) (-1313.191) -- 0:00:20 673500 -- (-1311.346) (-1310.656) (-1314.264) [-1310.897] * (-1310.806) (-1314.773) (-1311.489) [-1312.117] -- 0:00:20 674000 -- (-1310.905) (-1309.543) (-1311.407) [-1312.063] * (-1311.723) [-1314.646] (-1311.528) (-1312.018) -- 0:00:20 674500 -- (-1309.659) [-1311.366] (-1312.812) (-1312.555) * (-1312.407) (-1310.168) (-1310.715) [-1310.425] -- 0:00:20 675000 -- (-1311.121) (-1311.331) (-1313.323) [-1310.512] * [-1310.161] (-1314.184) (-1311.715) (-1313.699) -- 0:00:20 Average standard deviation of split frequencies: 0.010181 675500 -- (-1311.484) [-1311.589] (-1312.933) (-1310.040) * [-1309.977] (-1318.350) (-1311.511) (-1313.419) -- 0:00:20 676000 -- (-1311.803) (-1310.354) (-1310.806) [-1314.892] * (-1309.686) (-1310.867) [-1310.927] (-1310.913) -- 0:00:20 676500 -- (-1310.730) (-1309.833) [-1310.807] (-1312.300) * (-1309.703) [-1312.466] (-1309.759) (-1310.463) -- 0:00:20 677000 -- (-1310.897) (-1310.785) [-1310.475] (-1313.613) * [-1311.641] (-1310.843) (-1310.250) (-1315.494) -- 0:00:20 677500 -- (-1311.533) (-1314.081) (-1311.941) [-1314.088] * (-1314.269) (-1312.846) [-1310.190] (-1313.390) -- 0:00:20 678000 -- (-1310.891) (-1312.846) (-1315.365) [-1316.259] * (-1312.018) (-1311.760) [-1310.995] (-1313.254) -- 0:00:20 678500 -- (-1311.495) (-1313.250) (-1314.057) [-1309.758] * (-1309.896) [-1311.831] (-1311.096) (-1312.264) -- 0:00:20 679000 -- (-1313.107) [-1311.033] (-1314.410) (-1314.194) * (-1310.309) (-1313.189) [-1311.415] (-1310.965) -- 0:00:20 679500 -- (-1310.119) (-1311.146) (-1310.513) [-1311.533] * (-1314.290) (-1312.443) [-1310.559] (-1311.376) -- 0:00:20 680000 -- (-1310.727) (-1311.581) [-1310.031] (-1316.080) * [-1313.951] (-1313.875) (-1312.778) (-1311.600) -- 0:00:20 Average standard deviation of split frequencies: 0.009696 680500 -- (-1310.258) (-1311.804) (-1311.560) [-1312.469] * (-1315.297) (-1313.507) [-1317.507] (-1312.146) -- 0:00:20 681000 -- (-1309.958) (-1310.952) (-1314.367) [-1311.559] * (-1317.687) (-1310.694) (-1311.277) [-1312.951] -- 0:00:20 681500 -- [-1311.201] (-1315.581) (-1313.294) (-1310.411) * (-1313.970) (-1310.447) (-1312.099) [-1313.068] -- 0:00:20 682000 -- (-1315.022) [-1311.671] (-1312.262) (-1310.733) * (-1311.251) (-1312.776) [-1309.659] (-1313.514) -- 0:00:20 682500 -- [-1310.327] (-1314.582) (-1313.905) (-1311.009) * (-1315.645) [-1313.950] (-1310.845) (-1310.041) -- 0:00:20 683000 -- (-1310.049) (-1310.975) [-1312.144] (-1314.084) * [-1313.022] (-1315.241) (-1311.905) (-1309.669) -- 0:00:19 683500 -- (-1310.048) (-1312.398) (-1312.655) [-1313.336] * (-1311.748) (-1312.485) [-1311.409] (-1310.472) -- 0:00:19 684000 -- (-1312.335) (-1317.750) [-1310.219] (-1312.086) * (-1311.025) (-1312.635) [-1311.151] (-1311.712) -- 0:00:19 684500 -- [-1311.195] (-1313.928) (-1309.598) (-1312.005) * (-1313.929) [-1311.406] (-1311.257) (-1311.581) -- 0:00:19 685000 -- (-1310.597) (-1318.771) (-1309.598) [-1311.606] * (-1312.096) (-1313.368) [-1311.526] (-1311.147) -- 0:00:19 Average standard deviation of split frequencies: 0.009666 685500 -- (-1310.918) (-1312.889) [-1309.515] (-1310.336) * (-1311.403) (-1311.173) (-1311.642) [-1315.902] -- 0:00:20 686000 -- [-1311.545] (-1312.631) (-1310.222) (-1312.602) * [-1310.348] (-1310.475) (-1315.456) (-1312.448) -- 0:00:20 686500 -- (-1312.739) (-1310.454) [-1311.677] (-1310.098) * (-1310.917) [-1311.939] (-1312.608) (-1310.457) -- 0:00:20 687000 -- (-1314.811) (-1319.002) (-1315.779) [-1310.683] * [-1310.435] (-1310.357) (-1311.076) (-1311.419) -- 0:00:20 687500 -- (-1309.689) (-1310.071) (-1313.702) [-1309.917] * (-1316.172) (-1311.340) (-1310.423) [-1315.845] -- 0:00:20 688000 -- (-1311.757) (-1310.975) (-1312.202) [-1309.895] * (-1314.062) (-1311.427) (-1312.516) [-1313.767] -- 0:00:19 688500 -- [-1310.904] (-1311.370) (-1311.926) (-1310.781) * (-1315.147) (-1313.318) [-1310.997] (-1310.498) -- 0:00:19 689000 -- (-1311.422) [-1312.988] (-1310.355) (-1310.134) * (-1310.821) (-1316.294) [-1313.782] (-1312.020) -- 0:00:19 689500 -- (-1313.687) (-1311.067) [-1311.450] (-1311.518) * (-1309.789) [-1311.852] (-1311.301) (-1312.476) -- 0:00:19 690000 -- (-1311.686) [-1311.336] (-1311.695) (-1313.530) * [-1310.035] (-1312.708) (-1311.543) (-1313.883) -- 0:00:19 Average standard deviation of split frequencies: 0.010420 690500 -- [-1313.619] (-1309.859) (-1310.147) (-1312.157) * (-1310.894) (-1310.262) (-1311.055) [-1311.413] -- 0:00:19 691000 -- (-1313.690) (-1312.288) [-1309.660] (-1314.201) * [-1311.481] (-1310.596) (-1314.829) (-1314.815) -- 0:00:19 691500 -- (-1309.942) (-1312.936) (-1311.644) [-1312.086] * (-1311.957) [-1310.190] (-1313.126) (-1312.306) -- 0:00:19 692000 -- (-1311.635) (-1316.437) [-1311.601] (-1311.298) * (-1312.810) [-1313.541] (-1314.302) (-1316.249) -- 0:00:19 692500 -- (-1311.368) (-1310.953) [-1309.923] (-1310.937) * (-1315.639) (-1313.388) [-1314.714] (-1313.894) -- 0:00:19 693000 -- (-1312.479) (-1311.987) [-1313.578] (-1312.039) * [-1311.233] (-1311.355) (-1310.148) (-1310.595) -- 0:00:19 693500 -- [-1309.551] (-1309.821) (-1311.855) (-1313.447) * (-1310.931) (-1311.367) [-1312.804] (-1311.636) -- 0:00:19 694000 -- (-1312.072) (-1309.909) [-1311.872] (-1314.291) * [-1311.069] (-1315.590) (-1312.391) (-1311.547) -- 0:00:19 694500 -- (-1310.784) (-1309.771) (-1310.917) [-1314.874] * (-1311.121) (-1309.737) [-1310.485] (-1314.613) -- 0:00:19 695000 -- (-1311.205) (-1312.357) [-1311.163] (-1313.447) * [-1312.083] (-1310.454) (-1315.650) (-1310.627) -- 0:00:19 Average standard deviation of split frequencies: 0.010701 695500 -- [-1315.320] (-1310.883) (-1314.139) (-1309.678) * (-1312.810) (-1311.913) (-1313.283) [-1310.086] -- 0:00:19 696000 -- [-1312.715] (-1311.209) (-1309.760) (-1311.677) * (-1311.818) (-1314.358) (-1310.678) [-1310.622] -- 0:00:19 696500 -- [-1311.054] (-1314.948) (-1309.635) (-1312.383) * (-1312.357) [-1312.599] (-1311.046) (-1317.218) -- 0:00:19 697000 -- (-1310.809) [-1311.531] (-1310.877) (-1312.522) * (-1314.975) [-1313.477] (-1312.967) (-1315.325) -- 0:00:19 697500 -- (-1312.692) (-1310.357) [-1311.608] (-1312.122) * (-1314.727) (-1313.034) (-1313.932) [-1311.539] -- 0:00:19 698000 -- (-1315.751) [-1312.268] (-1311.349) (-1316.717) * [-1314.560] (-1311.590) (-1313.638) (-1312.407) -- 0:00:19 698500 -- (-1313.344) (-1311.339) (-1314.749) [-1311.254] * [-1310.280] (-1314.008) (-1313.640) (-1311.309) -- 0:00:18 699000 -- (-1311.067) (-1311.787) (-1312.989) [-1313.877] * [-1310.241] (-1314.608) (-1314.090) (-1314.618) -- 0:00:19 699500 -- (-1310.146) [-1315.722] (-1313.678) (-1310.592) * (-1310.746) (-1310.752) (-1313.639) [-1311.560] -- 0:00:19 700000 -- (-1313.336) (-1313.706) [-1311.020] (-1312.438) * (-1312.237) (-1315.454) (-1310.773) [-1310.161] -- 0:00:19 Average standard deviation of split frequencies: 0.010406 700500 -- (-1316.169) (-1315.765) (-1311.084) [-1311.301] * (-1310.924) [-1311.313] (-1310.308) (-1311.527) -- 0:00:19 701000 -- (-1313.117) (-1312.672) (-1312.559) [-1311.341] * (-1312.820) (-1313.758) [-1310.130] (-1314.661) -- 0:00:19 701500 -- (-1312.091) [-1309.955] (-1310.047) (-1314.666) * (-1312.825) (-1314.448) (-1311.046) [-1312.779] -- 0:00:19 702000 -- (-1312.332) [-1310.361] (-1311.904) (-1310.429) * [-1312.594] (-1310.009) (-1310.827) (-1311.214) -- 0:00:19 702500 -- (-1314.193) (-1311.817) [-1311.226] (-1311.429) * (-1313.948) (-1310.084) (-1312.898) [-1312.326] -- 0:00:19 703000 -- (-1309.674) (-1309.858) [-1312.189] (-1315.212) * (-1312.485) (-1310.540) [-1310.117] (-1312.074) -- 0:00:19 703500 -- (-1309.941) [-1309.881] (-1310.987) (-1313.651) * (-1309.702) (-1311.605) [-1310.391] (-1312.755) -- 0:00:18 704000 -- [-1312.557] (-1312.985) (-1312.256) (-1313.064) * (-1309.979) (-1311.820) (-1313.389) [-1310.729] -- 0:00:18 704500 -- (-1318.051) (-1311.752) (-1312.520) [-1310.647] * (-1310.197) [-1311.868] (-1315.161) (-1313.981) -- 0:00:18 705000 -- (-1311.200) (-1313.878) (-1309.869) [-1310.736] * (-1313.567) (-1311.711) (-1311.760) [-1310.170] -- 0:00:18 Average standard deviation of split frequencies: 0.010372 705500 -- (-1312.876) (-1312.135) [-1309.607] (-1311.913) * (-1312.536) [-1312.883] (-1312.960) (-1311.238) -- 0:00:18 706000 -- (-1311.218) (-1312.756) [-1310.069] (-1310.301) * (-1311.067) (-1311.058) (-1311.384) [-1312.793] -- 0:00:18 706500 -- [-1311.852] (-1309.432) (-1310.577) (-1311.091) * (-1310.768) (-1312.755) [-1310.959] (-1313.904) -- 0:00:18 707000 -- (-1314.582) (-1311.944) (-1312.386) [-1312.704] * [-1314.388] (-1312.868) (-1310.800) (-1309.921) -- 0:00:18 707500 -- [-1310.970] (-1312.296) (-1312.117) (-1310.269) * (-1310.161) [-1310.806] (-1315.632) (-1313.792) -- 0:00:18 708000 -- (-1311.546) (-1312.668) [-1311.068] (-1312.094) * (-1310.963) [-1310.725] (-1314.160) (-1312.115) -- 0:00:18 708500 -- (-1311.039) [-1310.996] (-1312.502) (-1313.295) * (-1311.914) (-1309.697) (-1313.221) [-1311.375] -- 0:00:18 709000 -- (-1310.705) (-1311.777) (-1310.943) [-1312.420] * (-1310.246) [-1310.465] (-1311.636) (-1311.607) -- 0:00:18 709500 -- (-1310.899) (-1313.744) (-1309.570) [-1311.360] * [-1311.840] (-1312.517) (-1314.316) (-1312.966) -- 0:00:18 710000 -- (-1314.067) [-1311.506] (-1312.441) (-1312.654) * (-1313.251) [-1313.815] (-1311.245) (-1314.553) -- 0:00:18 Average standard deviation of split frequencies: 0.010746 710500 -- (-1313.353) [-1313.820] (-1313.273) (-1310.547) * [-1313.087] (-1312.466) (-1312.449) (-1315.062) -- 0:00:18 711000 -- (-1317.682) (-1316.003) (-1314.842) [-1313.656] * (-1309.749) (-1310.939) [-1312.229] (-1312.122) -- 0:00:18 711500 -- (-1311.841) (-1311.940) (-1312.363) [-1311.033] * (-1309.980) (-1311.432) [-1310.139] (-1311.776) -- 0:00:18 712000 -- [-1311.814] (-1310.499) (-1311.771) (-1312.093) * (-1310.852) (-1313.406) [-1311.384] (-1312.984) -- 0:00:18 712500 -- (-1313.686) (-1312.005) (-1317.556) [-1315.639] * [-1310.373] (-1313.470) (-1311.322) (-1312.849) -- 0:00:18 713000 -- (-1311.336) [-1310.497] (-1313.082) (-1313.425) * [-1311.687] (-1311.812) (-1311.091) (-1311.510) -- 0:00:18 713500 -- (-1311.611) (-1318.050) (-1311.542) [-1311.354] * [-1311.645] (-1312.636) (-1310.378) (-1312.172) -- 0:00:18 714000 -- (-1310.294) [-1315.272] (-1310.412) (-1311.760) * (-1310.883) [-1310.666] (-1314.785) (-1310.458) -- 0:00:18 714500 -- [-1314.365] (-1311.896) (-1312.227) (-1315.709) * (-1311.703) [-1313.682] (-1314.990) (-1314.692) -- 0:00:18 715000 -- [-1315.103] (-1313.348) (-1312.275) (-1312.169) * (-1311.835) [-1311.797] (-1311.573) (-1310.599) -- 0:00:18 Average standard deviation of split frequencies: 0.010490 715500 -- (-1311.077) (-1311.518) [-1315.942] (-1310.374) * (-1311.980) [-1312.612] (-1311.568) (-1310.469) -- 0:00:18 716000 -- [-1310.750] (-1312.835) (-1312.850) (-1310.087) * (-1313.416) (-1310.414) (-1313.132) [-1309.359] -- 0:00:18 716500 -- (-1312.009) (-1314.132) (-1311.766) [-1310.972] * (-1314.303) [-1311.776] (-1313.021) (-1309.445) -- 0:00:18 717000 -- (-1313.538) (-1312.420) (-1313.515) [-1310.988] * (-1316.515) (-1309.917) [-1310.646] (-1312.216) -- 0:00:18 717500 -- [-1311.846] (-1315.707) (-1312.419) (-1315.767) * (-1311.388) [-1314.330] (-1310.253) (-1310.669) -- 0:00:18 718000 -- [-1310.433] (-1313.604) (-1312.057) (-1313.012) * [-1311.706] (-1310.926) (-1311.856) (-1311.249) -- 0:00:18 718500 -- (-1310.552) (-1314.287) (-1311.276) [-1311.236] * (-1311.166) (-1310.926) (-1310.737) [-1314.587] -- 0:00:18 719000 -- [-1310.508] (-1312.086) (-1310.589) (-1313.012) * (-1314.295) (-1313.193) [-1310.407] (-1312.301) -- 0:00:17 719500 -- (-1310.037) (-1309.890) (-1310.592) [-1310.372] * (-1312.905) (-1309.556) [-1312.087] (-1312.499) -- 0:00:17 720000 -- (-1310.361) [-1310.699] (-1311.690) (-1310.191) * (-1320.685) (-1309.616) [-1314.255] (-1310.851) -- 0:00:17 Average standard deviation of split frequencies: 0.010292 720500 -- (-1311.394) (-1314.755) (-1312.036) [-1311.543] * [-1310.076] (-1310.126) (-1311.437) (-1314.136) -- 0:00:17 721000 -- (-1312.512) (-1310.557) [-1310.065] (-1311.912) * (-1323.872) (-1311.243) [-1310.522] (-1316.352) -- 0:00:17 721500 -- (-1313.848) [-1309.993] (-1313.083) (-1313.241) * (-1312.300) (-1309.536) [-1311.642] (-1312.151) -- 0:00:17 722000 -- (-1310.479) (-1313.298) [-1312.563] (-1311.095) * (-1312.752) (-1316.286) [-1311.351] (-1310.625) -- 0:00:17 722500 -- [-1312.052] (-1315.504) (-1314.078) (-1311.916) * (-1312.277) (-1312.760) (-1310.127) [-1314.159] -- 0:00:17 723000 -- [-1311.200] (-1310.661) (-1315.923) (-1312.285) * [-1314.769] (-1312.181) (-1310.777) (-1312.116) -- 0:00:17 723500 -- (-1310.085) (-1309.695) [-1312.778] (-1312.152) * [-1311.739] (-1315.116) (-1311.659) (-1310.664) -- 0:00:17 724000 -- (-1311.505) (-1311.813) [-1312.319] (-1310.030) * (-1310.101) [-1311.252] (-1310.587) (-1315.081) -- 0:00:17 724500 -- (-1310.832) (-1316.935) [-1312.488] (-1311.829) * [-1311.498] (-1312.880) (-1315.582) (-1311.967) -- 0:00:17 725000 -- (-1310.754) (-1310.331) (-1311.485) [-1312.505] * (-1311.025) (-1312.089) (-1310.690) [-1311.282] -- 0:00:17 Average standard deviation of split frequencies: 0.009870 725500 -- (-1311.717) (-1311.225) [-1311.467] (-1315.734) * (-1311.173) (-1312.275) [-1312.174] (-1309.701) -- 0:00:17 726000 -- [-1311.014] (-1311.074) (-1313.291) (-1311.131) * [-1312.797] (-1311.622) (-1311.999) (-1312.390) -- 0:00:17 726500 -- (-1311.302) (-1313.782) (-1313.687) [-1311.897] * (-1319.482) [-1310.603] (-1310.926) (-1309.827) -- 0:00:17 727000 -- (-1310.531) [-1313.106] (-1313.301) (-1311.588) * (-1309.758) [-1313.513] (-1310.681) (-1310.046) -- 0:00:17 727500 -- (-1310.723) [-1314.890] (-1313.655) (-1311.573) * (-1310.897) (-1315.859) [-1311.103] (-1310.420) -- 0:00:17 728000 -- (-1311.830) [-1311.653] (-1315.203) (-1310.316) * (-1313.220) [-1317.265] (-1311.058) (-1313.040) -- 0:00:17 728500 -- (-1315.546) [-1311.854] (-1318.137) (-1318.864) * [-1311.607] (-1313.339) (-1310.659) (-1313.462) -- 0:00:17 729000 -- [-1313.156] (-1311.206) (-1316.982) (-1316.779) * (-1311.077) (-1312.712) [-1311.811] (-1316.163) -- 0:00:17 729500 -- [-1312.882] (-1310.379) (-1314.892) (-1315.909) * (-1311.460) (-1313.702) [-1310.512] (-1313.588) -- 0:00:17 730000 -- (-1314.135) (-1312.084) (-1309.567) [-1312.463] * (-1311.543) [-1314.218] (-1311.495) (-1316.643) -- 0:00:17 Average standard deviation of split frequencies: 0.009678 730500 -- (-1312.070) (-1314.531) (-1309.836) [-1310.570] * (-1311.429) (-1311.051) (-1310.673) [-1310.654] -- 0:00:17 731000 -- (-1314.263) (-1311.615) [-1311.369] (-1311.791) * (-1310.736) [-1311.737] (-1310.961) (-1311.279) -- 0:00:17 731500 -- (-1313.177) [-1310.069] (-1310.849) (-1311.565) * [-1310.091] (-1311.365) (-1311.182) (-1310.444) -- 0:00:17 732000 -- (-1314.416) (-1312.391) [-1314.072] (-1312.792) * [-1311.974] (-1311.229) (-1311.259) (-1311.652) -- 0:00:17 732500 -- (-1311.451) (-1314.972) [-1313.601] (-1311.515) * (-1311.760) (-1310.762) [-1311.339] (-1312.108) -- 0:00:17 733000 -- [-1313.404] (-1313.861) (-1312.976) (-1310.492) * [-1309.963] (-1311.000) (-1311.773) (-1310.525) -- 0:00:17 