--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:01:07 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2412/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.66 -906.14
2 -902.64 -906.21
--------------------------------------
TOTAL -902.65 -906.17
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889579 0.087241 0.396641 1.511872 0.852410 1240.61 1370.80 1.000
r(A<->C){all} 0.155363 0.018058 0.000202 0.428644 0.121008 152.62 210.84 1.001
r(A<->G){all} 0.167922 0.019534 0.000037 0.444673 0.131415 153.98 214.84 1.001
r(A<->T){all} 0.169140 0.020263 0.000006 0.460679 0.132292 253.65 258.09 1.003
r(C<->G){all} 0.169449 0.020989 0.000014 0.461038 0.128583 228.04 264.30 1.001
r(C<->T){all} 0.171922 0.020628 0.000064 0.458504 0.138292 199.31 205.97 1.000
r(G<->T){all} 0.166205 0.018431 0.000272 0.449495 0.132479 238.97 260.16 1.001
pi(A){all} 0.176339 0.000211 0.149150 0.205242 0.176138 1012.04 1098.07 1.000
pi(C){all} 0.291586 0.000299 0.261185 0.327657 0.291360 1189.19 1192.82 1.000
pi(G){all} 0.332044 0.000327 0.298284 0.369606 0.331981 1254.55 1294.17 1.000
pi(T){all} 0.200031 0.000232 0.170693 0.228778 0.199735 1177.42 1245.16 1.000
alpha{1,2} 0.411149 0.225798 0.000102 1.374844 0.242939 1197.19 1285.79 1.000
alpha{3} 0.447421 0.222329 0.000186 1.411529 0.287371 1198.04 1266.06 1.000
pinvar{all} 0.997592 0.000009 0.991999 1.000000 0.998552 1217.19 1258.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -852.835136
Model 2: PositiveSelection -852.835102
Model 0: one-ratio -852.835267
Model 7: beta -852.835102
Model 8: beta&w>1 -852.835231
Model 0 vs 1 2.620000000206346E-4
Model 2 vs 1 6.800000005569018E-5
Model 8 vs 7 2.5800000003073364E-4
>C1
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C2
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C3
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C4
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C5
MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
RVAHETVAGQLPRGTSoooooo
>C6
MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
RVAHETVAGQLPRGTSoooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=228
C1 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
C2 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
C3 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
C4 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
C5 ------MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
C6 ------MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
********************************************
C1 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
C2 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
C3 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
C4 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
C5 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
C6 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
**************************************************
C1 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
C2 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
C3 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
C4 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
C5 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
C6 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
**************************************************
C1 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
C2 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
C3 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
C4 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
C5 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
C6 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
**************************************************
C1 LQPVVARVAHETVAGQLPRGTS------
C2 LQPVVARVAHETVAGQLPRGTS------
C3 LQPVVARVAHETVAGQLPRGTS------
C4 LQPVVARVAHETVAGQLPRGTS------
C5 LQPVVARVAHETVAGQLPRGTSoooooo
C6 LQPVVARVAHETVAGQLPRGTSoooooo
**********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 222 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 222 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6692]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6692]--->[6660]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.770 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
C2 MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
C3 MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
C4 MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
C5 MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
C6 MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDG
**************************************************
C1 KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
C2 KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
C3 KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
C4 KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
C5 KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
C6 KTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINVWGQWCG
**************************************************
C1 PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
C2 PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
C3 PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
C4 PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
C5 PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
C6 PCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSI
**************************************************
C1 YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
C2 YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
C3 YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
C4 YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
C5 YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
C6 YDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVA
**************************************************
C1 RVAHETVAGQLPRGTS
C2 RVAHETVAGQLPRGTS
C3 RVAHETVAGQLPRGTS
C4 RVAHETVAGQLPRGTS
C5 RVAHETVAGQLPRGTS
C6 RVAHETVAGQLPRGTS
****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
C2 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
C3 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
C4 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
C5 ------------------ATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
C6 ------------------ATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
********************************
C1 CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
C2 CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
C3 CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
C4 CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
C5 CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
C6 CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
**************************************************
C1 TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
C2 TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
C3 TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
C4 TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
C5 TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
C6 TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
**************************************************
C1 TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
C2 TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
C3 TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
C4 TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
C5 TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
C6 TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
**************************************************
C1 CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
C2 CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
C3 CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
C4 CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
C5 CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
C6 CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
**************************************************
C1 GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
C2 GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
C3 GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
C4 GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
C5 GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
C6 GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
**************************************************
C1 TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
C2 TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
C3 TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
C4 TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
C5 TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
C6 TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
**************************************************
C1 GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
C2 GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
C3 GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
C4 GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
C5 GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
C6 GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
**************************************************
C1 TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
C2 TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
C3 TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
C4 TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
C5 TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
C6 TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
**************************************************
C1 GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
C2 GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
C3 GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
C4 GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
C5 GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
C6 GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