733500 -- (-1315.465) [-1313.147] (-1311.187) (-1314.096) * (-1310.944) (-1317.950) (-1309.666) [-1310.461] -- 0:00:17 734000 -- [-1313.253] (-1314.718) (-1309.760) (-1312.544) * (-1317.155) [-1313.058] (-1310.476) (-1313.319) -- 0:00:17 734500 -- (-1314.813) [-1313.289] (-1311.910) (-1317.467) * (-1316.532) (-1313.462) [-1310.425] (-1314.047) -- 0:00:16 735000 -- (-1311.303) (-1315.052) [-1310.328] (-1313.160) * (-1314.406) (-1314.764) (-1312.144) [-1311.364] -- 0:00:16 Average standard deviation of split frequencies: 0.009906 735500 -- (-1311.485) (-1321.840) [-1310.450] (-1316.874) * (-1311.611) [-1312.903] (-1310.185) (-1311.060) -- 0:00:16 736000 -- [-1311.919] (-1309.677) (-1310.967) (-1324.102) * (-1312.138) (-1311.209) (-1311.596) [-1311.204] -- 0:00:16 736500 -- (-1313.227) (-1311.736) (-1311.875) [-1311.654] * (-1310.693) (-1310.899) [-1312.601] (-1311.296) -- 0:00:16 737000 -- (-1311.036) (-1315.723) [-1311.927] (-1311.234) * (-1312.877) (-1316.809) (-1310.253) [-1312.639] -- 0:00:16 737500 -- (-1310.926) (-1310.433) [-1309.832] (-1313.234) * (-1314.367) (-1312.775) [-1311.238] (-1311.766) -- 0:00:16 738000 -- (-1313.628) (-1310.645) [-1310.881] (-1310.441) * (-1315.633) (-1312.807) [-1310.235] (-1313.479) -- 0:00:16 738500 -- (-1315.239) (-1310.014) [-1311.073] (-1312.588) * (-1318.621) (-1313.252) [-1310.387] (-1310.670) -- 0:00:16 739000 -- (-1310.527) (-1310.816) (-1314.935) [-1314.484] * (-1314.788) (-1312.261) [-1311.035] (-1315.076) -- 0:00:16 739500 -- (-1311.200) [-1310.957] (-1314.706) (-1311.691) * (-1315.189) [-1310.222] (-1310.274) (-1315.049) -- 0:00:16 740000 -- [-1311.058] (-1310.267) (-1313.748) (-1315.413) * [-1314.625] (-1310.288) (-1314.239) (-1311.222) -- 0:00:16 Average standard deviation of split frequencies: 0.009674 740500 -- (-1310.511) (-1313.808) [-1312.390] (-1314.212) * (-1312.744) [-1311.633] (-1311.000) (-1311.919) -- 0:00:16 741000 -- (-1311.522) [-1312.581] (-1311.638) (-1310.397) * (-1310.525) [-1313.859] (-1314.548) (-1311.898) -- 0:00:16 741500 -- (-1312.808) [-1312.854] (-1310.673) (-1313.085) * [-1312.353] (-1311.757) (-1310.607) (-1311.432) -- 0:00:16 742000 -- (-1314.169) [-1310.605] (-1310.330) (-1314.130) * (-1313.358) [-1310.679] (-1313.003) (-1311.422) -- 0:00:16 742500 -- (-1314.047) [-1309.910] (-1311.706) (-1309.911) * [-1309.915] (-1312.272) (-1312.077) (-1310.010) -- 0:00:16 743000 -- (-1315.194) (-1310.427) (-1310.242) [-1310.409] * (-1309.761) (-1309.873) [-1310.945] (-1312.582) -- 0:00:16 743500 -- [-1311.130] (-1310.464) (-1311.934) (-1310.269) * (-1311.184) (-1310.567) [-1312.196] (-1311.953) -- 0:00:16 744000 -- [-1309.504] (-1315.105) (-1312.695) (-1312.605) * [-1313.092] (-1313.796) (-1310.484) (-1310.567) -- 0:00:16 744500 -- (-1311.738) (-1310.752) [-1313.711] (-1312.366) * (-1315.014) [-1311.401] (-1312.208) (-1310.796) -- 0:00:16 745000 -- [-1311.570] (-1311.386) (-1312.305) (-1316.496) * (-1311.999) (-1312.937) (-1311.877) [-1310.775] -- 0:00:16 Average standard deviation of split frequencies: 0.008973 745500 -- [-1311.862] (-1311.612) (-1313.789) (-1316.470) * (-1311.712) (-1313.614) [-1314.217] (-1314.316) -- 0:00:16 746000 -- (-1310.656) [-1310.517] (-1310.397) (-1313.753) * (-1311.187) (-1311.792) (-1310.526) [-1317.875] -- 0:00:16 746500 -- (-1310.611) [-1311.077] (-1309.663) (-1311.908) * (-1310.878) [-1310.635] (-1315.156) (-1310.866) -- 0:00:16 747000 -- (-1312.339) (-1310.806) (-1311.235) [-1312.248] * (-1309.814) (-1311.457) [-1312.284] (-1315.127) -- 0:00:16 747500 -- (-1314.643) (-1311.824) (-1312.340) [-1315.373] * (-1310.712) (-1313.460) (-1312.401) [-1311.420] -- 0:00:16 748000 -- (-1312.579) [-1311.702] (-1314.188) (-1313.462) * [-1311.994] (-1314.372) (-1312.259) (-1312.124) -- 0:00:16 748500 -- (-1312.766) (-1310.468) (-1311.147) [-1312.360] * (-1311.875) (-1311.425) [-1311.782] (-1321.221) -- 0:00:16 749000 -- (-1311.693) [-1311.335] (-1313.733) (-1311.160) * [-1310.184] (-1316.029) (-1310.137) (-1319.864) -- 0:00:16 749500 -- (-1310.918) [-1314.759] (-1320.224) (-1311.339) * [-1313.756] (-1312.534) (-1309.538) (-1316.915) -- 0:00:16 750000 -- (-1314.170) (-1313.319) [-1313.042] (-1309.977) * [-1311.644] (-1317.139) (-1311.304) (-1312.425) -- 0:00:16 Average standard deviation of split frequencies: 0.008708 750500 -- (-1313.510) (-1311.661) (-1310.767) [-1309.638] * (-1312.081) (-1311.219) [-1310.786] (-1313.996) -- 0:00:15 751000 -- (-1311.972) (-1309.622) [-1312.713] (-1309.635) * (-1309.336) (-1310.693) [-1310.166] (-1312.133) -- 0:00:15 751500 -- (-1313.064) [-1314.940] (-1313.945) (-1310.799) * (-1311.431) [-1311.891] (-1313.234) (-1315.491) -- 0:00:15 752000 -- (-1314.209) (-1312.249) [-1311.227] (-1312.969) * (-1310.261) (-1310.916) [-1311.052] (-1312.852) -- 0:00:15 752500 -- (-1312.512) (-1310.536) [-1311.145] (-1313.140) * (-1313.563) (-1316.206) (-1314.110) [-1310.670] -- 0:00:15 753000 -- (-1314.049) (-1311.198) [-1309.965] (-1310.539) * (-1316.553) [-1310.893] (-1311.836) (-1312.636) -- 0:00:15 753500 -- (-1314.146) (-1309.953) (-1318.825) [-1312.896] * [-1311.593] (-1315.435) (-1311.886) (-1309.991) -- 0:00:15 754000 -- (-1315.426) (-1314.370) (-1311.095) [-1311.282] * (-1311.015) (-1312.586) (-1312.210) [-1310.731] -- 0:00:15 754500 -- (-1312.200) (-1312.152) [-1311.798] (-1310.578) * (-1313.379) (-1311.089) [-1311.434] (-1310.500) -- 0:00:15 755000 -- (-1312.296) (-1311.558) [-1310.696] (-1310.366) * [-1312.010] (-1311.146) (-1312.046) (-1312.077) -- 0:00:15 Average standard deviation of split frequencies: 0.009187 755500 -- [-1314.604] (-1309.798) (-1310.467) (-1310.618) * [-1310.774] (-1311.319) (-1311.815) (-1310.314) -- 0:00:15 756000 -- (-1314.709) [-1310.604] (-1313.870) (-1312.778) * [-1311.737] (-1311.685) (-1313.928) (-1309.654) -- 0:00:15 756500 -- (-1313.200) (-1311.050) (-1310.555) [-1315.038] * [-1309.768] (-1311.494) (-1310.264) (-1309.711) -- 0:00:15 757000 -- [-1310.731] (-1310.354) (-1312.913) (-1312.814) * (-1309.572) (-1315.214) (-1313.951) [-1310.377] -- 0:00:15 757500 -- (-1310.633) (-1311.406) [-1311.784] (-1312.282) * (-1309.789) (-1313.588) [-1313.031] (-1310.526) -- 0:00:15 758000 -- (-1310.857) (-1312.523) [-1310.800] (-1314.925) * (-1311.233) (-1315.077) (-1313.819) [-1311.131] -- 0:00:15 758500 -- (-1312.177) [-1310.374] (-1311.561) (-1315.414) * (-1314.481) (-1314.481) [-1312.330] (-1316.010) -- 0:00:15 759000 -- [-1313.944] (-1317.094) (-1314.945) (-1313.520) * (-1311.315) (-1311.714) [-1310.305] (-1318.052) -- 0:00:15 759500 -- [-1315.752] (-1312.551) (-1312.086) (-1313.198) * (-1311.414) [-1311.112] (-1309.815) (-1314.456) -- 0:00:15 760000 -- [-1315.754] (-1312.587) (-1312.364) (-1311.054) * (-1312.628) (-1310.163) [-1310.215] (-1313.912) -- 0:00:15 Average standard deviation of split frequencies: 0.008965 760500 -- (-1315.411) [-1311.072] (-1311.532) (-1310.517) * (-1313.595) (-1313.795) (-1310.832) [-1311.061] -- 0:00:15 761000 -- (-1315.976) (-1312.448) (-1310.720) [-1312.954] * (-1310.145) (-1310.005) (-1310.046) [-1312.637] -- 0:00:15 761500 -- (-1312.336) (-1312.107) [-1310.751] (-1313.814) * [-1312.418] (-1312.033) (-1310.079) (-1310.580) -- 0:00:15 762000 -- [-1311.298] (-1315.182) (-1311.825) (-1312.859) * (-1312.466) (-1313.205) (-1313.024) [-1311.983] -- 0:00:15 762500 -- [-1310.888] (-1315.880) (-1311.416) (-1311.380) * (-1310.324) (-1313.141) [-1310.129] (-1312.421) -- 0:00:15 763000 -- (-1314.542) [-1312.944] (-1311.711) (-1311.185) * (-1310.334) (-1310.629) (-1309.997) [-1311.251] -- 0:00:15 763500 -- (-1312.090) (-1312.769) (-1311.836) [-1311.528] * [-1309.758] (-1309.610) (-1313.295) (-1312.357) -- 0:00:15 764000 -- (-1316.603) [-1312.675] (-1312.238) (-1312.761) * (-1311.271) (-1309.690) [-1310.819] (-1312.258) -- 0:00:15 764500 -- [-1311.542] (-1312.588) (-1310.307) (-1310.856) * (-1310.404) (-1312.683) (-1310.714) [-1312.628] -- 0:00:15 765000 -- (-1314.033) (-1310.813) [-1310.867] (-1309.672) * (-1311.754) [-1311.839] (-1310.435) (-1312.791) -- 0:00:15 Average standard deviation of split frequencies: 0.008821 765500 -- [-1312.808] (-1310.558) (-1310.692) (-1310.848) * (-1310.208) [-1309.982] (-1311.996) (-1313.238) -- 0:00:15 766000 -- [-1310.846] (-1310.548) (-1313.166) (-1310.164) * (-1310.078) (-1309.851) [-1311.418] (-1311.286) -- 0:00:14 766500 -- [-1310.702] (-1311.407) (-1312.074) (-1310.209) * (-1311.926) [-1310.161] (-1310.030) (-1311.256) -- 0:00:14 767000 -- (-1310.940) [-1310.272] (-1310.130) (-1311.240) * (-1314.163) (-1310.758) (-1312.046) [-1312.485] -- 0:00:14 767500 -- (-1310.438) [-1310.718] (-1309.975) (-1312.035) * (-1310.480) (-1312.453) (-1313.982) [-1310.973] -- 0:00:14 768000 -- (-1311.720) [-1311.932] (-1312.152) (-1312.514) * (-1311.114) (-1313.408) (-1313.383) [-1310.538] -- 0:00:14 768500 -- (-1315.346) (-1312.024) (-1311.962) [-1314.120] * (-1310.874) [-1311.838] (-1313.063) (-1310.540) -- 0:00:14 769000 -- (-1312.137) (-1310.158) (-1312.839) [-1310.625] * (-1311.493) (-1311.311) (-1310.829) [-1314.253] -- 0:00:14 769500 -- [-1311.136] (-1311.901) (-1312.440) (-1310.065) * (-1311.764) [-1316.526] (-1310.718) (-1311.985) -- 0:00:14 770000 -- (-1310.209) [-1314.304] (-1311.056) (-1310.492) * (-1311.584) (-1318.718) [-1310.773] (-1312.152) -- 0:00:14 Average standard deviation of split frequencies: 0.009012 770500 -- (-1310.270) [-1310.860] (-1311.709) (-1311.536) * (-1311.087) (-1316.818) [-1312.819] (-1310.139) -- 0:00:14 771000 -- (-1311.738) (-1311.024) (-1312.583) [-1315.676] * [-1311.450] (-1310.889) (-1312.829) (-1311.730) -- 0:00:14 771500 -- (-1315.597) [-1310.163] (-1313.002) (-1312.716) * (-1312.367) [-1312.129] (-1312.426) (-1311.103) -- 0:00:14 772000 -- (-1313.587) [-1310.007] (-1310.719) (-1314.734) * (-1312.404) (-1311.144) [-1310.270] (-1312.885) -- 0:00:14 772500 -- [-1310.155] (-1310.130) (-1311.532) (-1311.763) * [-1311.326] (-1311.531) (-1312.068) (-1311.554) -- 0:00:14 773000 -- [-1310.717] (-1309.817) (-1310.924) (-1311.302) * (-1312.004) (-1311.094) (-1311.880) [-1311.008] -- 0:00:14 773500 -- (-1310.584) [-1310.128] (-1315.833) (-1311.104) * (-1314.601) (-1310.376) (-1310.108) [-1311.417] -- 0:00:14 774000 -- (-1310.260) (-1310.128) (-1312.990) [-1312.484] * [-1316.382] (-1312.590) (-1311.202) (-1312.612) -- 0:00:14 774500 -- (-1311.511) (-1315.598) [-1312.086] (-1313.073) * (-1314.534) [-1309.902] (-1317.401) (-1315.203) -- 0:00:14 775000 -- (-1311.663) [-1314.685] (-1310.895) (-1312.751) * (-1314.546) (-1314.747) [-1312.174] (-1312.755) -- 0:00:14 Average standard deviation of split frequencies: 0.009153 775500 -- (-1311.703) [-1315.033] (-1310.652) (-1312.827) * (-1312.133) [-1311.923] (-1312.476) (-1312.213) -- 0:00:14 776000 -- (-1315.466) (-1312.389) [-1311.027] (-1310.334) * (-1311.845) [-1311.839] (-1312.142) (-1315.755) -- 0:00:14 776500 -- (-1311.595) (-1311.926) [-1310.981] (-1311.008) * (-1310.824) (-1311.041) [-1312.240] (-1323.658) -- 0:00:14 777000 -- [-1312.865] (-1311.792) (-1310.759) (-1314.001) * (-1310.306) [-1314.329] (-1309.872) (-1311.148) -- 0:00:14 777500 -- (-1314.022) [-1322.282] (-1313.788) (-1312.220) * (-1311.806) [-1310.728] (-1311.931) (-1314.775) -- 0:00:14 778000 -- (-1310.230) (-1314.852) [-1313.804] (-1315.811) * (-1311.415) [-1317.407] (-1309.684) (-1310.098) -- 0:00:14 778500 -- (-1312.541) [-1313.405] (-1312.126) (-1312.401) * (-1311.577) [-1314.513] (-1309.684) (-1310.298) -- 0:00:14 779000 -- [-1312.969] (-1312.234) (-1312.913) (-1312.622) * [-1312.565] (-1311.108) (-1312.187) (-1314.319) -- 0:00:14 779500 -- (-1312.738) (-1311.828) (-1316.808) [-1310.718] * (-1311.071) (-1315.590) [-1311.723] (-1315.777) -- 0:00:14 780000 -- [-1311.232] (-1314.479) (-1313.196) (-1310.656) * (-1310.966) (-1312.830) [-1312.850] (-1314.839) -- 0:00:14 Average standard deviation of split frequencies: 0.008937 780500 -- (-1313.332) [-1309.862] (-1313.144) (-1312.876) * (-1311.231) (-1310.806) (-1314.169) [-1311.722] -- 0:00:14 781000 -- [-1314.474] (-1314.402) (-1311.117) (-1310.264) * (-1312.171) [-1310.902] (-1311.460) (-1309.755) -- 0:00:14 781500 -- (-1315.185) (-1310.894) (-1313.300) [-1310.861] * (-1312.193) (-1311.088) [-1312.212] (-1309.755) -- 0:00:13 782000 -- (-1311.063) (-1312.280) [-1312.215] (-1312.831) * (-1311.638) (-1313.041) (-1310.160) [-1312.920] -- 0:00:13 782500 -- (-1311.327) (-1313.840) (-1311.926) [-1311.677] * (-1310.562) (-1311.511) (-1310.534) [-1310.852] -- 0:00:13 783000 -- (-1313.914) (-1313.457) (-1314.228) [-1311.197] * [-1310.676] (-1310.542) (-1310.411) (-1311.606) -- 0:00:13 783500 -- [-1316.890] (-1316.676) (-1310.283) (-1313.787) * (-1309.894) [-1310.978] (-1314.274) (-1311.902) -- 0:00:13 784000 -- (-1313.658) (-1317.106) [-1311.806] (-1312.044) * [-1309.938] (-1311.284) (-1312.485) (-1311.724) -- 0:00:13 784500 -- (-1312.669) (-1316.292) [-1312.829] (-1310.395) * (-1311.653) [-1315.079] (-1312.280) (-1312.173) -- 0:00:13 785000 -- (-1311.441) [-1311.195] (-1313.718) (-1310.392) * (-1310.647) (-1312.883) [-1313.101] (-1312.175) -- 0:00:13 Average standard deviation of split frequencies: 0.008996 785500 -- (-1312.269) (-1311.511) (-1315.566) [-1311.194] * [-1311.038] (-1310.288) (-1312.145) (-1315.412) -- 0:00:13 786000 -- (-1312.245) (-1310.832) (-1312.103) [-1310.450] * (-1311.042) (-1312.772) [-1311.451] (-1311.530) -- 0:00:13 786500 -- (-1312.214) [-1311.136] (-1313.840) (-1309.390) * (-1311.119) (-1315.591) (-1312.344) [-1311.185] -- 0:00:13 787000 -- (-1310.912) (-1311.238) [-1310.611] (-1313.132) * (-1315.854) [-1314.667] (-1315.864) (-1311.272) -- 0:00:13 787500 -- (-1310.251) [-1310.509] (-1311.527) (-1313.833) * (-1317.406) [-1315.374] (-1313.262) (-1309.871) -- 0:00:13 788000 -- (-1309.901) [-1309.472] (-1311.933) (-1310.750) * (-1316.316) (-1310.187) (-1314.103) [-1310.417] -- 0:00:13 788500 -- [-1309.577] (-1309.858) (-1311.775) (-1309.982) * (-1316.562) (-1316.472) (-1313.283) [-1309.968] -- 0:00:13 789000 -- [-1310.014] (-1311.938) (-1315.248) (-1312.181) * (-1315.676) [-1312.455] (-1314.366) (-1310.364) -- 0:00:13 789500 -- (-1310.377) (-1309.838) (-1314.969) [-1312.582] * (-1315.832) (-1310.969) (-1323.862) [-1312.413] -- 0:00:13 790000 -- (-1312.037) (-1309.842) [-1314.620] (-1310.342) * (-1310.549) [-1311.278] (-1315.228) (-1311.071) -- 0:00:13 Average standard deviation of split frequencies: 0.008943 790500 -- (-1317.281) (-1311.409) (-1311.798) [-1310.305] * (-1317.246) (-1310.597) [-1310.972] (-1313.968) -- 0:00:13 791000 -- (-1315.539) (-1310.523) [-1312.107] (-1311.403) * (-1311.427) [-1310.707] (-1310.192) (-1316.444) -- 0:00:13 791500 -- (-1311.204) [-1310.881] (-1311.958) (-1311.141) * (-1313.215) (-1311.873) [-1313.490] (-1310.566) -- 0:00:13 792000 -- (-1309.648) [-1311.475] (-1310.703) (-1312.804) * (-1315.828) (-1313.711) [-1312.248] (-1310.883) -- 0:00:13 792500 -- [-1311.213] (-1311.983) (-1311.214) (-1311.921) * (-1313.910) [-1310.742] (-1309.773) (-1311.787) -- 0:00:13 793000 -- (-1310.258) [-1311.824] (-1309.940) (-1314.342) * (-1313.857) [-1310.782] (-1311.514) (-1312.939) -- 0:00:13 793500 -- (-1309.975) (-1313.607) (-1316.022) [-1315.070] * (-1310.908) (-1311.203) [-1310.988] (-1314.776) -- 0:00:13 794000 -- [-1310.643] (-1314.058) (-1311.474) (-1311.343) * (-1311.079) [-1310.650] (-1314.351) (-1311.515) -- 0:00:13 794500 -- (-1310.592) (-1313.774) [-1312.848] (-1310.865) * [-1312.176] (-1311.003) (-1310.652) (-1314.300) -- 0:00:13 795000 -- [-1312.130] (-1312.832) (-1313.631) (-1311.371) * [-1310.738] (-1311.393) (-1310.609) (-1310.513) -- 0:00:13 Average standard deviation of split frequencies: 0.008513 795500 -- (-1311.095) (-1312.451) (-1312.690) [-1311.865] * (-1311.402) (-1311.429) [-1310.069] (-1312.468) -- 0:00:13 796000 -- (-1312.292) (-1315.222) [-1313.427] (-1310.673) * (-1313.734) [-1310.881] (-1310.830) (-1317.714) -- 0:00:13 796500 -- [-1311.957] (-1310.084) (-1311.065) (-1313.777) * (-1311.489) (-1312.100) [-1311.017] (-1311.852) -- 0:00:13 797000 -- (-1311.581) [-1310.276] (-1311.056) (-1312.917) * (-1310.545) (-1312.028) (-1311.858) [-1311.952] -- 0:00:12 797500 -- (-1309.559) (-1310.277) (-1312.092) [-1310.664] * (-1311.064) [-1316.608] (-1312.191) (-1315.768) -- 0:00:12 798000 -- (-1311.668) (-1310.282) (-1313.647) [-1311.434] * (-1311.254) (-1314.231) [-1311.963] (-1313.671) -- 0:00:12 798500 -- (-1310.630) [-1311.199] (-1313.530) (-1316.241) * (-1313.139) (-1310.188) (-1311.315) [-1312.335] -- 0:00:12 799000 -- [-1310.002] (-1314.864) (-1312.059) (-1311.172) * (-1311.250) [-1311.871] (-1311.796) (-1312.468) -- 0:00:12 799500 -- (-1310.341) (-1312.891) (-1313.235) [-1312.219] * [-1311.954] (-1310.428) (-1311.387) (-1310.140) -- 0:00:12 800000 -- (-1313.817) (-1310.876) (-1311.911) [-1313.646] * [-1311.458] (-1309.715) (-1315.780) (-1314.119) -- 0:00:12 Average standard deviation of split frequencies: 0.008647 800500 -- (-1310.764) [-1309.791] (-1310.742) (-1312.011) * (-1310.819) [-1312.217] (-1310.433) (-1313.269) -- 0:00:12 801000 -- [-1310.769] (-1309.775) (-1310.742) (-1311.319) * (-1310.860) (-1314.518) [-1312.948] (-1309.950) -- 0:00:12 801500 -- (-1310.594) (-1310.530) (-1310.274) [-1310.570] * [-1311.734] (-1309.597) (-1311.781) (-1310.217) -- 0:00:12 802000 -- (-1314.129) (-1310.726) [-1311.392] (-1310.639) * (-1312.677) (-1310.255) [-1313.584] (-1312.101) -- 0:00:12 802500 -- (-1315.873) (-1313.213) [-1309.846] (-1310.528) * (-1312.937) (-1310.731) [-1314.489] (-1314.699) -- 0:00:12 803000 -- (-1312.427) (-1312.080) (-1310.151) [-1312.238] * (-1309.916) (-1311.036) (-1312.972) [-1312.435] -- 0:00:12 803500 -- (-1311.148) (-1313.536) [-1312.786] (-1311.658) * (-1312.204) (-1311.484) [-1311.164] (-1310.353) -- 0:00:12 804000 -- (-1311.194) [-1311.219] (-1310.640) (-1312.775) * (-1311.843) (-1311.041) [-1309.880] (-1311.198) -- 0:00:12 804500 -- (-1310.304) [-1311.205] (-1310.924) (-1312.750) * (-1311.384) (-1316.074) (-1311.826) [-1310.903] -- 0:00:12 805000 -- (-1312.770) (-1317.082) [-1310.044] (-1313.303) * (-1310.231) (-1311.333) (-1309.957) [-1310.009] -- 0:00:12 Average standard deviation of split frequencies: 0.009175 805500 -- (-1314.500) [-1310.012] (-1311.498) (-1310.916) * (-1310.402) (-1311.959) [-1311.515] (-1311.011) -- 0:00:12 806000 -- (-1311.108) (-1310.757) (-1312.049) [-1310.195] * (-1312.499) (-1312.057) [-1310.970] (-1311.252) -- 0:00:12 806500 -- (-1310.690) (-1311.920) [-1311.357] (-1310.746) * [-1310.522] (-1314.283) (-1311.665) (-1314.077) -- 0:00:12 807000 -- (-1313.823) (-1312.375) (-1309.934) [-1311.229] * (-1310.015) (-1314.590) (-1311.985) [-1312.078] -- 0:00:12 807500 -- [-1311.336] (-1312.330) (-1310.728) (-1312.000) * (-1310.157) (-1314.033) (-1313.393) [-1310.910] -- 0:00:12 808000 -- (-1310.035) (-1311.231) [-1313.371] (-1310.648) * [-1309.497] (-1313.010) (-1310.142) (-1312.893) -- 0:00:12 808500 -- (-1312.093) [-1311.478] (-1310.998) (-1311.039) * (-1312.069) [-1313.132] (-1315.380) (-1310.814) -- 0:00:12 809000 -- [-1310.550] (-1313.968) (-1311.350) (-1311.681) * (-1313.776) [-1315.329] (-1315.232) (-1312.987) -- 0:00:12 809500 -- (-1309.619) (-1310.207) (-1311.800) [-1310.550] * (-1310.942) (-1312.012) (-1313.573) [-1311.316] -- 0:00:12 810000 -- (-1309.607) [-1312.117] (-1311.024) (-1312.310) * (-1311.634) [-1311.269] (-1312.191) (-1312.030) -- 0:00:12 Average standard deviation of split frequencies: 0.009195 810500 -- (-1312.984) (-1310.032) [-1313.140] (-1310.228) * (-1312.364) [-1310.635] (-1313.812) (-1312.323) -- 0:00:12 811000 -- (-1309.777) (-1310.270) [-1311.373] (-1314.508) * [-1311.381] (-1310.527) (-1313.812) (-1311.409) -- 0:00:12 811500 -- (-1314.274) (-1312.975) (-1311.403) [-1316.069] * (-1313.425) (-1312.075) [-1312.363] (-1309.555) -- 0:00:12 812000 -- (-1312.995) [-1313.041] (-1311.044) (-1310.990) * [-1313.143] (-1321.559) (-1310.982) (-1309.984) -- 0:00:12 812500 -- (-1310.816) (-1312.783) (-1315.681) [-1311.017] * (-1311.731) (-1317.225) [-1312.065] (-1311.502) -- 0:00:12 813000 -- [-1310.070] (-1312.582) (-1315.864) (-1311.810) * [-1311.063] (-1312.596) (-1311.738) (-1311.179) -- 0:00:11 813500 -- [-1310.097] (-1314.262) (-1316.726) (-1311.866) * (-1310.398) (-1310.141) (-1309.823) [-1311.779] -- 0:00:11 814000 -- (-1312.175) (-1310.850) (-1312.203) [-1312.514] * (-1310.362) [-1311.448] (-1311.475) (-1310.707) -- 0:00:11 814500 -- (-1317.336) (-1313.390) [-1312.383] (-1310.386) * (-1312.117) (-1310.707) [-1309.969] (-1313.177) -- 0:00:11 815000 -- (-1310.729) [-1312.604] (-1312.720) (-1312.490) * (-1317.204) [-1312.196] (-1309.983) (-1316.727) -- 0:00:11 Average standard deviation of split frequencies: 0.009320 815500 -- (-1312.113) (-1311.853) (-1312.885) [-1310.565] * (-1310.712) (-1310.656) [-1311.096] (-1310.945) -- 0:00:11 816000 -- (-1312.947) [-1312.281] (-1314.036) (-1311.327) * (-1310.752) (-1311.830) [-1310.807] (-1312.715) -- 0:00:11 816500 -- (-1315.604) (-1310.817) (-1311.422) [-1311.615] * [-1315.142] (-1313.448) (-1316.325) (-1313.659) -- 0:00:11 817000 -- (-1312.054) (-1312.316) (-1310.966) [-1313.057] * (-1310.221) (-1310.814) (-1312.642) [-1314.565] -- 0:00:11 817500 -- (-1310.608) [-1311.499] (-1311.081) (-1313.048) * (-1310.509) (-1311.117) (-1312.932) [-1311.435] -- 0:00:11 818000 -- (-1310.570) [-1313.917] (-1314.525) (-1311.661) * (-1310.564) (-1310.535) [-1311.507] (-1312.002) -- 0:00:11 818500 -- (-1311.396) (-1310.803) [-1318.727] (-1311.347) * (-1309.676) (-1309.980) (-1312.544) [-1311.244] -- 0:00:11 819000 -- (-1312.836) (-1312.542) (-1309.811) [-1310.278] * [-1314.182] (-1311.331) (-1310.547) (-1310.330) -- 0:00:11 819500 -- (-1310.988) (-1309.962) [-1310.421] (-1310.980) * [-1315.952] (-1311.007) (-1311.420) (-1311.467) -- 0:00:11 820000 -- (-1313.566) (-1312.073) [-1311.430] (-1312.693) * (-1314.545) (-1310.828) (-1315.284) [-1311.161] -- 0:00:11 Average standard deviation of split frequencies: 0.009612 820500 -- (-1314.294) (-1313.844) (-1313.142) [-1312.109] * (-1315.803) (-1318.354) [-1312.820] (-1312.856) -- 0:00:11 821000 -- (-1309.996) (-1310.779) [-1311.413] (-1310.966) * (-1311.740) (-1312.395) (-1313.533) [-1310.440] -- 0:00:11 821500 -- (-1312.095) (-1309.701) [-1310.979] (-1317.293) * [-1315.185] (-1312.928) (-1313.782) (-1311.626) -- 0:00:11 822000 -- (-1315.521) (-1311.619) [-1312.574] (-1313.163) * (-1314.040) (-1311.221) [-1311.233] (-1311.722) -- 0:00:11 822500 -- [-1315.416] (-1310.917) (-1310.705) (-1312.485) * (-1310.876) (-1310.959) [-1310.429] (-1311.376) -- 0:00:11 823000 -- (-1317.066) [-1310.037] (-1310.368) (-1312.783) * (-1311.037) [-1311.178] (-1312.928) (-1309.625) -- 0:00:11 823500 -- [-1313.763] (-1311.396) (-1311.253) (-1310.214) * (-1313.343) (-1313.978) (-1313.294) [-1310.448] -- 0:00:11 824000 -- [-1313.670] (-1312.381) (-1310.998) (-1311.367) * (-1313.334) [-1311.890] (-1313.081) (-1316.020) -- 0:00:11 824500 -- (-1314.278) (-1312.028) [-1310.021] (-1311.865) * (-1312.758) [-1311.574] (-1312.522) (-1310.163) -- 0:00:11 825000 -- [-1310.981] (-1312.991) (-1310.484) (-1313.348) * (-1314.075) (-1311.027) (-1312.535) [-1310.172] -- 0:00:11 Average standard deviation of split frequencies: 0.010121 825500 -- (-1311.312) (-1313.157) [-1310.406] (-1311.398) * [-1311.084] (-1311.432) (-1310.150) (-1312.893) -- 0:00:11 826000 -- [-1313.018] (-1313.260) (-1312.843) (-1311.107) * (-1313.125) (-1313.472) (-1312.226) [-1310.998] -- 0:00:11 826500 -- (-1310.536) (-1311.442) (-1310.887) [-1312.494] * (-1313.640) [-1311.886] (-1311.289) (-1310.849) -- 0:00:11 827000 -- [-1310.791] (-1313.732) (-1314.931) (-1314.453) * (-1312.103) [-1311.890] (-1311.613) (-1309.844) -- 0:00:11 827500 -- [-1311.567] (-1312.322) (-1311.991) (-1312.071) * (-1312.299) [-1313.209] (-1310.300) (-1310.733) -- 0:00:11 828000 -- (-1314.243) [-1310.653] (-1313.006) (-1312.280) * (-1312.942) (-1312.039) (-1313.172) [-1311.609] -- 0:00:11 828500 -- [-1310.901] (-1312.132) (-1314.069) (-1311.920) * [-1312.557] (-1312.219) (-1310.121) (-1311.195) -- 0:00:10 829000 -- (-1315.833) (-1311.372) [-1312.857] (-1310.427) * (-1313.248) [-1312.374] (-1313.550) (-1311.151) -- 0:00:10 829500 -- (-1312.567) [-1313.876] (-1313.498) (-1313.916) * (-1313.634) (-1313.526) [-1313.625] (-1313.737) -- 0:00:10 830000 -- (-1313.711) (-1312.234) (-1326.004) [-1312.671] * (-1311.997) [-1312.099] (-1312.809) (-1311.946) -- 0:00:10 Average standard deviation of split frequencies: 0.009723 830500 -- (-1310.431) [-1313.875] (-1319.189) (-1314.313) * (-1311.939) (-1311.131) (-1311.136) [-1312.955] -- 0:00:10 831000 -- (-1311.537) (-1311.780) [-1311.841] (-1312.498) * (-1314.011) [-1311.095] (-1314.168) (-1311.623) -- 0:00:10 831500 -- [-1314.742] (-1311.792) (-1311.649) (-1312.179) * (-1311.274) [-1311.541] (-1312.411) (-1312.735) -- 0:00:10 832000 -- (-1313.425) (-1312.498) (-1310.921) [-1310.939] * (-1311.434) (-1310.115) [-1311.442] (-1312.503) -- 0:00:10 832500 -- (-1311.815) (-1312.848) (-1310.281) [-1313.158] * (-1314.220) (-1310.278) (-1311.475) [-1310.931] -- 0:00:10 833000 -- (-1313.102) (-1311.478) (-1310.195) [-1310.951] * [-1312.717] (-1315.392) (-1312.390) (-1310.692) -- 0:00:10 833500 -- (-1312.056) [-1314.218] (-1313.400) (-1313.397) * [-1311.435] (-1315.392) (-1312.219) (-1312.446) -- 0:00:10 834000 -- (-1310.984) (-1311.165) [-1309.983] (-1314.978) * (-1314.556) (-1314.943) (-1311.528) [-1311.517] -- 0:00:10 834500 -- (-1310.994) (-1314.344) [-1310.555] (-1310.141) * (-1311.957) (-1315.620) (-1312.086) [-1311.415] -- 0:00:10 835000 -- [-1310.569] (-1313.272) (-1310.412) (-1309.781) * (-1313.677) (-1312.498) [-1311.694] (-1310.837) -- 0:00:10 Average standard deviation of split frequencies: 0.009924 835500 -- (-1312.039) [-1311.201] (-1316.629) (-1310.492) * (-1312.486) (-1310.597) [-1313.455] (-1318.665) -- 0:00:10 836000 -- (-1312.382) (-1310.510) (-1311.321) [-1313.734] * (-1312.483) (-1310.694) [-1312.173] (-1312.887) -- 0:00:10 836500 -- (-1311.320) [-1312.833] (-1316.099) (-1311.573) * (-1313.206) (-1311.333) [-1311.730] (-1310.162) -- 0:00:10 837000 -- (-1311.678) (-1312.122) (-1317.714) [-1311.238] * (-1311.512) [-1312.275] (-1310.284) (-1313.308) -- 0:00:10 837500 -- [-1310.063] (-1310.994) (-1315.246) (-1311.126) * (-1312.188) [-1310.924] (-1313.151) (-1314.564) -- 0:00:10 838000 -- (-1312.260) [-1312.769] (-1310.993) (-1313.700) * [-1312.396] (-1312.841) (-1314.414) (-1311.869) -- 0:00:10 838500 -- (-1313.303) (-1316.889) [-1310.685] (-1309.970) * (-1310.403) (-1310.906) (-1315.477) [-1311.960] -- 0:00:10 839000 -- (-1314.560) (-1313.478) (-1311.024) [-1310.312] * [-1310.368] (-1310.627) (-1313.762) (-1310.990) -- 0:00:10 839500 -- [-1311.121] (-1315.807) (-1310.153) (-1310.711) * (-1310.479) [-1309.568] (-1313.084) (-1310.960) -- 0:00:10 840000 -- (-1310.017) [-1314.135] (-1312.533) (-1310.161) * (-1313.944) (-1310.506) [-1312.882] (-1311.885) -- 0:00:10 Average standard deviation of split frequencies: 0.009832 840500 -- (-1311.667) [-1312.980] (-1313.455) (-1311.541) * (-1311.995) (-1309.487) [-1311.456] (-1316.747) -- 0:00:10 841000 -- [-1313.400] (-1311.246) (-1310.291) (-1311.134) * (-1313.348) [-1309.616] (-1310.381) (-1313.630) -- 0:00:10 841500 -- (-1316.074) (-1310.896) (-1310.634) [-1310.681] * (-1313.945) (-1312.370) [-1310.322] (-1311.252) -- 0:00:10 842000 -- (-1310.903) (-1314.644) (-1310.577) [-1312.083] * (-1313.583) (-1312.329) [-1314.578] (-1314.669) -- 0:00:10 842500 -- (-1310.682) (-1312.805) (-1313.344) [-1310.539] * (-1310.176) [-1310.048] (-1311.955) (-1310.530) -- 0:00:10 843000 -- [-1311.751] (-1312.826) (-1313.415) (-1309.826) * (-1311.144) (-1311.994) (-1314.403) [-1312.136] -- 0:00:10 843500 -- (-1310.850) (-1316.950) (-1312.405) [-1309.929] * (-1312.062) (-1310.892) [-1312.882] (-1312.499) -- 0:00:10 844000 -- (-1312.288) (-1311.322) (-1314.147) [-1313.000] * (-1312.719) (-1312.446) (-1310.878) [-1310.820] -- 0:00:09 844500 -- (-1311.046) (-1311.223) (-1310.432) [-1310.897] * (-1311.312) (-1310.147) (-1311.254) [-1311.596] -- 0:00:09 845000 -- (-1310.262) (-1313.022) [-1311.562] (-1311.894) * (-1314.986) [-1310.112] (-1319.645) (-1310.127) -- 0:00:09 Average standard deviation of split frequencies: 0.010104 845500 -- (-1311.829) (-1312.462) [-1313.612] (-1310.705) * [-1309.984] (-1310.773) (-1315.010) (-1313.639) -- 0:00:09 846000 -- (-1311.661) (-1310.154) (-1309.951) [-1310.321] * (-1310.437) [-1311.582] (-1316.652) (-1317.518) -- 0:00:09 846500 -- [-1312.105] (-1311.284) (-1309.805) (-1320.771) * (-1310.634) (-1312.982) [-1312.609] (-1317.018) -- 0:00:09 847000 -- (-1309.930) (-1312.329) (-1311.178) [-1310.817] * (-1311.024) [-1312.019] (-1310.655) (-1315.039) -- 0:00:09 847500 -- (-1311.153) (-1314.626) (-1313.219) [-1312.177] * [-1311.611] (-1313.553) (-1311.580) (-1312.263) -- 0:00:09 848000 -- (-1314.114) (-1312.350) (-1313.450) [-1313.039] * [-1311.737] (-1316.166) (-1309.821) (-1309.616) -- 0:00:09 848500 -- (-1312.528) (-1314.472) (-1313.612) [-1314.507] * (-1311.261) (-1315.771) (-1312.833) [-1309.990] -- 0:00:09 849000 -- (-1311.046) [-1310.677] (-1311.170) (-1317.548) * (-1312.367) (-1312.775) (-1310.372) [-1312.576] -- 0:00:09 849500 -- (-1309.515) (-1310.233) (-1310.791) [-1309.382] * (-1311.558) (-1313.506) [-1310.110] (-1313.956) -- 0:00:09 850000 -- (-1311.813) [-1312.380] (-1310.791) (-1310.701) * (-1312.764) (-1312.374) (-1312.822) [-1313.512] -- 0:00:09 Average standard deviation of split frequencies: 0.009790 850500 -- [-1312.692] (-1316.688) (-1310.788) (-1310.891) * (-1313.566) [-1310.728] (-1311.609) (-1312.825) -- 0:00:09 851000 -- (-1312.153) (-1313.104) (-1310.468) [-1312.031] * [-1313.162] (-1310.475) (-1311.766) (-1310.939) -- 0:00:09 851500 -- (-1310.143) (-1310.939) (-1315.697) [-1311.052] * [-1310.743] (-1311.012) (-1313.538) (-1312.542) -- 0:00:09 852000 -- (-1316.959) (-1310.876) (-1312.749) [-1311.855] * (-1312.497) (-1311.124) (-1315.230) [-1313.036] -- 0:00:09 852500 -- (-1315.448) (-1311.274) (-1312.559) [-1312.029] * (-1311.846) (-1310.951) [-1310.455] (-1311.927) -- 0:00:09 853000 -- (-1311.303) [-1311.772] (-1311.872) (-1315.478) * (-1315.764) [-1309.999] (-1309.507) (-1312.118) -- 0:00:09 853500 -- [-1311.701] (-1311.077) (-1313.134) (-1311.363) * (-1310.772) [-1311.432] (-1309.924) (-1314.472) -- 