**************************************************
C1 CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
C2 CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
C3 CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
C4 CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
C5 CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
C6 CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
**************************************************
C1 GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
C2 GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
C3 GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
C4 GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
C5 GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
C6 GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
**************************************************
C1 TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
C2 TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
C3 TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
C4 TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
C5 TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
C6 TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
**************************************************
C1 GCCGCGGGGAACGTCA------------------
C2 GCCGCGGGGAACGTCA------------------
C3 GCCGCGGGGAACGTCA------------------
C4 GCCGCGGGGAACGTCA------------------
C5 GCCGCGGGGAACGTCA------------------
C6 GCCGCGGGGAACGTCA------------------
****************
>C1
TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
GCCGCGGGGAACGTCA------------------
>C2
TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
GCCGCGGGGAACGTCA------------------
>C3
TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
GCCGCGGGGAACGTCA------------------
>C4
TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
GCCGCGGGGAACGTCA------------------
>C5
------------------ATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
GCCGCGGGGAACGTCA------------------
>C6
------------------ATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC
CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC
TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA
TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG
CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC
GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT
TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA
GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG
TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG
GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT
CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC
GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT
TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT
GCCGCGGGGAACGTCA------------------
>C1
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C2
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C3
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C4
LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C5
ooooooMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
>C6
ooooooMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
LQPVVARVAHETVAGQLPRGTS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 684 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856374
Setting output file names to "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1713621896
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5043817053
Seed = 56725764
Swapseed = 1579856374
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 7 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1485.485907 -- -24.965149
Chain 2 -- -1487.032373 -- -24.965149
Chain 3 -- -1487.032371 -- -24.965149
Chain 4 -- -1487.032373 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1487.098962 -- -24.965149
Chain 2 -- -1485.485906 -- -24.965149
Chain 3 -- -1487.032287 -- -24.965149
Chain 4 -- -1487.032371 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1485.486] (-1487.032) (-1487.032) (-1487.032) * [-1487.099] (-1485.486) (-1487.032) (-1487.032)
500 -- (-911.802) (-913.125) (-916.450) [-919.135] * (-930.182) (-915.982) [-919.405] (-927.413) -- 0:00:00
1000 -- (-910.854) [-912.639] (-910.854) (-914.359) * [-914.230] (-913.213) (-912.236) (-914.142) -- 0:00:00
1500 -- (-913.690) (-919.317) [-911.517] (-912.463) * (-914.349) (-915.293) (-913.171) [-905.003] -- 0:00:00
2000 -- (-912.695) [-908.738] (-909.145) (-914.534) * (-913.967) (-916.995) [-909.650] (-913.161) -- 0:00:00
2500 -- (-913.518) (-919.556) (-906.320) [-912.278] * (-908.992) [-910.526] (-905.006) (-907.251) -- 0:06:39
3000 -- [-909.150] (-911.191) (-910.609) (-909.115) * [-908.740] (-912.100) (-907.109) (-912.741) -- 0:05:32
3500 -- (-913.791) [-914.682] (-914.851) (-912.328) * (-916.863) (-915.489) [-909.642] (-916.350) -- 0:04:44
4000 -- (-915.529) (-916.542) (-914.501) [-907.483] * (-918.232) [-906.573] (-912.192) (-908.689) -- 0:04:09