0:00:09 854000 -- (-1310.241) (-1311.001) [-1310.337] (-1312.217) * [-1309.993] (-1312.856) (-1312.021) (-1310.083) -- 0:00:09 854500 -- (-1311.606) (-1318.683) [-1310.091] (-1309.701) * (-1309.720) (-1312.517) (-1312.524) [-1311.263] -- 0:00:09 855000 -- [-1311.953] (-1312.650) (-1310.622) (-1310.608) * [-1312.806] (-1314.217) (-1310.543) (-1311.839) -- 0:00:09 Average standard deviation of split frequencies: 0.009692 855500 -- (-1314.092) (-1312.252) [-1309.855] (-1311.294) * [-1317.821] (-1318.475) (-1311.199) (-1313.008) -- 0:00:09 856000 -- [-1314.040] (-1311.445) (-1311.359) (-1315.546) * (-1312.010) [-1312.668] (-1313.849) (-1311.519) -- 0:00:09 856500 -- (-1310.562) (-1311.367) (-1310.765) [-1312.663] * (-1310.286) (-1310.947) (-1316.056) [-1312.246] -- 0:00:09 857000 -- (-1311.057) [-1311.744] (-1311.639) (-1314.688) * [-1309.691] (-1311.421) (-1312.113) (-1313.895) -- 0:00:09 857500 -- (-1312.042) [-1309.833] (-1310.554) (-1317.034) * [-1311.929] (-1311.648) (-1311.335) (-1314.050) -- 0:00:09 858000 -- (-1310.138) [-1310.993] (-1313.106) (-1313.641) * [-1311.658] (-1311.013) (-1310.748) (-1313.963) -- 0:00:09 858500 -- (-1311.872) (-1314.479) [-1314.408] (-1310.151) * (-1313.051) (-1311.447) (-1319.815) [-1314.762] -- 0:00:09 859000 -- [-1310.837] (-1310.631) (-1314.283) (-1309.912) * (-1311.082) (-1312.896) (-1314.202) [-1312.437] -- 0:00:09 859500 -- (-1316.696) (-1311.104) (-1314.534) [-1310.125] * (-1311.389) [-1311.857] (-1312.504) (-1312.541) -- 0:00:08 860000 -- (-1313.483) (-1311.456) (-1310.756) [-1312.483] * (-1309.935) (-1311.825) [-1316.993] (-1311.331) -- 0:00:08 Average standard deviation of split frequencies: 0.009713 860500 -- (-1311.084) (-1310.234) [-1311.652] (-1311.008) * (-1309.779) (-1312.859) (-1311.281) [-1310.598] -- 0:00:08 861000 -- (-1315.142) [-1311.305] (-1311.152) (-1312.680) * (-1312.296) [-1314.393] (-1310.736) (-1311.359) -- 0:00:08 861500 -- (-1315.063) (-1312.723) [-1314.687] (-1314.314) * (-1310.510) (-1311.491) [-1310.328] (-1310.096) -- 0:00:08 862000 -- (-1311.682) [-1309.629] (-1316.470) (-1314.259) * (-1312.865) [-1310.788] (-1311.506) (-1313.698) -- 0:00:08 862500 -- (-1313.586) (-1312.375) [-1311.522] (-1312.186) * (-1312.058) (-1310.598) [-1309.843] (-1311.835) -- 0:00:08 863000 -- [-1310.915] (-1310.718) (-1311.375) (-1318.109) * (-1312.608) [-1313.490] (-1311.685) (-1311.349) -- 0:00:08 863500 -- (-1309.537) (-1311.710) (-1314.699) [-1312.311] * [-1310.212] (-1315.462) (-1309.918) (-1312.187) -- 0:00:08 864000 -- (-1312.758) (-1313.290) (-1315.549) [-1313.953] * (-1312.516) (-1311.874) [-1309.767] (-1311.236) -- 0:00:08 864500 -- (-1311.071) (-1310.965) [-1313.321] (-1311.027) * [-1311.946] (-1310.058) (-1311.041) (-1311.695) -- 0:00:08 865000 -- (-1310.042) (-1312.324) [-1311.388] (-1310.470) * (-1311.743) (-1311.815) (-1310.797) [-1313.482] -- 0:00:08 Average standard deviation of split frequencies: 0.010270 865500 -- [-1310.344] (-1312.950) (-1318.835) (-1311.910) * (-1310.670) (-1313.606) [-1310.735] (-1313.633) -- 0:00:08 866000 -- (-1309.880) (-1310.719) [-1313.480] (-1311.475) * (-1312.982) (-1311.565) (-1312.491) [-1310.847] -- 0:00:08 866500 -- [-1311.747] (-1312.569) (-1311.629) (-1311.841) * (-1313.674) [-1311.104] (-1311.772) (-1311.366) -- 0:00:08 867000 -- [-1311.418] (-1310.154) (-1311.554) (-1310.860) * (-1313.548) [-1309.858] (-1310.195) (-1310.881) -- 0:00:08 867500 -- (-1309.970) [-1310.453] (-1314.092) (-1311.017) * (-1312.015) (-1310.975) [-1311.481] (-1312.320) -- 0:00:08 868000 -- (-1309.883) [-1309.609] (-1310.433) (-1311.495) * (-1310.836) [-1310.938] (-1310.074) (-1311.162) -- 0:00:08 868500 -- (-1310.594) [-1311.882] (-1315.899) (-1312.395) * [-1313.597] (-1310.027) (-1309.534) (-1311.157) -- 0:00:08 869000 -- (-1314.821) [-1314.811] (-1314.672) (-1311.253) * (-1312.991) [-1311.338] (-1310.383) (-1310.038) -- 0:00:08 869500 -- [-1313.986] (-1315.619) (-1317.122) (-1313.586) * (-1311.535) (-1309.334) (-1312.537) [-1310.395] -- 0:00:08 870000 -- (-1311.936) [-1312.729] (-1312.424) (-1312.799) * [-1313.955] (-1311.069) (-1312.289) (-1311.498) -- 0:00:08 Average standard deviation of split frequencies: 0.009983 870500 -- (-1310.613) (-1310.076) (-1311.379) [-1313.178] * (-1314.683) (-1314.538) (-1312.035) [-1311.774] -- 0:00:08 871000 -- (-1310.270) (-1309.837) [-1311.584] (-1311.046) * (-1311.059) (-1312.292) (-1311.063) [-1310.204] -- 0:00:08 871500 -- [-1311.141] (-1309.854) (-1311.020) (-1314.809) * (-1312.711) (-1312.835) (-1310.773) [-1311.066] -- 0:00:08 872000 -- (-1310.897) (-1314.600) [-1315.600] (-1314.249) * (-1314.382) (-1314.956) (-1312.378) [-1309.798] -- 0:00:08 872500 -- (-1311.352) (-1311.152) [-1313.178] (-1314.563) * (-1311.412) (-1314.201) (-1312.034) [-1309.903] -- 0:00:08 873000 -- (-1313.787) (-1311.702) [-1315.656] (-1310.584) * (-1313.418) (-1312.153) (-1312.274) [-1310.477] -- 0:00:08 873500 -- [-1317.049] (-1313.313) (-1313.142) (-1310.823) * (-1310.505) (-1310.956) (-1310.395) [-1310.826] -- 0:00:08 874000 -- (-1313.242) (-1310.871) [-1312.517] (-1311.781) * (-1311.753) (-1312.331) (-1311.140) [-1311.634] -- 0:00:08 874500 -- [-1309.761] (-1311.984) (-1311.416) (-1310.430) * (-1310.041) (-1311.064) [-1310.580] (-1311.938) -- 0:00:08 875000 -- (-1311.476) (-1309.614) (-1310.290) [-1310.247] * (-1309.692) (-1316.326) [-1313.652] (-1311.492) -- 0:00:08 Average standard deviation of split frequencies: 0.009585 875500 -- (-1309.429) [-1312.181] (-1310.083) (-1315.083) * [-1310.343] (-1310.525) (-1311.151) (-1319.053) -- 0:00:07 876000 -- (-1313.471) [-1311.888] (-1313.672) (-1316.237) * [-1310.343] (-1311.264) (-1310.650) (-1312.778) -- 0:00:07 876500 -- [-1310.258] (-1311.735) (-1313.466) (-1313.766) * (-1311.945) (-1313.813) [-1310.649] (-1310.624) -- 0:00:07 877000 -- (-1310.672) [-1313.285] (-1310.703) (-1313.260) * (-1311.542) [-1311.191] (-1312.535) (-1309.921) -- 0:00:07 877500 -- (-1310.529) [-1310.174] (-1309.953) (-1310.048) * (-1315.657) [-1311.683] (-1309.876) (-1310.053) -- 0:00:07 878000 -- (-1310.535) [-1309.855] (-1310.324) (-1310.790) * (-1313.072) (-1311.861) [-1312.087] (-1310.820) -- 0:00:07 878500 -- (-1312.139) [-1312.044] (-1310.124) (-1309.932) * (-1311.656) (-1312.967) [-1311.433] (-1311.291) -- 0:00:07 879000 -- (-1309.766) [-1312.689] (-1314.375) (-1310.311) * (-1310.878) (-1313.451) [-1312.006] (-1312.335) -- 0:00:07 879500 -- (-1311.993) (-1311.910) (-1316.845) [-1309.682] * [-1310.754] (-1311.890) (-1311.364) (-1313.869) -- 0:00:07 880000 -- (-1311.889) (-1314.280) (-1313.655) [-1311.397] * [-1310.654] (-1315.271) (-1317.258) (-1312.605) -- 0:00:07 Average standard deviation of split frequencies: 0.009501 880500 -- (-1311.491) (-1320.929) [-1312.527] (-1311.455) * [-1311.926] (-1310.674) (-1312.276) (-1311.342) -- 0:00:07 881000 -- (-1312.477) [-1314.203] (-1314.007) (-1311.392) * (-1316.084) [-1311.002] (-1315.571) (-1309.861) -- 0:00:07 881500 -- [-1311.595] (-1312.501) (-1315.627) (-1310.109) * (-1317.966) [-1310.870] (-1311.934) (-1314.673) -- 0:00:07 882000 -- (-1312.977) (-1310.832) [-1311.554] (-1311.989) * (-1310.370) [-1314.362] (-1311.305) (-1316.309) -- 0:00:07 882500 -- (-1312.142) (-1310.060) (-1310.998) [-1310.268] * (-1310.021) (-1311.688) [-1310.121] (-1316.670) -- 0:00:07 883000 -- (-1313.669) (-1311.801) [-1312.019] (-1315.462) * (-1311.406) [-1312.883] (-1310.123) (-1315.395) -- 0:00:07 883500 -- (-1312.697) [-1312.410] (-1311.296) (-1318.636) * [-1316.662] (-1311.743) (-1309.626) (-1310.630) -- 0:00:07 884000 -- (-1313.552) (-1312.349) [-1310.564] (-1314.813) * (-1312.230) (-1311.695) (-1310.103) [-1311.091] -- 0:00:07 884500 -- (-1312.628) (-1315.269) [-1311.127] (-1312.680) * (-1310.988) [-1313.986] (-1316.148) (-1311.429) -- 0:00:07 885000 -- (-1309.943) [-1313.983] (-1311.158) (-1310.056) * [-1314.518] (-1313.838) (-1311.896) (-1314.679) -- 0:00:07 Average standard deviation of split frequencies: 0.009078 885500 -- [-1310.602] (-1312.182) (-1313.333) (-1311.383) * [-1313.281] (-1314.120) (-1313.235) (-1310.360) -- 0:00:07 886000 -- (-1311.282) (-1311.454) [-1311.956] (-1310.225) * (-1311.815) (-1311.312) [-1312.266] (-1310.928) -- 0:00:07 886500 -- (-1313.045) [-1310.054] (-1309.940) (-1311.983) * (-1310.103) (-1311.276) [-1311.042] (-1315.534) -- 0:00:07 887000 -- (-1319.399) (-1310.620) [-1312.061] (-1311.521) * (-1312.378) (-1310.530) [-1310.187] (-1309.829) -- 0:00:07 887500 -- (-1313.914) (-1312.177) (-1310.973) [-1312.148] * (-1312.706) (-1311.335) [-1313.307] (-1309.592) -- 0:00:07 888000 -- (-1313.293) [-1310.715] (-1311.103) (-1313.924) * (-1310.554) (-1311.219) [-1310.746] (-1312.949) -- 0:00:07 888500 -- (-1315.307) [-1310.538] (-1310.311) (-1314.948) * (-1311.514) (-1311.983) [-1313.099] (-1314.828) -- 0:00:07 889000 -- [-1311.376] (-1311.389) (-1311.490) (-1309.868) * (-1310.869) (-1313.413) [-1311.126] (-1310.819) -- 0:00:07 889500 -- [-1311.170] (-1310.631) (-1311.123) (-1311.433) * (-1312.283) [-1310.819] (-1310.577) (-1310.306) -- 0:00:07 890000 -- (-1311.190) (-1313.458) [-1310.729] (-1310.316) * (-1310.713) (-1310.359) (-1311.511) [-1310.097] -- 0:00:07 Average standard deviation of split frequencies: 0.009163 890500 -- (-1312.441) [-1309.503] (-1310.192) (-1311.095) * (-1310.685) (-1310.265) (-1311.985) [-1310.604] -- 0:00:07 891000 -- [-1312.855] (-1313.321) (-1311.543) (-1310.793) * (-1311.302) [-1312.992] (-1312.678) (-1314.394) -- 0:00:06 891500 -- (-1313.794) (-1312.374) [-1311.097] (-1309.840) * [-1312.163] (-1316.263) (-1312.164) (-1314.524) -- 0:00:06 892000 -- (-1313.345) [-1313.911] (-1311.453) (-1316.939) * (-1313.614) [-1313.309] (-1309.972) (-1312.904) -- 0:00:06 892500 -- (-1318.594) [-1312.480] (-1310.014) (-1314.814) * [-1315.506] (-1312.903) (-1313.621) (-1310.751) -- 0:00:06 893000 -- (-1311.866) (-1312.991) [-1310.004] (-1310.633) * (-1310.362) (-1314.803) (-1314.856) [-1309.866] -- 0:00:06 893500 -- (-1312.376) (-1314.692) (-1310.014) [-1310.251] * [-1310.226] (-1311.545) (-1314.435) (-1312.337) -- 0:00:06 894000 -- (-1312.812) (-1312.920) (-1310.325) [-1312.968] * (-1312.157) [-1310.231] (-1311.124) (-1313.440) -- 0:00:06 894500 -- (-1311.556) (-1311.555) [-1313.600] (-1311.718) * [-1310.438] (-1309.653) (-1310.496) (-1316.185) -- 0:00:06 895000 -- (-1311.193) (-1311.266) (-1313.504) [-1310.970] * (-1311.160) (-1311.604) (-1317.198) [-1313.267] -- 0:00:06 Average standard deviation of split frequencies: 0.009273 895500 -- (-1310.149) (-1310.126) (-1312.844) [-1310.427] * (-1312.119) [-1313.978] (-1313.169) (-1315.234) -- 0:00:06 896000 -- (-1316.318) (-1309.729) (-1310.052) [-1313.053] * (-1314.520) [-1311.368] (-1312.526) (-1317.709) -- 0:00:06 896500 -- [-1310.235] (-1312.339) (-1309.887) (-1322.179) * (-1311.297) (-1311.908) (-1314.208) [-1312.124] -- 0:00:06 897000 -- [-1309.979] (-1310.440) (-1310.104) (-1313.110) * (-1311.210) [-1310.095] (-1310.334) (-1311.415) -- 0:00:06 897500 -- (-1309.915) (-1311.752) (-1311.136) [-1310.452] * (-1313.501) (-1312.078) [-1311.520] (-1312.199) -- 0:00:06 898000 -- [-1312.769] (-1310.372) (-1313.511) (-1313.351) * (-1312.834) [-1311.295] (-1309.492) (-1312.330) -- 0:00:06 898500 -- (-1310.298) [-1309.545] (-1311.377) (-1313.580) * (-1312.851) (-1315.395) [-1311.240] (-1310.694) -- 0:00:06 899000 -- (-1310.371) (-1310.720) (-1311.857) [-1309.797] * [-1310.045] (-1310.879) (-1312.906) (-1309.722) -- 0:00:06 899500 -- (-1311.825) (-1311.415) (-1315.075) [-1313.202] * (-1311.724) (-1311.742) [-1311.590] (-1310.253) -- 0:00:06 900000 -- (-1311.629) (-1312.367) (-1311.512) [-1310.349] * (-1311.982) (-1313.507) [-1315.506] (-1313.331) -- 0:00:06 Average standard deviation of split frequencies: 0.008865 900500 -- (-1310.788) [-1311.387] (-1311.185) (-1312.756) * (-1313.078) (-1313.466) (-1311.875) [-1311.044] -- 0:00:06 901000 -- (-1310.433) (-1312.047) [-1311.701] (-1310.995) * (-1315.002) [-1310.765] (-1312.657) (-1311.062) -- 0:00:06 901500 -- (-1312.710) [-1312.336] (-1314.044) (-1310.468) * (-1313.412) (-1313.170) [-1310.413] (-1310.478) -- 0:00:06 902000 -- (-1311.103) [-1315.037] (-1313.044) (-1311.656) * (-1314.075) (-1311.523) (-1311.178) [-1310.574] -- 0:00:06 902500 -- (-1311.063) [-1313.339] (-1312.536) (-1313.200) * (-1311.058) (-1311.228) [-1310.336] (-1309.946) -- 0:00:06 903000 -- [-1310.898] (-1313.318) (-1311.903) (-1310.258) * (-1312.845) [-1312.710] (-1309.831) (-1312.091) -- 0:00:06 903500 -- (-1312.164) (-1310.902) [-1310.086] (-1310.783) * (-1310.279) [-1310.562] (-1309.493) (-1312.198) -- 0:00:06 904000 -- (-1315.711) (-1310.429) (-1311.177) [-1310.783] * [-1311.610] (-1310.291) (-1309.501) (-1310.598) -- 0:00:06 904500 -- (-1312.547) [-1311.226] (-1311.242) (-1310.995) * (-1312.303) (-1311.571) [-1309.867] (-1311.558) -- 0:00:06 905000 -- [-1311.489] (-1311.309) (-1311.492) (-1310.181) * [-1309.705] (-1312.239) (-1309.868) (-1311.542) -- 0:00:06 Average standard deviation of split frequencies: 0.009496 905500 -- [-1312.578] (-1320.373) (-1310.944) (-1311.909) * (-1311.234) (-1310.633) [-1311.665] (-1313.550) -- 0:00:06 906000 -- (-1311.385) [-1313.386] (-1310.348) (-1311.734) * (-1315.215) [-1311.036] (-1311.642) (-1310.854) -- 0:00:06 906500 -- (-1310.572) [-1309.778] (-1310.255) (-1313.311) * (-1313.474) (-1311.338) (-1310.778) [-1311.515] -- 0:00:05 907000 -- [-1311.710] (-1311.771) (-1311.721) (-1315.924) * (-1310.362) (-1313.629) (-1310.259) [-1311.919] -- 0:00:05 907500 -- (-1310.738) [-1313.943] (-1311.296) (-1315.067) * (-1310.905) (-1313.189) [-1311.536] (-1313.202) -- 0:00:05 908000 -- (-1310.283) [-1310.312] (-1311.109) (-1309.450) * [-1310.506] (-1311.105) (-1311.924) (-1311.354) -- 0:00:05 908500 -- [-1309.763] (-1310.789) (-1312.966) (-1310.860) * (-1311.438) (-1312.053) (-1310.989) [-1313.851] -- 0:00:05 909000 -- [-1311.076] (-1309.447) (-1310.131) (-1312.125) * (-1312.428) (-1312.249) (-1312.364) [-1315.112] -- 0:00:05 909500 -- (-1311.132) (-1309.499) [-1311.171] (-1310.745) * [-1310.058] (-1315.957) (-1309.953) (-1313.722) -- 0:00:05 910000 -- [-1312.961] (-1309.447) (-1313.081) (-1311.726) * (-1311.356) [-1311.138] (-1311.822) (-1312.907) -- 0:00:05 Average standard deviation of split frequencies: 0.009253 910500 -- [-1313.427] (-1311.052) (-1309.826) (-1310.083) * [-1310.357] (-1311.087) (-1314.446) (-1310.051) -- 0:00:05 911000 -- [-1313.318] (-1315.794) (-1310.469) (-1312.450) * [-1314.112] (-1309.811) (-1314.054) (-1311.558) -- 0:00:05 911500 -- (-1310.201) [-1310.310] (-1317.827) (-1313.715) * (-1315.157) (-1310.774) (-1320.316) [-1311.659] -- 0:00:05 912000 -- (-1312.312) (-1311.455) [-1312.797] (-1309.979) * (-1314.216) [-1314.795] (-1310.545) (-1312.904) -- 0:00:05 912500 -- (-1312.756) (-1310.362) [-1309.603] (-1310.066) * (-1310.390) (-1311.569) (-1313.734) [-1310.132] -- 0:00:05 913000 -- (-1310.737) [-1309.472] (-1312.177) (-1312.849) * (-1314.380) [-1312.609] (-1314.797) (-1309.801) -- 0:00:05 913500 -- (-1310.679) [-1311.771] (-1311.510) (-1310.672) * (-1313.717) [-1312.707] (-1313.978) (-1310.765) -- 0:00:05 914000 -- (-1310.037) [-1314.329] (-1310.669) (-1310.678) * [-1310.609] (-1315.779) (-1311.679) (-1311.801) -- 0:00:05 914500 -- (-1313.499) (-1311.478) [-1310.429] (-1315.546) * (-1310.118) [-1312.894] (-1312.553) (-1312.134) -- 0:00:05 915000 -- (-1313.701) [-1310.484] (-1312.123) (-1313.037) * [-1311.528] (-1311.856) (-1316.451) (-1309.989) -- 0:00:05 Average standard deviation of split frequencies: 0.008974 915500 -- (-1311.421) (-1310.394) [-1312.010] (-1314.179) * (-1314.885) (-1312.353) (-1313.877) [-1312.502] -- 0:00:05 916000 -- (-1310.698) (-1309.788) (-1312.289) [-1310.786] * [-1311.621] (-1314.781) (-1313.688) (-1314.461) -- 0:00:05 916500 -- (-1309.709) (-1310.778) (-1314.972) [-1309.924] * (-1312.486) [-1314.282] (-1313.103) (-1312.841) -- 0:00:05 917000 -- [-1309.757] (-1310.129) (-1309.653) (-1314.186) * (-1313.540) [-1310.198] (-1311.531) (-1313.134) -- 0:00:05 917500 -- (-1311.458) (-1313.511) [-1309.829] (-1311.371) * (-1310.337) (-1311.174) (-1312.932) [-1312.227] -- 0:00:05 918000 -- (-1312.809) (-1316.498) [-1311.092] (-1311.658) * (-1311.679) (-1310.493) [-1312.802] (-1315.959) -- 0:00:05 918500 -- [-1312.737] (-1310.575) (-1312.584) (-1310.690) * (-1313.872) [-1311.617] (-1314.952) (-1309.939) -- 0:00:05 919000 -- [-1310.431] (-1310.505) (-1310.379) (-1313.821) * (-1312.873) (-1311.906) [-1315.485] (-1309.892) -- 0:00:05 919500 -- (-1311.949) (-1311.389) [-1314.004] (-1310.222) * [-1314.440] (-1312.072) (-1311.061) (-1310.144) -- 0:00:05 920000 -- (-1314.606) [-1309.423] (-1314.060) (-1313.096) * (-1310.648) (-1312.379) (-1311.068) [-1310.043] -- 0:00:05 Average standard deviation of split frequencies: 0.009056 920500 -- [-1310.772] (-1313.550) (-1312.865) (-1312.605) * (-1310.241) (-1310.442) (-1310.166) [-1310.653] -- 0:00:05 921000 -- [-1309.931] (-1310.278) (-1313.971) (-1313.256) * (-1313.053) (-1311.106) [-1316.566] (-1311.470) -- 0:00:05 921500 -- (-1310.174) (-1310.308) [-1312.845] (-1311.264) * (-1313.650) (-1311.379) [-1315.430] (-1312.472) -- 0:00:05 922000 -- (-1310.229) (-1317.634) [-1310.001] (-1311.325) * (-1313.161) (-1311.255) (-1317.280) [-1312.151] -- 0:00:04 922500 -- (-1314.374) [-1310.549] (-1310.656) (-1311.325) * (-1312.722) (-1310.974) [-1312.353] (-1309.735) -- 0:00:04 923000 -- (-1312.241) (-1311.112) [-1312.751] (-1311.151) * (-1311.830) [-1311.430] (-1317.148) (-1311.029) -- 0:00:04 923500 -- (-1315.527) (-1310.479) [-1313.444] (-1311.165) * (-1312.250) [-1312.776] (-1314.773) (-1310.968) -- 0:00:04 924000 -- (-1311.873) (-1310.702) [-1310.766] (-1314.403) * (-1315.168) (-1311.931) (-1311.288) [-1311.122] -- 0:00:04 924500 -- [-1310.548] (-1312.467) (-1312.790) (-1315.079) * (-1312.763) [-1310.531] (-1312.815) (-1310.330) -- 0:00:04 925000 -- [-1310.686] (-1311.185) (-1311.795) (-1310.806) * (-1311.761) [-1309.972] (-1313.629) (-1316.337) -- 0:00:04 Average standard deviation of split frequencies: 0.008909 925500 -- (-1310.672) (-1312.381) [-1314.408] (-1309.794) * (-1311.790) [-1313.225] (-1319.415) (-1312.499) -- 0:00:04 926000 -- (-1315.363) (-1313.035) [-1310.647] (-1309.838) * [-1311.296] (-1317.007) (-1312.590) (-1310.779) -- 0:00:04 926500 -- (-1310.922) [-1310.905] (-1313.115) (-1309.692) * [-1312.839] (-1312.578) (-1311.618) (-1314.083) -- 0:00:04 927000 -- [-1312.399] (-1311.157) (-1311.827) (-1310.897) * (-1314.418) [-1312.326] (-1311.478) (-1311.229) -- 0:00:04 927500 -- (-1311.621) [-1312.865] (-1311.941) (-1311.165) * (-1312.521) [-1311.452] (-1318.908) (-1311.708) -- 0:00:04 928000 -- (-1311.506) (-1312.275) (-1312.525) [-1310.613] * (-1311.965) (-1310.023) (-1318.903) [-1319.584] -- 0:00:04 928500 -- (-1310.100) (-1311.900) [-1310.007] (-1310.072) * (-1313.410) (-1315.721) (-1313.088) [-1311.573] -- 0:00:04 929000 -- (-1310.536) (-1310.867) (-1309.649) [-1312.791] * (-1313.254) [-1310.908] (-1310.966) (-1312.073) -- 0:00:04 929500 -- (-1311.484) (-1311.332) [-1309.672] (-1313.372) * (-1312.781) (-1311.642) (-1311.000) [-1313.342] -- 0:00:04 930000 -- (-1312.077) (-1311.470) [-1311.964] (-1310.824) * (-1311.237) (-1313.348) [-1313.529] (-1310.368) -- 0:00:04 Average standard deviation of split frequencies: 0.008706 930500 -- (-1313.908) [-1311.561] (-1311.908) (-1311.577) * [-1313.092] (-1315.581) (-1312.102) (-1311.014) -- 0:00:04 931000 -- (-1311.406) (-1311.701) [-1312.660] (-1311.944) * (-1316.373) (-1313.053) (-1313.601) [-1310.428] -- 0:00:04 931500 -- [-1311.393] (-1313.569) (-1311.894) (-1312.898) * (-1310.666) (-1318.813) (-1311.040) [-1311.944] -- 0:00:04 932000 -- (-1310.703) [-1314.503] (-1310.686) (-1313.234) * (-1311.436) (-1318.007) [-1311.061] (-1311.977) -- 0:00:04 932500 -- (-1310.847) (-1317.507) [-1311.316] (-1314.614) * (-1311.883) (-1311.130) [-1310.692] (-1312.649) -- 0:00:04 933000 -- (-1310.806) (-1313.759) [-1310.028] (-1313.452) * (-1313.191) [-1311.580] (-1313.476) (-1311.128) -- 0:00:04 933500 -- (-1315.017) (-1312.282) (-1311.189) [-1314.069] * [-1310.531] (-1312.860) (-1311.153) (-1311.222) -- 0:00:04 934000 -- (-1311.904) (-1314.172) [-1313.957] (-1314.594) * [-1311.243] (-1310.667) (-1310.717) (-1312.132) -- 0:00:04 934500 -- (-1309.514) (-1312.438) (-1310.062) [-1313.403] * [-1311.287] (-1310.436) (-1310.589) (-1311.727) -- 0:00:04 935000 -- [-1310.559] (-1312.234) (-1313.335) (-1313.071) * (-1312.119) [-1309.851] (-1309.571) (-1311.190) -- 0:00:04 Average standard deviation of split frequencies: 0.008247 935500 -- (-1317.107) (-1309.792) (-1310.056) [-1310.432] * [-1315.321] (-1310.692) (-1311.657) (-1312.502) -- 0:00:04 936000 -- [-1314.520] (-1311.197) (-1310.022) (-1312.363) * (-1313.313) [-1312.254] (-1312.274) (-1310.587) -- 0:00:04 936500 -- (-1312.420) [-1312.814] (-1310.117) (-1313.102) * (-1313.250) [-1311.106] (-1311.049) (-1314.830) -- 0:00:04 937000 -- (-1311.969) (-1313.294) [-1309.529] (-1314.996) * [-1312.941] (-1314.067) (-1313.946) (-1310.207) -- 0:00:04 937500 -- [-1315.280] (-1312.364) (-1311.901) (-1312.235) * (-1312.930) [-1311.994] (-1311.045) (-1315.962) -- 0:00:04 938000 -- [-1311.136] (-1313.471) (-1310.070) (-1311.588) * (-1310.385) [-1311.157] (-1313.189) (-1311.740) -- 0:00:03 938500 -- [-1312.548] (-1323.766) (-1312.682) (-1313.283) * [-1312.594] (-1311.153) (-1310.659) (-1311.743) -- 0:00:03 939000 -- (-1312.200) [-1315.881] (-1312.645) (-1311.054) * (-1309.545) (-1310.272) [-1310.545] (-1312.293) -- 0:00:03 939500 -- [-1311.401] (-1311.552) (-1310.369) (-1310.394) * (-1314.617) (-1309.612) (-1309.919) [-1312.121] -- 0:00:03 940000 -- (-1311.447) [-1310.233] (-1314.419) (-1311.110) * [-1310.474] (-1314.587) (-1314.420) (-1311.921) -- 0:00:03 Average standard deviation of split frequencies: 0.008300 940500 -- (-1310.759) [-1311.998] (-1309.536) (-1311.464) * (-1311.522) [-1311.700] (-1312.000) (-1312.299) -- 0:00:03 941000 -- (-1311.449) (-1310.719) [-1310.335] (-1312.471) * (-1314.629) (-1316.706) (-1309.923) [-1314.750] -- 0:00:03 941500 -- (-1313.302) (-1310.997) [-1310.399] (-1310.629) * [-1311.044] (-1309.909) (-1312.591) (-1314.497) -- 0:00:03 942000 -- (-1314.070) [-1310.838] (-1312.485) (-1313.737) * [-1311.899] (-1311.622) (-1311.216) (-1313.342) -- 0:00:03 942500 -- (-1314.977) (-1319.625) (-1310.897) [-1310.258] * (-1315.483) (-1312.672) (-1311.712) [-1310.706] -- 0:00:03 943000 -- (-1316.250) (-1312.954) [-1310.397] (-1309.874) * (-1311.443) [-1311.097] (-1312.850) (-1310.600) -- 0:00:03 943500 -- [-1311.546] (-1309.511) (-1311.619) (-1312.681) * (-1313.665) (-1310.917) [-1311.470] (-1311.940) -- 0:00:03 944000 -- (-1311.322) [-1316.094] (-1316.011) (-1313.166) * (-1311.479) [-1313.385] (-1313.615) (-1310.697) -- 0:00:03 944500 -- (-1310.056) (-1313.449) (-1315.339) [-1309.918] * (-1311.698) [-1311.696] (-1309.954) (-1312.265) -- 0:00:03 945000 -- (-1310.427) [-1310.243] (-1314.832) (-1311.944) * [-1312.289] (-1311.495) (-1313.204) (-1310.168) -- 0:00:03 Average standard deviation of split frequencies: 0.008658 945500 -- (-1310.894) (-1310.463) (-1311.567) [-1310.864] * (-1310.918) [-1313.719] (-1312.129) (-1310.356) -- 0:00:03 946000 -- (-1313.557) (-1311.516) (-1312.897) [-1315.234] * [-1309.642] (-1310.510) (-1311.076) (-1320.997) -- 0:00:03 946500 -- (-1311.796) [-1312.405] (-1315.466) (-1314.921) * (-1311.793) [-1311.189] (-1312.089) (-1311.636) -- 0:00:03 947000 -- [-1310.251] (-1312.125) (-1314.595) (-1318.020) * [-1311.002] (-1311.290) (-1313.561) (-1315.560) -- 0:00:03 947500 -- (-1309.652) (-1313.935) (-1312.154) [-1314.086] * (-1314.438) (-1310.712) [-1311.605] (-1311.087) -- 0:00:03 948000 -- (-1312.295) (-1310.484) (-1314.235) [-1315.942] * (-1316.265) [-1310.566] (-1316.292) (-1310.785) -- 0:00:03 948500 -- (-1313.198) (-1310.142) (-1315.091) [-1312.208] * (-1309.650) (-1312.235) (-1315.640) [-1312.088] -- 0:00:03 949000 -- [-1311.376] (-1311.561) (-1311.087) (-1310.262) * (-1313.700) [-1310.463] (-1311.626) (-1310.297) -- 0:00:03 949500 -- (-1312.187) (-1313.244) [-1312.248] (-1311.087) * (-1314.108) [-1310.925] (-1313.352) (-1312.143) -- 0:00:03 950000 -- (-1313.168) (-1311.443) [-1310.794] (-1314.930) * (-1312.639) (-1313.279) [-1313.322] (-1311.504) -- 0:00:03 Average standard deviation of split frequencies: 0.008275 950500 -- (-1311.742) (-1316.725) (-1312.078) [-1311.301] * [-1313.006] (-1310.598) (-1312.472) (-1310.313) -- 0:00:03 951000 -- (-1311.078) (-1315.542) [-1311.845] (-1312.218) * (-1309.581) (-1312.006) [-1311.834] (-1311.573) -- 0:00:03 951500 -- [-1311.198] (-1312.450) (-1312.510) (-1311.496) * (-1309.625) (-1311.411) (-1313.259) [-1311.912] -- 0:00:03 952000 -- (-1311.543) (-1310.866) [-1309.997] (-1314.224) * (-1311.493) (-1311.005) (-1310.193) [-1310.570] -- 0:00:03 952500 -- (-1314.771) (-1313.083) [-1312.545] (-1314.520) * (-1309.640) [-1310.920] (-1316.934) (-1311.453) -- 0:00:03 953000 -- [-1309.709] (-1310.632) (-1311.800) (-1312.531) * (-1313.005) (-1310.878) [-1313.224] (-1311.572) -- 0:00:03 953500 -- (-1309.922) (-1310.254) (-1314.205) [-1312.319] * (-1311.499) (-1315.556) (-1313.346) [-1317.187] -- 0:00:02 954000 -- [-1315.535] (-1311.486) (-1314.843) (-1310.672) * (-1311.452) (-1311.700) (-1316.269) [-1311.858] -- 0:00:02 954500 -- (-1312.902) (-1313.478) (-1317.434) [-1310.330] * (-1310.381) (-1311.929) (-1315.843) [-1310.517] -- 0:00:02 955000 -- [-1312.250] (-1312.148) (-1317.665) (-1311.360) * (-1311.757) (-1314.353) (-1310.599) [-1315.163] -- 0:00:02 Average standard deviation of split frequencies: 0.008167 955500 -- (-1310.674) (-1313.396) (-1313.875) [-1310.864] * (-1312.111) (-1311.720) (-1310.758) [-1313.964] -- 0:00:02 956000 -- (-1312.192) [-1313.009] (-1313.097) (-1320.665) * (-1314.136) (-1311.802) [-1313.074] (-1310.612) -- 0:00:02 956500 -- (-1310.408) (-1311.498) [-1312.137] (-1315.515) * [-1311.507] (-1312.181) (-1313.527) (-1310.277) -- 0:00:02 957000 -- (-1310.677) [-1311.226] (-1313.260) (-1312.343) * (-1312.167) [-1310.263] (-1313.747) (-1311.110) -- 0:00:02 957500 -- (-1310.290) (-1309.681) (-1314.015) [-1311.632] * (-1313.046) (-1311.723) (-1311.305) [-1312.717] -- 0:00:02 958000 -- (-1315.264) (-1310.308) (-1312.429) [-1311.468] * (-1310.965) (-1312.575) (-1310.164) [-1310.712] -- 0:00:02 958500 -- [-1311.126] (-1310.308) (-1312.000) (-1313.282) * [-1310.027] (-1313.702) (-1314.360) (-1310.896) -- 0:00:02 959000 -- [-1312.702] (-1310.660) (-1310.057) (-1310.799) * (-1310.891) [-1313.166] (-1311.890) (-1310.589) -- 0:00:02 959500 -- (-1312.883) [-1310.260] (-1310.098) (-1314.072) * (-1316.093) (-1312.552) (-1317.106) [-1310.883] -- 0:00:02 960000 -- [-1313.674] (-1310.123) (-1309.843) (-1312.153) * (-1310.619) (-1310.345) [-1311.603] (-1310.901) -- 0:00:02 Average standard deviation of split frequencies: 0.008113 960500 -- [-1312.227] (-1310.888) (-1310.818) (-1311.267) * (-1310.650) (-1313.415) (-1314.106) [-1309.669] -- 0:00:02 961000 -- (-1315.540) (-1318.004) [-1313.676] (-1314.775) * (-1312.114) (-1309.699) [-1311.996] (-1310.930) -- 0:00:02 961500 -- (-1309.578) (-1312.322) [-1312.235] (-1313.327) * [-1313.340] (-1313.791) (-1312.053) (-1311.526) -- 0:00:02 962000 -- [-1310.953] (-1313.240) (-1312.951) (-1310.849) * [-1311.268] (-1310.043) (-1309.987) (-1310.525) -- 0:00:02 962500 -- (-1312.319) (-1311.580) (-1311.167) [-1311.440] * (-1310.910) [-1311.973] (-1312.672) (-1311.739) -- 0:00:02 963000 -- (-1313.472) (-1314.222) (-1310.048) [-1310.444] * (-1312.097) (-1309.692) (-1309.929) [-1310.052] -- 0:00:02 963500 -- [-1312.139] (-1311.481) (-1310.035) (-1311.842) * (-1310.849) (-1310.212) (-1312.388) [-1312.006] -- 0:00:02 964000 -- (-1310.217) (-1316.615) (-1310.298) [-1313.064] * [-1310.803] (-1310.063) (-1311.091) (-1312.022) -- 0:00:02 964500 -- [-1310.453] (-1312.240) (-1310.459) (-1314.993) * (-1310.820) (-1310.896) [-1310.114] (-1310.087) -- 0:00:02 965000 -- (-1312.713) [-1310.202] (-1312.336) (-1313.041) * (-1312.017) [-1311.643] (-1314.318) (-1310.379) -- 0:00:02 Average standard deviation of split frequencies: 0.008387 965500 -- (-1310.235) [-1311.020] (-1316.867) (-1313.366) * [-1310.128] (-1314.215) (-1312.705) (-1310.395) -- 0:00:02 966000 -- (-1310.813) (-1311.009) [-1314.573] (-1313.342) * (-1310.840) [-1312.210] (-1314.748) (-1311.247) -- 0:00:02 966500 -- (-1311.253) (-1311.247) [-1312.296] (-1312.837) * (-1310.700) (-1310.269) [-1311.634] (-1313.420) -- 0:00:02 967000 -- [-1311.256] (-1311.965) (-1312.889) (-1311.984) * (-1310.767) [-1315.454] (-1312.674) (-1312.863) -- 0:00:02 967500 -- [-1313.513] (-1310.559) (-1310.854) (-1313.227) * (-1310.902) (-1312.763) (-1312.291) [-1312.086] -- 0:00:02 968000 -- [-1312.468] (-1313.331) (-1310.029) (-1310.919) * [-1312.662] (-1314.092) (-1313.244) (-1313.940) -- 0:00:02 968500 -- (-1313.802) (-1314.056) [-1313.495] (-1311.907) * [-1313.861] (-1310.129) (-1310.181) (-1310.244) -- 0:00:02 969000 -- (-1310.591) [-1313.173] (-1310.013) (-1310.937) * [-1314.303] (-1309.572) (-1312.301) (-1312.097) -- 0:00:01 969500 -- (-1309.959) (-1311.888) [-1311.281] (-1311.975) * (-1312.886) [-1312.517] (-1311.814) (-1312.654) -- 0:00:01 970000 -- (-1312.091) (-1313.572) [-1311.321] (-1310.050) * (-1313.631) (-1310.182) (-1312.515) [-1311.091] -- 0:00:01 Average standard deviation of split frequencies: 0.008074 970500 -- (-1313.361) [-1313.899] (-1311.371) (-1311.347) * (-1314.160) [-1310.817] (-1310.753) (-1313.886) -- 0:00:01 971000 -- (-1314.612) [-1311.995] (-1310.256) (-1313.822) * (-1312.538) (-1311.348) (-1313.269) [-1310.590] -- 0:00:01 971500 -- [-1314.838] (-1311.917) (-1310.921) (-1314.874) * (-1311.542) (-1312.186) [-1312.164] (-1310.026) -- 0:00:01 972000 -- (-1317.422) (-1310.734) [-1311.376] (-1310.575) * (-1311.766) (-1316.344) [-1310.573] (-1311.293) -- 0:00:01 972500 -- (-1317.156) [-1310.537] (-1314.480) (-1310.680) * (-1313.626) [-1313.853] (-1311.918) (-1313.975) -- 0:00:01 973000 -- (-1310.349) (-1311.243) (-1310.251) [-1310.424] * (-1311.170) [-1311.632] (-1311.560) (-1312.231) -- 0:00:01 973500 -- [-1315.672] (-1312.542) (-1312.262) (-1311.959) * (-1312.251) (-1311.207) (-1317.037) [-1311.443] -- 0:00:01 