4500 -- [-913.867] (-922.662) (-919.345) (-915.099) * (-910.201) [-915.122] (-923.043) (-910.470) -- 0:03:41
5000 -- (-918.114) [-914.797] (-912.048) (-915.188) * (-912.133) [-910.017] (-908.588) (-910.097) -- 0:03:19
Average standard deviation of split frequencies: 0.113486
5500 -- [-917.359] (-911.162) (-911.531) (-914.635) * (-912.421) [-911.744] (-913.554) (-910.936) -- 0:03:00
6000 -- (-914.018) [-910.032] (-909.338) (-915.750) * (-911.873) [-909.230] (-912.020) (-916.878) -- 0:02:45
6500 -- [-909.037] (-911.923) (-909.029) (-912.934) * (-911.640) (-912.123) (-918.630) [-920.677] -- 0:02:32
7000 -- (-913.068) (-912.126) (-914.028) [-909.414] * (-915.705) [-910.084] (-926.934) (-921.507) -- 0:02:21
7500 -- (-914.495) (-920.405) [-916.151] (-913.932) * (-912.265) (-914.762) [-909.137] (-923.652) -- 0:02:12
8000 -- (-920.745) [-912.111] (-908.338) (-919.055) * (-918.156) (-912.973) [-913.741] (-910.703) -- 0:02:04
8500 -- (-914.894) [-911.905] (-912.783) (-918.043) * (-913.157) (-909.262) [-912.824] (-916.142) -- 0:01:56
9000 -- (-913.663) (-916.206) (-905.192) [-913.193] * (-911.327) [-918.816] (-908.018) (-921.861) -- 0:01:50
9500 -- (-909.727) [-915.538] (-916.552) (-914.800) * (-915.991) (-914.198) (-910.627) [-913.339] -- 0:01:44
10000 -- [-911.406] (-912.071) (-910.758) (-910.983) * (-909.463) (-915.274) [-910.444] (-908.609) -- 0:01:39
Average standard deviation of split frequencies: 0.076335
10500 -- (-910.899) [-912.136] (-915.743) (-915.640) * [-912.167] (-915.241) (-912.117) (-913.583) -- 0:01:34
11000 -- [-911.087] (-906.782) (-918.189) (-915.207) * (-916.753) (-916.368) [-906.612] (-913.745) -- 0:01:29
11500 -- (-917.065) (-909.809) [-915.208] (-907.505) * (-916.241) (-917.122) [-909.699] (-914.659) -- 0:01:25
12000 -- (-913.907) [-915.606] (-918.677) (-920.501) * (-913.694) [-907.913] (-920.499) (-915.015) -- 0:01:22
12500 -- (-916.171) (-918.793) [-909.822] (-912.254) * [-911.860] (-905.300) (-907.654) (-919.627) -- 0:01:19
13000 -- (-913.454) (-912.457) (-915.915) [-925.588] * (-917.161) (-902.028) [-913.133] (-912.411) -- 0:01:15
13500 -- (-910.304) (-918.577) [-914.278] (-911.889) * (-908.354) (-902.398) (-919.528) [-908.980] -- 0:01:13
14000 -- (-911.497) [-907.471] (-926.269) (-920.160) * (-915.994) [-905.069] (-915.833) (-911.855) -- 0:01:10
14500 -- [-910.264] (-905.816) (-911.418) (-904.677) * (-912.959) (-903.048) [-912.980] (-910.855) -- 0:01:07
15000 -- [-907.572] (-908.429) (-917.295) (-902.995) * (-911.237) (-905.447) (-917.255) [-909.451] -- 0:02:11
Average standard deviation of split frequencies: 0.074996
15500 -- (-908.453) (-917.198) (-910.266) [-904.159] * (-917.448) [-902.738] (-920.486) (-908.911) -- 0:02:07
16000 -- [-911.535] (-918.159) (-913.638) (-903.815) * (-915.492) [-902.693] (-920.950) (-912.421) -- 0:02:03
16500 -- [-911.869] (-914.106) (-910.599) (-905.935) * [-907.955] (-903.941) (-922.125) (-912.540) -- 0:01:59
17000 -- [-912.785] (-907.532) (-915.316) (-904.759) * (-917.573) (-902.805) [-906.440] (-919.493) -- 0:01:55
17500 -- (-917.256) [-912.000] (-911.429) (-904.249) * (-907.722) (-904.365) (-911.574) [-906.151] -- 0:01:52
18000 -- [-907.143] (-911.331) (-909.132) (-902.794) * (-916.453) (-904.645) (-924.153) [-917.505] -- 0:01:49
18500 -- (-911.568) [-912.707] (-917.532) (-911.622) * (-907.843) (-903.476) [-919.469] (-918.758) -- 0:01:46
19000 -- (-917.744) (-917.990) (-912.078) [-907.064] * [-915.212] (-902.794) (-916.348) (-922.587) -- 0:01:43
19500 -- (-912.684) (-915.501) (-917.730) [-903.799] * [-911.218] (-903.260) (-910.236) (-909.389) -- 0:01:40
20000 -- [-912.397] (-913.450) (-916.904) (-907.033) * [-913.523] (-902.917) (-908.512) (-905.291) -- 0:01:38
Average standard deviation of split frequencies: 0.083636
20500 -- (-914.841) (-911.082) (-911.519) [-902.684] * (-913.025) (-904.150) (-905.872) [-909.334] -- 0:01:35
21000 -- (-912.484) [-913.016] (-919.317) (-901.433) * (-911.230) (-903.850) (-905.045) [-912.753] -- 0:01:33
21500 -- (-912.051) (-919.180) (-913.164) [-902.485] * (-915.612) (-903.857) (-904.393) [-915.730] -- 0:01:31
22000 -- (-920.048) (-913.525) [-915.209] (-901.801) * (-912.335) (-905.637) [-902.694] (-908.650) -- 0:01:28
22500 -- (-920.551) [-910.088] (-904.623) (-903.886) * (-916.403) [-904.462] (-902.719) (-914.569) -- 0:01:26
23000 -- (-912.174) [-913.939] (-903.749) (-901.668) * (-917.576) (-909.816) [-903.663] (-919.641) -- 0:01:24
23500 -- (-910.042) (-919.213) (-903.216) [-903.685] * [-910.321] (-904.682) (-910.701) (-910.223) -- 0:01:23
24000 -- (-910.735) (-913.884) [-902.060] (-904.347) * (-908.064) (-903.651) [-902.855] (-922.151) -- 0:01:21
24500 -- (-917.643) [-907.160] (-902.868) (-902.803) * [-907.940] (-903.141) (-907.195) (-908.484) -- 0:01:19
25000 -- (-912.022) (-913.088) [-902.870] (-901.843) * [-909.792] (-905.456) (-906.250) (-902.860) -- 0:01:18
Average standard deviation of split frequencies: 0.061810
25500 -- (-914.115) [-914.973] (-906.169) (-903.979) * (-909.267) (-905.049) [-902.401] (-905.463) -- 0:01:16
26000 -- [-907.247] (-917.247) (-905.320) (-905.464) * [-909.620] (-903.865) (-901.439) (-905.529) -- 0:01:14
26500 -- [-910.738] (-913.443) (-902.532) (-903.910) * (-922.403) (-903.545) [-901.410] (-906.935) -- 0:01:13
27000 -- (-909.872) (-915.225) (-903.393) [-903.782] * [-914.207] (-904.237) (-903.172) (-903.033) -- 0:01:12
27500 -- (-909.502) (-919.776) (-905.218) [-902.751] * (-912.096) [-904.422] (-909.500) (-902.950) -- 0:01:10
28000 -- (-911.743) (-916.396) (-907.803) [-903.636] * [-914.914] (-907.893) (-906.511) (-906.127) -- 0:01:44
28500 -- (-924.158) (-910.827) (-904.934) [-906.422] * (-914.742) [-908.889] (-903.169) (-904.427) -- 0:01:42
29000 -- (-915.768) [-909.232] (-902.769) (-902.890) * (-911.886) [-902.523] (-905.928) (-903.400) -- 0:01:40
29500 -- (-916.334) [-915.489] (-904.258) (-904.293) * (-909.336) [-902.327] (-906.189) (-902.746) -- 0:01:38
30000 -- [-916.244] (-920.828) (-905.286) (-901.012) * [-915.293] (-903.162) (-905.624) (-903.616) -- 0:01:37
Average standard deviation of split frequencies: 0.052264
30500 -- [-906.330] (-908.226) (-907.146) (-901.263) * (-916.231) (-903.095) (-902.320) [-903.563] -- 0:01:35
31000 -- [-911.692] (-908.854) (-902.504) (-901.920) * (-914.585) (-903.195) [-902.585] (-904.854) -- 0:01:33
31500 -- (-913.785) (-911.311) [-905.111] (-901.573) * [-910.312] (-903.706) (-904.327) (-905.222) -- 0:01:32
32000 -- (-908.868) [-905.679] (-902.028) (-902.956) * (-913.921) (-904.322) (-902.344) [-904.504] -- 0:01:30
32500 -- (-908.882) (-918.536) (-901.958) [-902.824] * (-918.099) (-905.659) [-903.105] (-903.568) -- 0:01:29
33000 -- [-918.598] (-911.075) (-903.344) (-902.340) * (-916.958) (-907.461) [-903.443] (-906.241) -- 0:01:27
33500 -- (-924.673) (-914.608) [-906.408] (-902.329) * [-912.550] (-905.302) (-901.687) (-908.899) -- 0:01:26
34000 -- (-918.398) [-910.758] (-903.578) (-903.234) * (-920.227) [-902.732] (-903.364) (-905.103) -- 0:01:25
34500 -- (-914.663) (-910.429) (-905.304) [-903.469] * (-911.030) (-905.432) [-904.235] (-904.663) -- 0:01:23
35000 -- [-911.112] (-911.012) (-905.853) (-901.139) * (-913.275) (-903.573) (-901.784) [-906.767] -- 0:01:22
Average standard deviation of split frequencies: 0.052378
35500 -- (-916.693) (-906.871) (-904.116) [-902.467] * (-908.164) (-903.041) [-902.065] (-901.331) -- 0:01:21
36000 -- (-909.268) (-915.360) (-905.156) [-908.095] * (-916.470) [-901.750] (-902.740) (-905.152) -- 0:01:20
36500 -- (-916.054) (-912.218) (-902.411) [-909.515] * (-914.574) (-905.868) (-901.920) [-903.054] -- 0:01:19
37000 -- [-908.622] (-920.244) (-906.055) (-905.504) * (-914.731) (-904.487) [-902.738] (-903.822) -- 0:01:18
37500 -- (-915.686) (-915.392) (-903.478) [-903.881] * (-915.836) [-904.563] (-903.533) (-904.671) -- 0:01:17
38000 -- (-912.724) (-913.594) (-904.182) [-905.746] * [-913.951] (-903.765) (-902.663) (-904.648) -- 0:01:15
38500 -- (-915.469) (-914.317) [-902.024] (-905.456) * [-908.133] (-904.055) (-904.524) (-904.411) -- 0:01:14
39000 -- (-919.789) (-915.027) [-901.393] (-903.181) * [-912.067] (-904.584) (-908.543) (-902.885) -- 0:01:13
39500 -- [-913.722] (-908.805) (-902.814) (-903.220) * (-911.141) (-903.516) [-903.285] (-904.558) -- 0:01:12
40000 -- (-912.566) (-907.276) (-902.936) [-903.372] * [-906.742] (-902.464) (-902.866) (-903.188) -- 0:01:12
Average standard deviation of split frequencies: 0.047588
40500 -- (-910.979) [-919.325] (-901.903) (-904.433) * [-911.409] (-903.640) (-901.723) (-902.643) -- 0:01:11
41000 -- (-906.833) (-919.549) (-902.861) [-904.435] * [-905.636] (-904.502) (-901.944) (-903.120) -- 0:01:33
41500 -- (-912.444) (-922.007) [-903.043] (-904.023) * (-909.941) (-902.801) [-901.469] (-901.767) -- 0:01:32
42000 -- (-913.739) [-911.652] (-902.406) (-906.543) * [-924.436] (-906.602) (-901.995) (-902.502) -- 0:01:31
42500 -- (-908.288) (-913.636) [-903.851] (-904.229) * (-915.695) [-905.545] (-903.512) (-902.060) -- 0:01:30
43000 -- [-912.881] (-907.401) (-904.108) (-903.596) * [-908.683] (-903.500) (-903.276) (-901.905) -- 0:01:29
43500 -- (-913.255) (-907.135) [-903.428] (-902.312) * (-913.036) (-905.547) (-903.654) [-902.959] -- 0:01:27
44000 -- [-918.106] (-903.756) (-901.526) (-904.290) * (-920.742) [-901.779] (-903.322) (-902.582) -- 0:01:26
44500 -- (-918.206) [-904.848] (-903.191) (-905.554) * (-918.549) (-903.068) [-902.328] (-903.760) -- 0:01:25
45000 -- [-913.411] (-903.177) (-903.029) (-902.346) * (-912.774) (-902.773) (-905.853) [-903.693] -- 0:01:24
Average standard deviation of split frequencies: 0.033306
45500 -- (-911.456) (-902.408) [-903.178] (-902.222) * (-914.100) (-902.254) [-903.084] (-905.158) -- 0:01:23
46000 -- (-910.750) [-903.003] (-902.996) (-910.325) * (-920.247) [-901.859] (-904.364) (-904.386) -- 0:01:22
46500 -- (-914.266) (-901.780) (-902.694) [-901.866] * (-909.410) (-903.184) [-902.665] (-906.109) -- 0:01:22
47000 -- (-911.386) [-905.424] (-904.093) (-902.216) * [-918.540] (-903.044) (-905.682) (-903.291) -- 0:01:21