974000 -- (-1312.296) [-1312.034] (-1311.843) (-1310.878) * (-1316.613) [-1311.647] (-1311.957) (-1316.178) -- 0:00:01 974500 -- (-1310.741) [-1310.135] (-1314.257) (-1313.562) * [-1312.405] (-1313.847) (-1310.484) (-1314.673) -- 0:00:01 975000 -- (-1311.065) (-1311.790) [-1311.376] (-1316.539) * (-1314.736) (-1312.526) [-1310.775] (-1315.303) -- 0:00:01 Average standard deviation of split frequencies: 0.007728 975500 -- (-1315.866) [-1311.833] (-1310.596) (-1312.642) * (-1312.089) (-1313.732) (-1310.487) [-1312.650] -- 0:00:01 976000 -- (-1310.716) (-1312.943) (-1309.863) [-1311.330] * (-1311.283) (-1315.224) [-1312.341] (-1314.166) -- 0:00:01 976500 -- (-1312.465) (-1310.074) (-1310.983) [-1315.426] * (-1310.215) (-1311.572) (-1312.766) [-1314.523] -- 0:00:01 977000 -- (-1312.168) (-1312.664) [-1310.941] (-1313.414) * (-1311.507) [-1312.033] (-1310.582) (-1310.461) -- 0:00:01 977500 -- (-1310.932) (-1312.839) [-1310.323] (-1314.960) * (-1313.696) (-1311.787) (-1312.005) [-1310.168] -- 0:00:01 978000 -- (-1312.710) (-1313.172) (-1310.974) [-1315.245] * (-1311.903) (-1312.651) [-1310.383] (-1311.021) -- 0:00:01 978500 -- (-1318.593) (-1310.519) (-1315.788) [-1312.029] * (-1309.855) [-1312.204] (-1309.910) (-1310.295) -- 0:00:01 979000 -- (-1310.923) (-1317.034) [-1310.973] (-1317.360) * (-1311.252) (-1310.583) [-1310.702] (-1313.926) -- 0:00:01 979500 -- (-1310.355) (-1312.570) [-1313.327] (-1318.442) * (-1310.624) (-1310.989) [-1311.138] (-1311.770) -- 0:00:01 980000 -- [-1309.625] (-1311.243) (-1313.098) (-1312.102) * (-1310.536) [-1313.778] (-1313.368) (-1310.200) -- 0:00:01 Average standard deviation of split frequencies: 0.007451 980500 -- (-1311.389) (-1312.038) (-1314.450) [-1312.180] * (-1311.857) (-1313.432) [-1310.704] (-1312.951) -- 0:00:01 981000 -- [-1313.757] (-1309.880) (-1316.866) (-1312.203) * (-1311.640) [-1311.958] (-1315.544) (-1312.727) -- 0:00:01 981500 -- (-1314.031) [-1309.494] (-1312.320) (-1311.303) * (-1312.167) (-1311.241) [-1312.380] (-1314.800) -- 0:00:01 982000 -- (-1312.417) [-1314.477] (-1310.574) (-1314.954) * (-1314.523) (-1310.976) [-1311.198] (-1311.691) -- 0:00:01 982500 -- (-1313.556) (-1312.840) [-1309.863] (-1311.349) * (-1309.556) (-1312.129) [-1312.980] (-1313.835) -- 0:00:01 983000 -- (-1311.531) (-1311.694) (-1312.157) [-1310.713] * [-1310.630] (-1310.916) (-1315.273) (-1311.521) -- 0:00:01 983500 -- (-1313.190) (-1312.343) (-1310.888) [-1310.578] * (-1312.297) (-1311.774) (-1312.355) [-1310.891] -- 0:00:01 984000 -- (-1315.144) (-1312.045) (-1310.680) [-1309.868] * (-1311.266) (-1310.449) [-1310.229] (-1310.416) -- 0:00:01 984500 -- (-1311.880) (-1311.249) (-1309.911) [-1310.545] * (-1311.088) (-1311.016) [-1310.711] (-1311.320) -- 0:00:00 985000 -- (-1311.338) [-1312.580] (-1311.050) (-1312.407) * (-1309.712) (-1311.439) [-1312.655] (-1310.270) -- 0:00:00 Average standard deviation of split frequencies: 0.007440 985500 -- (-1311.449) [-1310.419] (-1309.778) (-1311.527) * (-1310.608) (-1310.968) [-1311.776] (-1310.078) -- 0:00:00 986000 -- [-1310.406] (-1312.383) (-1310.013) (-1310.899) * (-1311.168) (-1311.005) (-1313.738) [-1310.495] -- 0:00:00 986500 -- (-1309.853) (-1310.980) (-1311.312) [-1311.353] * (-1310.313) [-1311.010] (-1313.884) (-1310.645) -- 0:00:00 987000 -- (-1312.265) (-1312.014) (-1311.739) [-1312.328] * (-1311.355) [-1310.269] (-1315.075) (-1310.893) -- 0:00:00 987500 -- (-1314.363) [-1310.093] (-1316.766) (-1312.752) * (-1312.835) (-1311.314) (-1312.758) [-1311.722] -- 0:00:00 988000 -- (-1315.249) [-1313.628] (-1312.764) (-1310.581) * [-1310.377] (-1312.121) (-1311.812) (-1312.709) -- 0:00:00 988500 -- (-1313.141) [-1313.866] (-1311.389) (-1312.226) * (-1309.963) [-1313.798] (-1311.095) (-1311.975) -- 0:00:00 989000 -- (-1310.429) (-1311.374) [-1310.859] (-1313.265) * (-1310.799) (-1311.286) [-1309.863] (-1310.610) -- 0:00:00 989500 -- (-1312.092) (-1316.213) (-1313.166) [-1312.069] * (-1311.757) (-1311.260) (-1313.110) [-1310.572] -- 0:00:00 990000 -- (-1312.222) [-1310.572] (-1309.599) (-1310.503) * (-1312.461) (-1312.991) (-1311.959) [-1311.028] -- 0:00:00 Average standard deviation of split frequencies: 0.007167 990500 -- [-1310.276] (-1312.043) (-1310.338) (-1312.871) * (-1310.982) (-1311.186) (-1311.391) [-1309.994] -- 0:00:00 991000 -- (-1310.359) (-1311.848) [-1312.429] (-1315.845) * (-1311.668) (-1315.013) (-1312.198) [-1311.580] -- 0:00:00 991500 -- (-1311.216) [-1310.931] (-1311.767) (-1316.004) * (-1310.454) (-1312.994) [-1313.014] (-1312.653) -- 0:00:00 992000 -- (-1312.745) (-1311.220) (-1311.021) [-1314.386] * (-1314.437) (-1313.554) (-1311.847) [-1311.437] -- 0:00:00 992500 -- (-1311.939) (-1311.347) (-1313.460) [-1315.478] * (-1315.733) (-1312.440) [-1309.873] (-1310.653) -- 0:00:00 993000 -- (-1310.902) [-1311.382] (-1315.676) (-1310.824) * (-1317.924) (-1311.402) (-1311.498) [-1310.605] -- 0:00:00 993500 -- (-1311.785) (-1312.448) [-1313.728] (-1312.603) * (-1313.357) (-1311.995) (-1311.913) [-1313.007] -- 0:00:00 994000 -- [-1310.582] (-1315.171) (-1315.290) (-1314.605) * (-1312.276) [-1311.428] (-1311.057) (-1314.201) -- 0:00:00 994500 -- (-1310.479) [-1313.112] (-1314.979) (-1317.513) * (-1311.272) [-1311.475] (-1310.938) (-1313.106) -- 0:00:00 995000 -- (-1313.065) (-1311.974) (-1314.675) [-1314.425] * (-1311.229) [-1310.506] (-1312.306) (-1311.591) -- 0:00:00 Average standard deviation of split frequencies: 0.007454 995500 -- (-1312.943) [-1310.785] (-1313.049) (-1312.839) * (-1309.987) [-1312.483] (-1310.246) (-1312.221) -- 0:00:00 996000 -- (-1316.975) (-1312.234) [-1309.837] (-1312.881) * (-1312.294) (-1313.231) (-1310.457) [-1313.940] -- 0:00:00 996500 -- (-1314.747) (-1310.250) [-1312.241] (-1312.701) * (-1309.774) (-1316.277) (-1311.082) [-1309.698] -- 0:00:00 997000 -- (-1314.912) (-1311.888) (-1312.694) [-1314.447] * [-1316.627] (-1313.387) (-1311.195) (-1313.604) -- 0:00:00 997500 -- (-1310.444) (-1311.788) [-1312.466] (-1311.173) * [-1310.986] (-1314.284) (-1311.701) (-1310.150) -- 0:00:00 998000 -- (-1310.862) [-1313.240] (-1312.421) (-1312.863) * (-1312.156) (-1312.892) [-1310.352] (-1313.512) -- 0:00:00 998500 -- (-1311.330) (-1312.409) (-1312.647) [-1311.274] * (-1311.152) (-1312.981) [-1311.315] (-1312.263) -- 0:00:00 999000 -- (-1311.505) [-1311.654] (-1313.182) (-1312.338) * (-1314.647) [-1310.217] (-1311.424) (-1313.036) -- 0:00:00 999500 -- (-1311.012) (-1311.152) (-1311.528) [-1314.045] * (-1314.801) (-1310.760) [-1310.837] (-1312.111) -- 0:00:00 1000000 -- (-1311.625) (-1315.155) [-1311.968] (-1316.557) * (-1310.258) (-1317.453) [-1312.225] (-1313.445) -- 0:00:00 Average standard deviation of split frequencies: 0.007214 Analysis completed in 1 mins 5 seconds Analysis used 63.81 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1309.28 Likelihood of best state for "cold" chain of run 2 was -1309.28 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 74.5 % ( 74 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.1 % ( 22 %) Dirichlet(Pi{all}) 27.6 % ( 20 %) Slider(Pi{all}) 78.3 % ( 44 %) Multiplier(Alpha{1,2}) 78.1 % ( 56 %) Multiplier(Alpha{3}) 17.9 % ( 30 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 75 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.7 % ( 92 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 21 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.2 % ( 30 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.7 % ( 65 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.9 % ( 28 %) Dirichlet(Pi{all}) 27.5 % ( 20 %) Slider(Pi{all}) 77.9 % ( 56 %) Multiplier(Alpha{1,2}) 78.0 % ( 55 %) Multiplier(Alpha{3}) 18.2 % ( 29 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 23 %) Multiplier(V{all}) 97.3 % ( 98 %) Nodeslider(V{all}) 30.6 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166496 0.82 0.67 3 | 167259 166763 0.84 4 | 165790 165898 167794 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166537 0.82 0.67 3 | 166636 166386 0.84 4 | 166345 167213 166883 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1311.00 | 1 1 | | 2 | | 2 11 2 | | 2 2 1 2 1 | | 1 1 2 11 2 1 2| | 2 11 11 12 1 2 1 1 12 2 * | | 2 1 2 22 2 22 2 11 2 | | 1 11 1 1 12 1 1 22 1 1 | | 22 2 1 2 2 2 222 2 2 1 2 | |*2 12 2 1 12 1 * 1 21 | | 1 2 2 2 2 1 1 1 1 2121 | | 1 1 1 1 1 2 | | 2 2 2 1| | 2 2 22 1 | | 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1312.62 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1311.04 -1315.33 2 -1311.08 -1314.71 -------------------------------------- TOTAL -1311.06 -1315.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897537 0.088311 0.349811 1.468454 0.861408 1501.00 1501.00 1.000 r(A<->C){all} 0.155027 0.018344 0.000087 0.428765 0.117965 168.75 186.79 1.000 r(A<->G){all} 0.180336 0.021930 0.000017 0.476770 0.144739 176.25 185.70 1.012 r(A<->T){all} 0.162376 0.021250 0.000044 0.459630 0.117716 232.58 234.55 1.002 r(C<->G){all} 0.156855 0.017576 0.000082 0.420676 0.122711 189.69 203.86 1.001 r(C<->T){all} 0.170101 0.021729 0.000033 0.475770 0.127413 167.86 182.41 1.006 r(G<->T){all} 0.175305 0.021623 0.000042 0.466266 0.136539 219.62 247.68 1.001 pi(A){all} 0.131198 0.000119 0.109894 0.152280 0.130746 1245.33 1311.55 1.000 pi(C){all} 0.286043 0.000211 0.257285 0.313542 0.286202 1120.49 1162.44 1.000 pi(G){all} 0.339139 0.000225 0.310625 0.367955 0.338815 1154.20 1247.94 1.000 pi(T){all} 0.243620 0.000192 0.217796 0.271015 0.243330 1257.73 1308.37 1.000 alpha{1,2} 0.413422 0.208541 0.000239 1.345223 0.256986 1146.17 1225.13 1.000 alpha{3} 0.448497 0.225417 0.000137 1.450243 0.283781 1268.63 1336.92 1.000 pinvar{all} 0.998415 0.000003 0.994840 0.999998 0.998987 1091.50 1175.83 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- .**.** 9 -- ...*.* 10 -- ....** 11 -- .***.* 12 -- ...**. 13 -- ..*.*. 14 -- ..**** 15 -- .*...* 16 -- .*.*** 17 -- .*..*. 18 -- ..*..* 19 -- ..**.. 20 -- .*.*.. 21 -- .****. 22 -- .**.*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 460 0.153231 0.002827 0.151233 0.155230 2 8 447 0.148901 0.011777 0.140573 0.157229 2 9 446 0.148568 0.009422 0.141905 0.155230 2 10 441 0.146902 0.000471 0.146569 0.147235 2 11 438 0.145903 0.011306 0.137908 0.153897 2 12 436 0.145237 0.001884 0.143904 0.146569 2 13 435 0.144903 0.004240 0.141905 0.147901 2 14 435 0.144903 0.005182 0.141239 0.148568 2 15 429 0.142905 0.008009 0.137242 0.148568 2 16 421 0.140240 0.002355 0.138574 0.141905 2 17 418 0.139241 0.016959 0.127249 0.151233 2 18 417 0.138907 0.003298 0.136576 0.141239 2 19 416 0.138574 0.003769 0.135909 0.141239 2 20 404 0.134577 0.009422 0.127915 0.141239 2 21 404 0.134577 0.015075 0.123917 0.145237 2 22 282 0.093937 0.009422 0.087275 0.100600 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.102695 0.010279 0.000068 0.305028 0.074482 1.000 2 length{all}[2] 0.098257 0.010091 0.000059 0.298174 0.068940 1.000 2 length{all}[3] 0.101268 0.010056 0.000013 0.296160 0.072726 1.000 2 length{all}[4] 0.098749 0.009406 0.000058 0.300462 0.068921 1.000 2 length{all}[5] 0.098149 0.009582 0.000007 0.282976 0.070012 1.000 2 length{all}[6] 0.099525 0.009312 0.000113 0.291891 0.071457 1.000 2 length{all}[7] 0.093089 0.008727 0.000103 0.270612 0.064585 0.999 2 length{all}[8] 0.095757 0.008694 0.000060 0.248943 0.071037 1.000 2 length{all}[9] 0.097023 0.009237 0.000059 0.291957 0.062302 1.000 2 length{all}[10] 0.092318 0.008020 0.000152 0.263633 0.064935 1.005 2 length{all}[11] 0.103933 0.010450 0.000161 0.323694 0.072944 1.001 2 length{all}[12] 0.096872 0.009977 0.000020 0.303148 0.064174 1.001 2 length{all}[13] 0.093691 0.007628 0.000002 0.265360 0.066819 1.000 2 length{all}[14] 0.104342 0.010269 0.000001 0.317252 0.064464 1.000 2 length{all}[15] 0.105502 0.009444 0.000166 0.305286 0.077812 1.001 2 length{all}[16] 0.104205 0.008424 0.000131 0.278514 0.079956 0.998 2 length{all}[17] 0.098749 0.010727 0.000077 0.305675 0.069544 0.998 2 length{all}[18] 0.103122 0.009217 0.000024 0.310180 0.072758 1.007 2 length{all}[19] 0.096026 0.008657 0.000001 0.278071 0.071129 0.999 2 length{all}[20] 0.105595 0.013315 0.000170 0.340155 0.072547 0.998 2 length{all}[21] 0.098391 0.009436 0.000194 0.315399 0.071067 0.998 2 length{all}[22] 0.096905 0.011279 0.000400 0.273501 0.063738 0.996 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007214 Maximum standard deviation of split frequencies = 0.016959 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.007 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------- C2 (2) | |---------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------- C4 (4) | |-------------------------------------------------------------------- C5 (5) | \--------------------------------------------------------------------- C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 92 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 981 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 55 patterns at 327 / 327 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 55 patterns at 327 / 327 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 53680 bytes for conP 4840 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.100530 0.020901 0.045192 0.090704 0.086251 0.061789 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1387.949260 Iterating by ming2 Initial: fx= 1387.949260 x= 0.10053 0.02090 0.04519 0.09070 0.08625 0.06179 0.30000 1.30000 1 h-m-p 0.0000 0.0001 782.5585 ++ 1348.174620 m 0.0001 13 | 1/8 2 h-m-p 0.0009 0.0070 49.6880 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 715.9700 ++ 1309.277837 m 0.0001 44 | 2/8 4 h-m-p 0.0015 0.0121 32.7327 -----------.. | 2/8 5 h-m-p 0.0000 0.0001 642.4213 ++ 1287.826929 m 0.0001 75 | 3/8 6 h-m-p 0.0014 0.0262 20.6960 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 557.3179 ++ 1263.899822 m 0.0001 106 | 4/8 8 h-m-p 0.0026 0.1516 13.1984 ------------.. | 4/8 9 h-m-p 0.0000 0.0000 456.9496 ++ 1260.974144 m 0.0000 138 | 5/8 10 h-m-p 0.0160 8.0000 9.0737 -------------.. | 5/8 11 h-m-p 0.0000 0.0000 323.0826 ++ 1257.739643 m 0.0000 171 | 6/8 12 h-m-p 0.0588 8.0000 0.0000 ++++ 1257.739643 m 8.0000 184 | 6/8 13 h-m-p 0.0657 8.0000 0.0005 ++++ 1257.739643 m 8.0000 199 | 6/8 14 h-m-p 0.0383 8.0000 0.1010 ++C 1257.739643 0 0.8975 214 | 6/8 15 h-m-p 1.6000 8.0000 0.0006 C 1257.739643 0 0.6083 227 | 6/8 16 h-m-p 1.6000 8.0000 0.0001 Y 1257.739643 0 1.6000 240 | 6/8 17 h-m-p 1.6000 8.0000 0.0001 --C 1257.739643 0 0.0250 255 | 6/8 18 h-m-p 0.0696 8.0000 0.0000 -C 1257.739643 0 0.0044 269 | 6/8 19 h-m-p 0.2387 8.0000 0.0000 -----Y 1257.739643 0 0.0001 287 Out.. lnL = -1257.739643 288 lfun, 288 eigenQcodon, 1728 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.040227 0.031192 0.012204 0.103650 0.039990 0.108122 0.384668 0.821849 0.335798 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 11.343049 np = 9 lnL0 = -1363.633492 Iterating by ming2 Initial: fx= 1363.633492 x= 0.04023 0.03119 0.01220 0.10365 0.03999 0.10812 0.38467 0.82185 0.33580 1 h-m-p 0.0000 0.0000 756.8097 ++ 1341.141255 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0001 558.2848 ++ 1311.066814 