47500 -- (-909.231) [-902.720] (-903.213) (-904.189) * (-917.776) [-902.231] (-905.585) (-901.568) -- 0:01:20
48000 -- [-914.690] (-903.732) (-904.019) (-902.238) * (-918.614) [-903.079] (-902.961) (-901.668) -- 0:01:19
48500 -- (-928.700) (-902.496) [-903.346] (-904.383) * [-913.774] (-902.648) (-903.104) (-902.209) -- 0:01:18
49000 -- (-914.544) (-902.936) (-903.281) [-903.654] * (-909.670) [-904.612] (-905.229) (-905.863) -- 0:01:17
49500 -- (-903.467) (-901.824) [-903.285] (-907.712) * (-912.056) (-906.224) (-904.168) [-906.116] -- 0:01:16
50000 -- (-901.549) [-901.500] (-903.389) (-905.567) * [-907.565] (-901.726) (-904.372) (-903.456) -- 0:01:16
Average standard deviation of split frequencies: 0.035821
50500 -- (-902.849) (-901.819) [-901.106] (-902.440) * (-911.313) (-902.120) (-906.192) [-903.248] -- 0:01:15
51000 -- (-903.636) (-903.966) (-902.178) [-908.801] * [-906.774] (-903.270) (-902.365) (-903.104) -- 0:01:14
51500 -- (-903.371) (-902.853) [-902.683] (-905.033) * (-911.772) (-908.948) (-904.044) [-901.971] -- 0:01:13
52000 -- [-905.271] (-906.362) (-905.542) (-905.613) * (-914.178) (-912.812) [-902.211] (-905.621) -- 0:01:12
52500 -- (-903.853) [-906.519] (-903.517) (-905.931) * (-915.896) (-905.830) [-903.682] (-902.587) -- 0:01:12
53000 -- (-905.919) (-904.812) [-905.373] (-904.883) * (-919.063) (-903.149) (-908.051) [-903.896] -- 0:01:11
53500 -- (-902.174) (-903.159) [-903.412] (-904.815) * (-915.159) (-905.828) (-903.501) [-904.320] -- 0:01:10
54000 -- (-904.197) [-903.810] (-904.387) (-905.442) * [-911.760] (-902.922) (-902.549) (-903.984) -- 0:01:27
54500 -- [-902.466] (-904.954) (-902.186) (-904.713) * (-918.909) (-903.950) (-903.960) [-903.978] -- 0:01:26
55000 -- [-908.439] (-905.693) (-904.067) (-903.556) * (-918.856) (-904.234) [-907.693] (-903.631) -- 0:01:25
Average standard deviation of split frequencies: 0.035776
55500 -- (-903.418) (-905.385) [-903.020] (-902.933) * (-912.460) (-903.972) (-902.370) [-903.425] -- 0:01:25
56000 -- (-903.809) (-902.123) (-904.108) [-901.945] * [-908.848] (-903.128) (-903.783) (-901.220) -- 0:01:24
56500 -- (-904.543) (-901.184) [-902.847] (-903.290) * (-908.666) [-903.603] (-907.679) (-901.885) -- 0:01:23
57000 -- (-904.068) (-903.095) [-904.573] (-906.621) * (-912.460) (-901.922) [-901.578] (-902.672) -- 0:01:22
57500 -- (-903.241) [-903.434] (-902.364) (-905.991) * (-919.824) (-902.917) [-903.037] (-903.060) -- 0:01:21
58000 -- (-902.590) (-903.489) [-902.547] (-902.261) * (-912.289) (-902.995) [-902.626] (-903.953) -- 0:01:21
58500 -- (-905.670) [-903.749] (-901.598) (-902.486) * (-906.662) (-902.672) (-907.360) [-904.212] -- 0:01:20
59000 -- (-903.662) (-904.994) [-903.082] (-902.156) * [-923.431] (-902.311) (-907.069) (-901.880) -- 0:01:19
59500 -- (-902.141) (-904.175) [-904.022] (-902.560) * [-917.927] (-903.582) (-901.942) (-902.398) -- 0:01:19
60000 -- (-901.950) (-903.297) (-902.296) [-903.920] * (-921.892) (-904.977) (-909.610) [-901.904] -- 0:01:18
Average standard deviation of split frequencies: 0.028219
60500 -- (-901.913) [-901.818] (-901.994) (-902.675) * (-904.782) (-904.738) (-907.628) [-903.080] -- 0:01:17
61000 -- (-902.803) [-902.892] (-901.438) (-903.757) * (-903.233) [-902.966] (-902.110) (-906.602) -- 0:01:16
61500 -- (-902.234) [-903.184] (-903.574) (-903.340) * (-902.210) (-902.564) [-903.442] (-906.367) -- 0:01:16
62000 -- (-905.436) (-904.652) (-908.758) [-903.209] * (-903.012) (-908.172) [-903.004] (-905.966) -- 0:01:15
62500 -- (-906.231) (-906.510) (-905.205) [-908.129] * (-902.748) (-905.268) (-901.470) [-905.567] -- 0:01:15
63000 -- (-905.159) [-902.677] (-903.509) (-908.063) * (-903.821) (-905.319) [-901.568] (-906.546) -- 0:01:14
63500 -- (-901.952) (-903.730) [-901.604] (-907.118) * (-906.312) (-901.954) [-902.694] (-905.464) -- 0:01:13
64000 -- (-904.597) (-902.344) [-902.027] (-906.744) * (-907.224) (-903.746) [-903.566] (-905.080) -- 0:01:13
64500 -- [-901.970] (-907.682) (-901.567) (-906.695) * (-902.893) (-905.058) (-905.331) [-902.807] -- 0:01:12
65000 -- (-901.684) [-907.470] (-901.548) (-903.420) * (-901.967) (-902.502) (-904.669) [-904.630] -- 0:01:11
Average standard deviation of split frequencies: 0.021087
65500 -- [-902.531] (-911.016) (-901.710) (-904.078) * (-903.790) (-902.123) (-910.061) [-903.110] -- 0:01:11
66000 -- (-902.624) [-902.037] (-901.793) (-901.992) * [-903.928] (-902.132) (-905.305) (-903.178) -- 0:01:10
66500 -- [-906.069] (-901.759) (-903.329) (-902.461) * (-904.230) (-902.759) (-902.764) [-903.940] -- 0:01:10
67000 -- (-905.404) (-903.863) (-906.956) [-907.268] * (-904.618) (-904.236) [-901.767] (-903.059) -- 0:01:23
67500 -- (-906.250) (-903.459) (-903.866) [-903.371] * [-904.687] (-904.234) (-903.127) (-903.105) -- 0:01:22
68000 -- [-903.306] (-903.009) (-907.026) (-904.636) * [-903.052] (-901.910) (-901.412) (-906.015) -- 0:01:22
68500 -- (-908.228) [-904.406] (-905.180) (-906.531) * (-903.028) [-901.833] (-901.100) (-902.453) -- 0:01:21
69000 -- (-903.137) [-901.901] (-904.012) (-907.990) * (-902.789) [-901.688] (-901.569) (-906.633) -- 0:01:20
69500 -- (-901.650) [-901.897] (-904.473) (-903.141) * (-903.533) (-902.404) (-902.015) [-903.689] -- 0:01:20
70000 -- [-903.816] (-901.897) (-903.433) (-903.748) * (-903.055) (-902.207) [-902.004] (-904.430) -- 0:01:19
Average standard deviation of split frequencies: 0.017154
70500 -- [-903.114] (-902.468) (-901.279) (-905.426) * (-903.408) [-902.810] (-901.519) (-913.739) -- 0:01:19
71000 -- (-902.817) [-902.852] (-906.330) (-905.524) * [-901.671] (-903.031) (-901.158) (-905.094) -- 0:01:18
71500 -- (-901.527) (-904.469) [-907.475] (-904.272) * [-901.930] (-904.360) (-905.839) (-908.996) -- 0:01:17
72000 -- (-901.591) [-904.263] (-909.061) (-907.543) * (-905.435) (-905.462) [-904.396] (-902.318) -- 0:01:17
72500 -- [-901.768] (-902.290) (-903.247) (-903.407) * (-905.015) [-905.324] (-909.054) (-909.211) -- 0:01:16
73000 -- (-903.642) (-903.132) [-902.082] (-902.982) * (-903.484) (-903.422) [-904.297] (-905.962) -- 0:01:16
73500 -- (-904.587) (-904.272) (-902.799) [-903.113] * (-905.189) (-902.265) (-904.194) [-903.721] -- 0:01:15
74000 -- [-904.485] (-902.672) (-905.514) (-903.959) * (-909.166) (-904.926) [-901.583] (-903.237) -- 0:01:15
74500 -- [-904.742] (-901.811) (-903.493) (-905.440) * (-902.738) [-907.118] (-902.225) (-902.068) -- 0:01:14
75000 -- (-903.234) [-905.219] (-902.468) (-903.122) * [-901.974] (-906.558) (-906.789) (-906.977) -- 0:01:14
Average standard deviation of split frequencies: 0.017368
75500 -- (-905.280) (-902.365) [-902.475] (-902.358) * [-901.476] (-904.083) (-908.944) (-906.836) -- 0:01:13
76000 -- (-903.760) (-901.029) (-902.175) [-901.651] * (-902.091) (-905.216) (-906.810) [-902.261] -- 0:01:12
76500 -- (-904.171) [-904.435] (-901.834) (-904.087) * (-904.480) (-903.125) (-905.586) [-902.361] -- 0:01:12
77000 -- [-903.698] (-903.583) (-902.466) (-903.219) * (-905.027) [-902.497] (-908.775) (-905.072) -- 0:01:11
77500 -- [-901.876] (-905.532) (-903.340) (-906.303) * (-903.096) [-902.529] (-905.654) (-907.007) -- 0:01:11
78000 -- (-904.674) (-904.825) [-902.754] (-904.240) * [-903.258] (-901.903) (-906.250) (-902.136) -- 0:01:10
78500 -- (-902.340) (-904.994) [-901.899] (-902.022) * (-902.332) (-904.863) (-906.250) [-904.009] -- 0:01:10
79000 -- (-901.509) (-905.890) [-902.131] (-901.913) * [-904.839] (-905.961) (-905.422) (-908.772) -- 0:01:09
79500 -- [-901.290] (-904.814) (-904.433) (-905.163) * (-902.675) (-905.384) [-903.929] (-904.167) -- 0:01:09
80000 -- (-904.713) (-901.612) (-904.080) [-903.393] * (-902.537) [-906.798] (-906.402) (-903.736) -- 0:01:20
Average standard deviation of split frequencies: 0.024298
80500 -- (-902.370) [-902.115] (-901.344) (-902.311) * (-903.784) (-902.914) (-904.139) [-903.089] -- 0:01:19
81000 -- (-902.533) (-905.230) [-901.471] (-901.967) * [-903.371] (-904.162) (-904.549) (-903.301) -- 0:01:19
81500 -- (-901.742) [-905.126] (-901.770) (-902.272) * (-904.319) [-906.959] (-905.557) (-903.745) -- 0:01:18
82000 -- [-902.029] (-902.679) (-902.591) (-902.881) * [-903.710] (-905.520) (-905.464) (-901.463) -- 0:01:18
82500 -- (-901.674) (-902.130) (-902.631) [-901.996] * (-901.998) (-907.460) (-905.307) [-902.008] -- 0:01:17
83000 -- (-906.280) (-904.192) (-901.817) [-901.968] * (-901.765) (-903.713) (-902.867) [-903.075] -- 0:01:17
83500 -- (-904.997) (-902.036) (-902.743) [-901.446] * (-902.726) [-906.724] (-903.176) (-903.675) -- 0:01:16
84000 -- (-909.755) (-908.739) (-901.204) [-902.743] * (-901.519) [-904.041] (-901.787) (-904.580) -- 0:01:16
84500 -- (-904.025) (-910.695) (-901.466) [-904.837] * (-903.373) (-902.443) (-902.213) [-904.504] -- 0:01:15
85000 -- (-905.275) (-903.968) [-903.343] (-904.024) * (-902.899) (-901.263) (-906.303) [-901.779] -- 0:01:15
Average standard deviation of split frequencies: 0.027929
85500 -- (-902.943) (-903.720) (-902.802) [-902.753] * [-902.840] (-906.161) (-903.162) (-903.898) -- 0:01:14
86000 -- (-903.771) [-904.120] (-909.687) (-904.273) * (-903.575) (-905.359) (-906.348) [-905.060] -- 0:01:14
86500 -- (-903.032) (-903.849) [-902.574] (-901.607) * (-901.679) (-907.435) [-902.218] (-903.986) -- 0:01:13
87000 -- (-902.631) (-901.803) [-902.063] (-901.598) * (-902.779) (-904.528) [-904.014] (-904.361) -- 0:01:13
87500 -- (-905.288) (-902.225) [-902.084] (-903.134) * (-906.431) (-901.719) [-902.335] (-901.613) -- 0:01:13
88000 -- (-903.790) [-902.547] (-902.495) (-901.756) * [-904.913] (-901.302) (-903.537) (-906.569) -- 0:01:12
88500 -- (-906.937) (-903.781) [-901.134] (-901.658) * (-906.708) [-901.496] (-905.857) (-904.934) -- 0:01:12
89000 -- (-902.566) [-903.842] (-902.283) (-903.659) * (-911.587) [-903.603] (-903.018) (-903.410) -- 0:01:11
89500 -- (-905.272) [-904.604] (-902.958) (-905.415) * (-902.332) [-902.627] (-903.239) (-902.148) -- 0:01:11