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 1087.9643 ++ 1300.924305 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 795.2312 ++ 1300.679706 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0001 1213.5919 ++ 1259.303695 m 0.0001 62 | 5/9 6 h-m-p 0.0000 0.0000 488.6344 ++ 1257.739688 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0003 ++ 1257.739688 m 8.0000 86 | 6/9 8 h-m-p 0.2408 8.0000 0.0091 ------Y 1257.739688 0 0.0000 107 | 6/9 9 h-m-p 0.0160 8.0000 0.0001 --------C 1257.739688 0 0.0000 130 | 6/9 10 h-m-p 0.0160 8.0000 0.0000 +++++ 1257.739688 m 8.0000 148 | 6/9 11 h-m-p 0.0035 1.7302 0.3792 +++++ 1257.739650 m 1.7302 166 | 7/9 12 h-m-p 1.6000 8.0000 0.0279 ++ 1257.739649 m 8.0000 181 | 7/9 13 h-m-p 0.0679 0.3393 0.4394 ++ 1257.739648 m 0.3393 195 | 8/9 14 h-m-p 1.6000 8.0000 0.0000 C 1257.739648 0 1.6000 209 | 8/9 15 h-m-p 0.0160 8.0000 0.0000 N 1257.739648 0 0.0160 222 Out.. lnL = -1257.739648 223 lfun, 669 eigenQcodon, 2676 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.070958 0.098595 0.064995 0.093258 0.053434 0.057833 0.000100 1.282673 0.460799 0.121176 1.382156 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 11.855240 np = 11 lnL0 = -1385.915759 Iterating by ming2 Initial: fx= 1385.915759 x= 0.07096 0.09859 0.06500 0.09326 0.05343 0.05783 0.00011 1.28267 0.46080 0.12118 1.38216 1 h-m-p 0.0000 0.0000 646.4279 ++ 1385.353141 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0003 553.2010 +++ 1332.681040 m 0.0003 31 | 2/11 3 h-m-p 0.0003 0.0017 185.6354 ++ 1284.234401 m 0.0017 45 | 3/11 4 h-m-p 0.0002 0.0010 307.5524 ++ 1271.853396 m 0.0010 59 | 4/11 5 h-m-p 0.0000 0.0002 1677.3147 ++ 1265.893532 m 0.0002 73 | 5/11 6 h-m-p 0.0000 0.0000 41920.2524 ++ 1263.430842 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0000 1050560.5941 ++ 1261.928162 m 0.0000 101 | 7/11 8 h-m-p 0.0000 0.0000 45466.0946 ++ 1257.739653 m 0.0000 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0000 ++ 1257.739653 m 8.0000 129 | 8/11 10 h-m-p 0.1374 8.0000 0.0011 +++ 1257.739653 m 8.0000 147 | 8/11 11 h-m-p 0.0018 0.7856 4.6336 +++++ 1257.739649 m 0.7856 167 | 8/11 12 h-m-p -0.0000 -0.0000 0.0958 h-m-p: -0.00000000e+00 -0.00000000e+00 9.57958869e-02 1257.739649 .. | 8/11 13 h-m-p 0.0160 8.0000 0.0000 Y 1257.739649 0 0.0040 195 | 8/11 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1257.739649 m 8.0000 215 | 8/11 15 h-m-p 0.0160 8.0000 1.5807 +++Y 1257.739648 0 2.4916 235 | 8/11 16 h-m-p 1.6000 8.0000 0.1053 ++ 1257.739648 m 8.0000 249 | 8/11 17 h-m-p 1.3775 6.8874 0.4497 Y 1257.739648 0 0.2671 266 | 8/11 18 h-m-p 1.6000 8.0000 0.0054 C 1257.739648 0 1.6000 283 | 8/11 19 h-m-p 1.4069 8.0000 0.0062 ------N 1257.739648 0 0.0001 306 | 8/11 20 h-m-p 0.1951 8.0000 0.0000 Y 1257.739648 0 0.1951 323 | 8/11 21 h-m-p 0.0160 8.0000 0.0463 ------C 1257.739648 0 0.0000 346 | 8/11 22 h-m-p 0.0537 8.0000 0.0000 -C 1257.739648 0 0.0034 364 | 7/11 23 h-m-p 0.0160 8.0000 0.0000 +++++ 1257.739648 m 8.0000 384 | 7/11 24 h-m-p 0.0073 0.0364 0.0025 ---C 1257.739648 0 0.0000 405 | 7/11 25 h-m-p 0.0160 8.0000 0.0057 +++++ 1257.739647 m 8.0000 426 | 7/11 26 h-m-p 0.0082 0.0409 1.1193 -------C 1257.739647 0 0.0000 451 | 7/11 27 h-m-p 0.0160 8.0000 0.0000 +++++ 1257.739647 m 8.0000 468 | 7/11 28 h-m-p 0.0160 8.0000 0.0049 +++++ 1257.739647 m 8.0000 489 | 7/11 29 h-m-p 0.0070 0.0351 2.3168 --------C 1257.739647 0 0.0000 515 | 7/11 30 h-m-p 0.0183 8.0000 0.0000 Y 1257.739647 0 0.0046 529 | 7/11 31 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11 32 h-m-p 0.0160 8.0000 0.0000 -------Y 1257.739647 0 0.0000 583 Out.. lnL = -1257.739647 584 lfun, 2336 eigenQcodon, 10512 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1257.746829 S = -1257.733744 -0.005010 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:04 did 20 / 55 patterns 0:04 did 30 / 55 patterns 0:04 did 40 / 55 patterns 0:04 did 50 / 55 patterns 0:04 did 55 / 55 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.062662 0.096325 0.093514 0.106269 0.081419 0.038334 0.059375 0.256828 1.071666 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 20.009682 np = 9 lnL0 = -1400.195020 Iterating by ming2 Initial: fx= 1400.195020 x= 0.06266 0.09633 0.09351 0.10627 0.08142 0.03833 0.05938 0.25683 1.07167 1 h-m-p 0.0000 0.0001 673.6063 ++ 1336.085799 m 0.0001 14 | 1/9 2 h-m-p 0.0002 0.0010 79.6999 ++ 1330.584527 m 0.0010 26 | 2/9 3 h-m-p 0.0000 0.0000 4440.6234 ++ 1319.329683 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 16282.3575 ++ 1307.399176 m 0.0000 50 | 4/9 5 h-m-p 0.0001 0.0003 456.7697 ++ 1290.855919 m 0.0003 62 | 5/9 6 h-m-p 0.0001 0.0003 179.4333 ++ 1278.428985 m 0.0003 74 | 6/9 7 h-m-p 0.0001 0.0004 217.0390 ++ 1275.093986 m 0.0004 86 | 7/9 8 h-m-p 0.0138 6.8975 14.3345 -------------.. | 7/9 9 h-m-p 0.0000 0.0002 304.3970 +++ 1257.739672 m 0.0002 122 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 Y 1257.739672 0 1.6000 134 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1257.739672 m 8.0000 150 QuantileBeta(0.15, 0.00496, 0.49393) = 9.571963e-161 2000 rounds | 7/9 12 h-m-p 0.0421 0.2106 0.0001 ---Y 1257.739672 0 0.0002 167 QuantileBeta(0.15, 0.00496, 0.49393) = 9.560630e-161 2000 rounds | 7/9 13 h-m-p 0.0034 1.6953 0.0000 --C 1257.739672 0 0.0001 183 Out.. lnL = -1257.739672 184 lfun, 2024 eigenQcodon, 11040 P(t) Time used: 0:07 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.098771 0.029602 0.028686 0.051643 0.033964 0.070873 0.000100 0.900000 0.267385 1.222907 1.258533 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 17.257427 np = 11 lnL0 = -1350.725009 Iterating by ming2 Initial: fx= 1350.725009 x= 0.09877 0.02960 0.02869 0.05164 0.03396 0.07087 0.00011 0.90000 0.26739 1.22291 1.25853 1 h-m-p 0.0000 0.0000 672.0786 ++ 1350.109982 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0008 278.2149 ++++ 1301.010372 m 0.0008 32 | 2/11 3 h-m-p 0.0000 0.0000 3848.7107 ++ 1299.640686 m 0.0000 46 | 3/11 4 h-m-p 0.0000 0.0004 153.1967 ++ 1295.512627 m 0.0004 60 | 4/11 5 h-m-p 0.0000 0.0001 867.6963 ++ 1284.175087 m 0.0001 74 | 5/11 6 h-m-p 0.0000 0.0000 4411.0018 ++ 1281.878371 m 0.0000 88 | 6/11 7 h-m-p 0.0000 0.0000 5494.1347 ++ 1269.626360 m 0.0000 102 | 7/11 8 h-m-p 0.0023 0.0115 29.3677 ++ 1261.265236 m 0.0115 116 | 7/11 9 h-m-p 0.0001 0.0003 3569.1159 ---------.. | 7/11 10 h-m-p 0.0000 0.0000 320.8561 ++ 1257.739672 m 0.0000 151 | 8/11 11 h-m-p 1.6000 8.0000 0.0000 ++ 1257.739672 m 8.0000 165 | 8/11 12 h-m-p 0.3052 8.0000 0.0000 +++ 1257.739672 m 8.0000 183 | 8/11 13 h-m-p 0.0016 0.0223 0.0666 -----------.. | 8/11 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1257.739672 m 8.0000 229 | 8/11 15 h-m-p 0.0160 8.0000 0.0994 +++++ 1257.739647 m 8.0000 249 | 8/11 16 h-m-p 1.2093 6.0464 0.0337 ++ 1257.739646 m 6.0464 266 | 9/11 17 h-m-p 0.1546 8.0000 0.0003 +++ 1257.739646 m 8.0000 284 | 9/11 18 h-m-p 0.0160 8.0000 0.3140 +++++ 1257.739643 m 8.0000 303 | 9/11 19 h-m-p 1.6000 8.0000 0.5156 ++ 1257.739642 m 8.0000 319 | 9/11 20 h-m-p 1.6000 8.0000 1.3890 ++ 1257.739642 m 8.0000 335 | 9/11 21 h-m-p 0.0606 0.3031 7.1509 ++ 1257.739642 m 0.3031 349 | 9/11 22 h-m-p 1.5536 8.0000 1.3950 ---------C 1257.739642 0 0.0000 372 | 9/11 23 h-m-p 0.1111 0.5556 0.0000 --------Y 1257.739642 0 0.0000 394 Out.. lnL = -1257.739642 395 lfun, 4740 eigenQcodon, 26070 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1257.733147 S = -1257.731999 -0.000503 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:13 did 20 / 55 patterns 0:14 did 30 / 55 patterns 0:14 did 40 / 55 patterns 0:14 did 50 / 55 patterns 0:14 did 55 / 55 patterns 0:14 Time used: 0:14 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=327 NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV NC_002677_1_NP_302558_1_1430_ML2409 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV NZ_CP029543_1_WP_010908878_1_2601_ccsB MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV NZ_AP014567_1_WP_010908878_1_2666_ccsB MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV ************************************************** NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG NC_002677_1_NP_302558_1_1430_ML2409 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG NZ_CP029543_1_WP_010908878_1_2601_ccsB VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG NZ_AP014567_1_WP_010908878_1_2666_ccsB VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG ************************************************** NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL NC_002677_1_NP_302558_1_1430_ML2409 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL NZ_CP029543_1_WP_010908878_1_2601_ccsB LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL NZ_AP014567_1_WP_010908878_1_2666_ccsB LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL ************************************************** NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS NC_002677_1_NP_302558_1_1430_ML2409 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS NZ_CP029543_1_WP_010908878_1_2601_ccsB TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS NZ_AP014567_1_WP_010908878_1_2666_ccsB TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS ************************************************** NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG NC_002677_1_NP_302558_1_1430_ML2409 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG NZ_CP029543_1_WP_010908878_1_2601_ccsB TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG NZ_AP014567_1_WP_010908878_1_2666_ccsB TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG ************************************************** NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV NC_002677_1_NP_302558_1_1430_ML2409 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV NZ_CP029543_1_WP_010908878_1_2601_ccsB AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV NZ_AP014567_1_WP_010908878_1_2666_ccsB AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV ************************************************** NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 VGCVAMVFNLFFVNLVTVGLHSYAGVD NC_002677_1_NP_302558_1_1430_ML2409 VGCVAMVFNLFFVNLVTVGLHSYAGVD NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 VGCVAMVFNLFFVNLVTVGLHSYAGVD NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 VGCVAMVFNLFFVNLVTVGLHSYAGVD NZ_CP029543_1_WP_010908878_1_2601_ccsB VGCVAMVFNLFFVNLVTVGLHSYAGVD NZ_AP014567_1_WP_010908878_1_2666_ccsB VGCVAMVFNLFFVNLVTVGLHSYAGVD ***************************
>NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >NC_002677_1_NP_302558_1_1430_ML2409 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >NZ_CP029543_1_WP_010908878_1_2601_ccsB ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC >NZ_AP014567_1_WP_010908878_1_2666_ccsB ATGAACACTCTGCACGTCAACATCGGCCTGGCGTGCTACTCCGACTGGGC GTTCACCTCGGCCGTGGTGGCGTTGGTGGTCGCTCTGCTACTGTTGGCTT ACGAGCTAGCGTACGTTGGCAGCCGCCGGTTAGACAACCGCACGCGGGTG GTGCCCGGGTCGGTCGCCGCCGACAGCGGGACCCCCGGTATCGTGGTGGA CTCTCTGCAACGGCCGTTCGGCGAACGTGTCGGGCAGGCTGGGTTGGCCG TGGCCTACCTTGGCATCGGTCTCTTGCTAGCGTGCATATTGCTGCGCGGC CTGGCCACCCTGCGTGTGCCTTGGGGCAATATGTATGAGTTCATTAACCT GACCTGCTTCTCCGAGCTGGTCGCCGGCGCGATCGTGTTGCGTCGGCGAC AGTACCGCCCGCTGTGGGTTTTCTTGCTGGTGTCGGTGTTGATCCTGCTC ACGATTTCCGGTCGGTGGCTCTACGCCAACGCCGCACCGGTGATCCCGGC GCTGCAGTCCTACTGGCTGCCCATCCACGTGTCGGTGGTCAGCCTCGGCT CGGGGATTTTCCTGGTCGCCGGCATCGCCAGCATCTTGTTCCTGCTGAGC ACCTCGCGGCTGGTGGCCTCCGACCCCGAAGGTGCAAAGGCACTGGCCCG GCTGGTGCGGCGGTTCCCTGACGCACAGACCCTGGACCGGATCGCCTATC GAACGACGATCTTTGCGTTTCCGGTGTTTGGTTTCGGGGTGATCTTTGGT GCGATCTGGGCCGAGCAAGCCTGGGGCAGGTACTGGGGCTGGGATCCCAA GGAGACGGTTTCTTTTGTTGCGTGGGTAGTATACGCAGCTTATCTACATG CCAGGTCGACCGCGGGATGGCGGGACAGGAGGGCGGCGTGGATCAACGTG GTCGGGTGTGTTGCTATGGTCTTCAACCTGTTTTTCGTTAACCTGGTGAC TGTAGGTCTGCATTCGTATGCGGGAGTGGAC
>NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >NC_002677_1_NP_302558_1_1430_ML2409 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >NZ_CP029543_1_WP_010908878_1_2601_ccsB MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD >NZ_AP014567_1_WP_010908878_1_2666_ccsB MNTLHVNIGLACYSDWAFTSAVVALVVALLLLAYELAYVGSRRLDNRTRV VPGSVAADSGTPGIVVDSLQRPFGERVGQAGLAVAYLGIGLLLACILLRG LATLRVPWGNMYEFINLTCFSELVAGAIVLRRRQYRPLWVFLLVSVLILL TISGRWLYANAAPVIPALQSYWLPIHVSVVSLGSGIFLVAGIASILFLLS TSRLVASDPEGAKALARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFG AIWAEQAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRRAAWINV VGCVAMVFNLFFVNLVTVGLHSYAGVD
#NEXUS [ID: 5759037610] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 NC_002677_1_NP_302558_1_1430_ML2409 NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 NZ_CP029543_1_WP_010908878_1_2601_ccsB NZ_AP014567_1_WP_010908878_1_2666_ccsB ; end; begin trees; translate 1 NC_011896_1_WP_010908878_1_2574_MLBR_RS12260, 2 NC_002677_1_NP_302558_1_1430_ML2409, 3 NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235, 4 NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015, 5 NZ_CP029543_1_WP_010908878_1_2601_ccsB, 6 NZ_AP014567_1_WP_010908878_1_2666_ccsB ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07448151,2:0.06893967,3:0.07272638,4:0.06892101,5:0.07001199,6:0.07145658); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07448151,2:0.06893967,3:0.07272638,4:0.06892101,5:0.07001199,6:0.07145658); end;
Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1311.04 -1315.33 2 -1311.08 -1314.71 -------------------------------------- TOTAL -1311.06 -1315.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2409/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897537 0.088311 0.349811 1.468454 0.861408 1501.00 1501.00 1.000 r(A<->C){all} 0.155027 0.018344 0.000087 0.428765 0.117965 168.75 186.79 1.000 r(A<->G){all} 0.180336 0.021930 0.000017 0.476770 0.144739 176.25 185.70 1.012 r(A<->T){all} 0.162376 0.021250 0.000044 0.459630 0.117716 232.58 234.55 1.002 r(C<->G){all} 0.156855 0.017576 0.000082 0.420676 0.122711 189.69 203.86 1.001 r(C<->T){all} 0.170101 0.021729 0.000033 0.475770 0.127413 167.86 182.41 1.006 r(G<->T){all} 0.175305 0.021623 0.000042 0.466266 0.136539 219.62 247.68 1.001 pi(A){all} 0.131198 0.000119 0.109894 0.152280 0.130746 1245.33 1311.55 1.000 pi(C){all} 0.286043 0.000211 0.257285 0.313542 0.286202 1120.49 1162.44 1.000 pi(G){all} 0.339139 0.000225 0.310625 0.367955 0.338815 1154.20 1247.94 1.000 pi(T){all} 0.243620 0.000192 0.217796 0.271015 0.243330 1257.73 1308.37 1.000 alpha{1,2} 0.413422 0.208541 0.000239 1.345223 0.256986 1146.17 1225.13 1.000 alpha{3} 0.448497 0.225417 0.000137 1.450243 0.283781 1268.63 1336.92 1.000 pinvar{all} 0.998415 0.000003 0.994840 0.999998 0.998987 1091.50 1175.83 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2409/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 327 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 6 6 6 6 6 6 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 1 1 1 1 1 1 TTC 11 11 11 11 11 11 | TCC 5 5 5 5 5 5 | TAC 9 9 9 9 9 9 | TGC 3 3 3 3 3 3 Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 9 9 9 9 9 9 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 12 12 12 12 12 12 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3 CTC 4 4 4 4 4 4 | CCC 5 5 5 5 5 5 | CAC 2 2 2 2 2 2 | CGC 4 4 4 4 4 4 CTA 4 4 4 4 4 4 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2 CTG 25 25 25 25 25 25 | CCG 5 5 5 5 5 5 | CAG 4 4 4 4 4 4 | CGG 11 11 11 11 11 11 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0 ATC 14 14 14 14 14 14 | ACC 7 7 7 7 7 7 | AAC 8 8 8 8 8 8 | AGC 5 5 5 5 5 5 ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0 Met ATG 3 3 3 3 3 3 | ACG 5 5 5 5 5 5 | AAG 2 2 2 2 2 2 | AGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 6 6 6 | Ala GCT 5 5 5 5 5 5 | Asp GAT 1 1 1 1 1 1 | Gly GGT 7 7 7 7 7 7 GTC 9 9 9 9 9 9 | GCC 17 17 17 17 17 17 | GAC 9 9 9 9 9 9 | GGC 11 11 11 11 11 11 GTA 3 3 3 3 3 3 | GCA 5 5 5 5 5 5 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2 GTG 22 22 22 22 22 22 | GCG 14 14 14 14 14 14 | GAG 5 5 5 5 5 5 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908878_1_2574_MLBR_RS12260 position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 #2: NC_002677_1_NP_302558_1_1430_ML2409 position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 #3: NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235 position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 #4: NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015 position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 #5: NZ_CP029543_1_WP_010908878_1_2601_ccsB position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 #6: NZ_AP014567_1_WP_010908878_1_2666_ccsB position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 36 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 6 TTC 66 | TCC 30 | TAC 54 | TGC 18 Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 54 | TCG 48 | TAG 0 | Trp W TGG 72 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 18 CTC 24 | CCC 30 | CAC 12 | CGC 24 CTA 24 | CCA 0 | Gln Q CAA 12 | CGA 12 CTG 150 | CCG 30 | CAG 24 | CGG 66 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 0 ATC 84 | ACC 42 | AAC 48 | AGC 30 ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 0 Met M ATG 18 | ACG 30 | AAG 12 | AGG 24 ------------------------------------------------------------------------------ Val V GTT 36 | Ala A GCT 30 | Asp D GAT 6 | Gly G GGT 42 GTC 54 | GCC 102 | GAC 54 | GGC 66 GTA 18 | GCA 30 | Glu E GAA 12 | GGA 12 GTG 132 | GCG 84 | GAG 30 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.21713 C:0.23242 A:0.16820 G:0.38226 position 2: T:0.37309 C:0.25076 A:0.15596 G:0.22018 position 3: T:0.14067 C:0.37615 A:0.06728 G:0.41590 Average T:0.24363 C:0.28644 A:0.13048 G:0.33945 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1257.739643 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.384668 1.258533 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908878_1_2574_MLBR_RS12260: 0.000004, NC_002677_1_NP_302558_1_1430_ML2409: 0.000004, NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235: 0.000004, NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015: 0.000004, NZ_CP029543_1_WP_010908878_1_2601_ccsB: 0.000004, NZ_AP014567_1_WP_010908878_1_2666_ccsB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.38467 omega (dN/dS) = 1.25853 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 753.2 227.8 1.2585 0.0000 0.0000 0.0 0.0 7..2 0.000 753.2 227.8 1.2585 0.0000 0.0000 0.0 0.0 7..3 0.000 753.2 227.8 1.2585 0.0000 0.0000 0.0 0.0 7..4 0.000 753.2 227.8 1.2585 0.0000 0.0000 0.0 0.0 7..5 0.000 753.2 227.8 1.2585 0.0000 0.0000 0.0 0.0 7..6 0.000 753.2 227.8 1.2585 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1257.739648 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.550684 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908878_1_2574_MLBR_RS12260: 0.000004, NC_002677_1_NP_302558_1_1430_ML2409: 0.000004, NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235: 0.000004, NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015: 0.000004, NZ_CP029543_1_WP_010908878_1_2601_ccsB: 0.000004, NZ_AP014567_1_WP_010908878_1_2666_ccsB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.55068 0.44932 w: 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 757.0 224.0 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 757.0 224.0 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 757.0 224.0 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 757.0 224.0 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 757.0 224.0 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 757.0 224.0 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1257.739647 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.059375 0.015016 0.909446 0.000001 3.207287 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908878_1_2574_MLBR_RS12260: 0.000004, NC_002677_1_NP_302558_1_1430_ML2409: 0.000004, NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235: 0.000004, NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015: 0.000004, NZ_CP029543_1_WP_010908878_1_2601_ccsB: 0.000004, NZ_AP014567_1_WP_010908878_1_2666_ccsB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.05938 MLEs of dN/dS (w) for site classes (K=3) p: 0.01502 0.90945 0.07554 w: 0.00000 1.00000 3.20729 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 756.4 224.6 1.1517 0.0000 0.0000 0.0 0.0 7..2 0.000 756.4 224.6 1.1517 0.0000 0.0000 0.0 0.0 7..3 0.000 756.4 224.6 1.1517 0.0000 0.0000 0.0 0.0 7..4 0.000 756.4 224.6 1.1517 0.0000 0.0000 0.0 0.0 7..5 0.000 756.4 224.6 1.1517 0.0000 0.0000 0.0 0.0 7..6 0.000 756.4 224.6 1.1517 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908878_1_2574_MLBR_RS12260) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908878_1_2574_MLBR_RS12260) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1257.739672 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005020 0.493926 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908878_1_2574_MLBR_RS12260: 0.000004, NC_002677_1_NP_302558_1_1430_ML2409: 0.000004, NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235: 0.000004, NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015: 0.000004, NZ_CP029543_1_WP_010908878_1_2601_ccsB: 0.000004, NZ_AP014567_1_WP_010908878_1_2666_ccsB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00502 q = 0.49393 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00015 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 757.0 224.0 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 757.0 224.0 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 757.0 224.0 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 757.0 224.0 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 757.0 224.0 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 757.0 224.0 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:07 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1257.739642 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 21.333965 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908878_1_2574_MLBR_RS12260: 0.000004, NC_002677_1_NP_302558_1_1430_ML2409: 0.000004, NZ_LVXE01000073_1_WP_010908878_1_2620_A3216_RS13235: 0.000004, NZ_LYPH01000074_1_WP_010908878_1_2501_A8144_RS12015: 0.000004, NZ_CP029543_1_WP_010908878_1_2601_ccsB: 0.000004, NZ_AP014567_1_WP_010908878_1_2666_ccsB: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 0.00500 q = 0.00500 (p1 = 0.99999) w = 21.33397 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 21.33397 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 757.0 224.0 21.3338 0.0000 0.0000 0.0 0.0 7..2 0.000 757.0 224.0 21.3338 0.0000 0.0000 0.0 0.0 7..3 0.000 757.0 224.0 21.3338 0.0000 0.0000 0.0 0.0 7..4 0.000 757.0 224.0 21.3338 0.0000 0.0000 0.0 0.0 7..5 0.000 757.0 224.0 21.3338 0.0000 0.0000 0.0 0.0 7..6 0.000 757.0 224.0 21.3338 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908878_1_2574_MLBR_RS12260) Pr(w>1) post mean +- SE for w 1 M 1.000** 21.334 2 N 1.000** 21.334 3 T 1.000** 21.334 4 L 1.000** 21.334 5 H 1.000** 21.334 6 V 1.000** 21.334 7 N 1.000** 21.334 8 I 1.000** 21.334 9 G 1.000** 21.334 10 L 1.000** 21.334 11 A 1.000** 21.334 12 C 1.000** 21.334 13 Y 1.000** 21.334 14 S 1.000** 21.334 15 D 1.000** 21.334 16 W 1.000** 21.334 17 A 1.000** 21.334 18 F 1.000** 21.334 19 T 1.000** 21.334 20 S 1.000** 21.334 21 A 1.000** 21.334 22 V 1.000** 21.334 23 V 1.000** 21.334 24 A 1.000** 21.334 25 L 1.000** 21.334 26 V 1.000** 21.334 27 V 1.000** 21.334 28 A 1.000** 21.334 29 L 1.000** 21.334 30 L 1.000** 21.334 31 L 1.000** 21.334 32 L 1.000** 21.334 33 A 1.000** 21.334 34 Y 1.000** 21.334 35 E 1.000** 21.334 36 L 1.000** 21.334 37 A 1.000** 21.334 38 Y 1.000** 21.334 39 V 1.000** 21.334 40 G 1.000** 21.334 41 S 1.000** 21.334 42 R 1.000** 21.334 43 R 1.000** 21.334 44 L 1.000** 21.334 45 D 1.000** 21.334 46 N 1.000** 21.334 47 R 1.000** 21.334 48 T 1.000** 21.334 49 R 1.000** 21.334 50 V 1.000** 21.334 51 V 1.000** 21.334 52 P 1.000** 21.334 53 G 1.000** 21.334 54 S 1.000** 21.334 55 V 1.000** 21.334 56 A 1.000** 21.334 57 A 1.000** 21.334 58 D 1.000** 21.334 59 S 1.000** 21.334 60 G 1.000** 21.334 61 T 1.000** 21.334 62 P 1.000** 21.334 63 G 1.000** 21.334 64 I 1.000** 21.334 65 V 1.000** 21.334 66 V 1.000** 21.334 67 D 1.000** 21.334 68 S 1.000** 21.334 69 L 1.000** 21.334 70 Q 1.000** 21.334 71 R 1.000** 21.334 72 P 1.000** 21.334 73 F 1.000** 21.334 74 G 1.000** 21.334 75 E 1.000** 21.334 76 R 1.000** 21.334 77 V 1.000** 21.334 78 G 1.000** 21.334 79 Q 1.000** 21.334 80 A 1.000** 21.334 81 G 1.000** 21.334 82 L 1.000** 21.334 83 A 1.000** 21.334 84 V 1.000** 21.334 85 A 1.000** 21.334 86 Y 1.000** 21.334 87 L 1.000** 21.334 88 G 1.000** 21.334 89 I 1.000** 21.334 90 G 1.000** 21.334 91 L 1.000** 21.334 92 L 1.000** 21.334 93 L 1.000** 21.334 94 A 1.000** 21.334 95 C 1.000** 21.334 96 I 1.000** 21.334 97 L 1.000** 21.334 98 L 1.000** 21.334 99 R 1.000** 21.334 100 G 1.000** 21.334 101 L 1.000** 21.334 102 A 1.000** 21.334 103 T 1.000** 21.334 104 L 1.000** 21.334 105 R 1.000** 21.334 106 V 1.000** 21.334 107 P 1.000** 21.334 108 W 1.000** 21.334 109 G 1.000** 21.334 110 N 1.000** 21.334 111 M 1.000** 21.334 112 Y 1.000** 21.334 113 E 1.000** 21.334 114 F 1.000** 21.334 115 I 1.000** 21.334 116 N 1.000** 21.334 117 L 1.000** 21.334 118 T 1.000** 21.334 119 C 1.000** 21.334 120 F 1.000** 21.334 121 S 1.000** 21.334 122 E 1.000** 21.334 123 L 1.000** 21.334 124 V 1.000** 21.334 125 A 1.000** 21.334 126 G 1.000** 21.334 127 A 1.000** 21.334 128 I 1.000** 21.334 129 V 1.000** 21.334 130 L 1.000** 21.334 131 R 1.000** 21.334 132 R 1.000** 21.334 133 R 1.000** 21.334 134 Q 1.000** 21.334 135 Y 1.000** 21.334 136 R 1.000** 21.334 137 P 1.000** 21.334 138 L 1.000** 21.334 139 W 1.000** 21.334 140 V 1.000** 21.334 141 F 1.000** 21.334 142 L 1.000** 21.334 143 L 1.000** 21.334 144 V 1.000** 21.334 145 S 1.000** 21.334 146 V 1.000** 21.334 147 L 1.000** 21.334 148 I 1.000** 21.334 149 L 1.000** 21.334 150 L 1.000** 21.334 151 T 1.000** 21.334 152 I 1.000** 21.334 153 S 1.000** 21.334 154 G 1.000** 21.334 155 R 1.000** 21.334 156 W 1.000** 21.334 157 L 1.000** 21.334 158 Y 1.000** 21.334 159 A 1.000** 21.334 160 N 1.000** 21.334 161 A 1.000** 21.334 162 A 1.000** 21.334 163 P 1.000** 21.334 164 V 1.000** 21.334 165 I 1.000** 21.334 166 P 1.000** 21.334 167 A 1.000** 21.334 168 L 1.000** 21.334 169 Q 1.000** 21.334 170 S 1.000** 21.334 171 Y 1.000** 21.334 172 W 1.000** 21.334 173 L 1.000** 21.334 174 P 1.000** 21.334 175 I 1.000** 21.334 176 H 1.000** 21.334 177 V 1.000** 21.334 178 S 1.000** 21.334 179 V 1.000** 21.334 180 V 1.000** 21.334 181 S 1.000** 21.334 182 L 1.000** 21.334 183 G 1.000** 21.334 184 S 1.000** 21.334 185 G 1.000** 21.334 186 I 1.000** 21.334 187 F 1.000** 21.334 188 L 1.000** 21.334 189 V 1.000** 21.334 190 A 1.000** 21.334 191 G 1.000** 21.334 192 I 1.000** 21.334 193 A 1.000** 21.334 194 S 1.000** 21.334 195 I 1.000** 21.334 196 L 1.000** 21.334 197 F 1.000** 21.334 198 L 1.000** 21.334 199 L 1.000** 21.334 200 S 1.000** 21.334 201 T 1.000** 21.334 202 S 1.000** 21.334 203 R 1.000** 21.334 204 L 1.000** 21.334 205 V 1.000** 21.334 206 A 1.000** 21.334 207 S 1.000** 21.334 208 D 1.000** 21.334 209 P 1.000** 21.334 210 E 1.000** 21.334 211 G 1.000** 21.334 212 A 1.000** 21.334 213 K 1.000** 21.334 214 A 1.000** 21.334 215 L 1.000** 21.334 216 A 1.000** 21.334 217 R 1.000** 21.334 218 L 1.000** 21.334 219 V 1.000** 21.334 220 R 1.000** 21.334 221 R 1.000** 21.334 222 F 1.000** 21.334 223 P 1.000** 21.334 224 D 1.000** 21.334 225 A 1.000** 21.334 226 Q 1.000** 21.334 227 T 1.000** 21.334 228 L 1.000** 21.334 229 D 1.000** 21.334 230 R 1.000** 21.334 231 I 1.000** 21.334 232 A 1.000** 21.334 233 Y 1.000** 21.334 234 R 1.000** 21.334 235 T 1.000** 21.334 236 T 1.000** 21.334 237 I 1.000** 21.334 238 F 1.000** 21.334 239 A 1.000** 21.334 240 F 1.000** 21.334 241 P 1.000** 21.334 242 V 1.000** 21.334 243 F 1.000** 21.334 244 G 1.000** 21.334 245 F 1.000** 21.334 246 G 1.000** 21.334 247 V 1.000** 21.334 248 I 1.000** 21.334 249 F 1.000** 21.334 250 G 1.000** 21.334 251 A 1.000** 21.334 252 I 1.000** 21.334 253 W 1.000** 21.334 254 A 1.000** 21.334 255 E 1.000** 21.334 256 Q 1.000** 21.334 257 A 1.000** 21.334 258 W 1.000** 21.334 259 G 1.000** 21.334 260 R 1.000** 21.334 261 Y 1.000** 21.334 262 W 1.000** 21.334 263 G 1.000** 21.334 264 W 1.000** 21.334 265 D 1.000** 21.334 266 P 1.000** 21.334 267 K 1.000** 21.334 268 E 1.000** 21.334 269 T 1.000** 21.334 270 V 1.000** 21.334 271 S 1.000** 21.334 272 F 1.000** 21.334 273 V 1.000** 21.334 274 A 1.000** 21.334 275 W 1.000** 21.334 276 V 1.000** 21.334 277 V 1.000** 21.334 278 Y 1.000** 21.334 279 A 1.000** 21.334 280 A 1.000** 21.334 281 Y 1.000** 21.334 282 L 1.000** 21.334 283 H 1.000** 21.334 284 A 1.000** 21.334 285 R 1.000** 21.334 286 S 1.000** 21.334 287 T 1.000** 21.334 288 A 1.000** 21.334 289 G 1.000** 21.334 290 W 1.000** 21.334 291 R 1.000** 21.334 292 D 1.000** 21.334 293 R 1.000** 21.334 294 R 1.000** 21.334 295 A 1.000** 21.334 296 A 1.000** 21.334 297 W 1.000** 21.334 298 I 1.000** 21.334 299 N 1.000** 21.334 300 V 1.000** 21.334 301 V 1.000** 21.334 302 G 1.000** 21.334 303 C 1.000** 21.334 304 V 1.000** 21.334 305 A 1.000** 21.334 306 M 1.000** 21.334 307 V 1.000** 21.334 308 F 1.000** 21.334 309 N 1.000** 21.334 310 L 1.000** 21.334 311 F 1.000** 21.334 312 F 1.000** 21.334 313 V 1.000** 21.334 314 N 1.000** 21.334 315 L 1.000** 21.334 316 V 1.000** 21.334 317 T 1.000** 21.334 318 V 1.000** 21.334 319 G 1.000** 21.334 320 L 1.000** 21.334 321 H 1.000** 21.334 322 S 1.000** 21.334 323 Y 1.000** 21.334 324 A 1.000** 21.334 325 G 1.000** 21.334 326 V 1.000** 21.334 327 D 1.000** 21.334 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908878_1_2574_MLBR_RS12260) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:14
Model 1: NearlyNeutral -1257.739648 Model 2: PositiveSelection -1257.739647 Model 0: one-ratio -1257.739643 Model 7: beta -1257.739672 Model 8: beta&w>1 -1257.739642 Model 0 vs 1 1.0000000202126103E-5 Model 2 vs 1 1.99999976757681E-6 Model 8 vs 7 5.999999984851456E-5