90000 -- (-903.049) (-904.575) [-906.699] (-906.038) * (-902.695) [-902.229] (-904.570) (-903.865) -- 0:01:10
Average standard deviation of split frequencies: 0.027036
90500 -- (-904.023) [-902.932] (-902.766) (-904.379) * (-906.194) (-903.715) (-905.877) [-902.102] -- 0:01:10
91000 -- (-906.908) [-905.467] (-903.996) (-907.413) * [-906.311] (-905.116) (-902.835) (-906.073) -- 0:01:09
91500 -- (-906.892) [-905.612] (-906.068) (-903.797) * (-903.664) [-905.160] (-903.589) (-904.826) -- 0:01:09
92000 -- (-901.765) [-901.909] (-915.581) (-905.988) * (-906.886) [-903.394] (-903.115) (-906.831) -- 0:01:09
92500 -- [-904.112] (-901.860) (-905.820) (-903.688) * (-905.058) [-901.950] (-902.629) (-906.124) -- 0:01:08
93000 -- [-905.094] (-902.691) (-907.692) (-903.495) * (-904.486) [-902.174] (-903.095) (-907.279) -- 0:01:18
93500 -- (-903.243) [-903.153] (-906.940) (-907.037) * (-905.695) [-904.317] (-902.462) (-904.598) -- 0:01:17
94000 -- [-903.377] (-904.262) (-910.232) (-904.949) * (-901.756) [-905.250] (-905.202) (-901.451) -- 0:01:17
94500 -- [-904.690] (-902.459) (-905.454) (-906.004) * (-903.262) [-904.154] (-908.562) (-906.189) -- 0:01:16
95000 -- (-901.777) (-902.216) (-902.037) [-904.181] * (-905.699) (-910.268) [-904.353] (-904.946) -- 0:01:16
Average standard deviation of split frequencies: 0.025069
95500 -- (-904.700) (-901.640) [-906.614] (-902.908) * (-902.664) (-902.806) (-904.470) [-903.952] -- 0:01:15
96000 -- [-903.375] (-905.750) (-905.871) (-901.574) * (-910.414) [-903.635] (-904.787) (-907.595) -- 0:01:15
96500 -- [-904.233] (-906.497) (-905.061) (-901.468) * (-903.863) [-901.333] (-905.029) (-906.318) -- 0:01:14
97000 -- (-903.242) [-902.542] (-903.445) (-903.297) * (-905.041) (-905.174) (-908.137) [-903.044] -- 0:01:14
97500 -- (-904.069) (-905.186) (-901.471) [-902.052] * (-906.591) [-902.917] (-905.194) (-903.079) -- 0:01:14
98000 -- [-901.781] (-903.634) (-901.385) (-906.212) * (-903.508) [-902.024] (-906.725) (-903.451) -- 0:01:13
98500 -- (-902.202) [-903.777] (-901.673) (-905.570) * [-905.146] (-902.835) (-904.212) (-903.116) -- 0:01:13
99000 -- [-902.381] (-906.029) (-901.723) (-905.589) * (-902.598) [-902.503] (-903.330) (-903.074) -- 0:01:12
99500 -- [-902.750] (-902.101) (-902.252) (-906.259) * (-901.883) [-902.931] (-903.380) (-902.348) -- 0:01:12
100000 -- [-902.867] (-905.960) (-903.183) (-906.238) * (-901.889) [-901.800] (-903.502) (-903.520) -- 0:01:12
Average standard deviation of split frequencies: 0.021689
100500 -- (-904.771) [-903.422] (-905.310) (-905.482) * (-906.751) [-902.035] (-903.736) (-904.080) -- 0:01:11
101000 -- [-902.919] (-904.572) (-901.978) (-902.027) * (-905.572) (-904.873) (-904.248) [-903.662] -- 0:01:11
101500 -- (-904.994) [-904.200] (-904.739) (-904.186) * (-903.629) (-904.255) [-901.894] (-905.017) -- 0:01:10
102000 -- (-904.992) [-904.714] (-905.888) (-904.169) * (-904.301) (-902.138) (-906.105) [-902.279] -- 0:01:10
102500 -- (-906.077) (-905.253) (-903.309) [-904.257] * (-905.110) (-903.779) (-905.892) [-902.158] -- 0:01:10
103000 -- (-907.582) (-904.524) [-902.429] (-905.364) * (-906.015) (-903.257) (-904.504) [-902.833] -- 0:01:09
103500 -- (-902.728) [-902.207] (-902.441) (-904.990) * [-903.662] (-903.470) (-906.023) (-902.256) -- 0:01:09
104000 -- (-903.304) (-902.791) (-902.359) [-903.028] * (-903.468) [-906.027] (-904.116) (-901.923) -- 0:01:08
104500 -- (-901.663) [-905.961] (-902.663) (-903.660) * (-905.426) (-903.448) (-906.559) [-902.332] -- 0:01:08
105000 -- (-901.394) [-907.074] (-902.736) (-904.322) * (-904.029) (-904.771) [-901.790] (-901.324) -- 0:01:08
Average standard deviation of split frequencies: 0.023126
105500 -- (-902.354) (-905.263) (-905.277) [-902.325] * (-902.831) (-905.482) [-902.680] (-902.029) -- 0:01:07
106000 -- (-903.691) (-903.644) (-905.464) [-902.660] * (-904.051) (-903.441) [-901.858] (-902.386) -- 0:01:15
106500 -- (-902.481) [-905.395] (-906.208) (-904.724) * (-902.694) (-905.116) (-902.262) [-902.617] -- 0:01:15
107000 -- (-902.865) [-903.103] (-904.336) (-902.283) * (-901.644) (-903.378) [-901.955] (-902.992) -- 0:01:15
107500 -- (-904.430) (-901.923) [-904.565] (-901.718) * (-905.946) (-902.687) [-902.093] (-901.679) -- 0:01:14
108000 -- (-907.209) [-904.451] (-904.644) (-904.002) * [-904.306] (-902.403) (-902.018) (-904.937) -- 0:01:14
108500 -- (-903.428) [-902.747] (-905.545) (-902.534) * [-903.943] (-907.085) (-902.058) (-903.751) -- 0:01:13
109000 -- (-903.453) [-903.394] (-903.759) (-903.358) * (-904.002) (-904.414) [-902.594] (-901.493) -- 0:01:13
109500 -- (-901.574) (-904.695) [-905.457] (-901.223) * (-908.320) (-905.758) (-902.926) [-907.762] -- 0:01:13
110000 -- (-903.284) [-904.374] (-906.463) (-905.280) * (-908.744) (-901.608) [-901.836] (-903.550) -- 0:01:12
Average standard deviation of split frequencies: 0.026836
110500 -- (-904.035) (-903.432) (-902.608) [-904.186] * (-906.738) [-905.735] (-902.180) (-904.585) -- 0:01:12
111000 -- (-904.967) (-902.469) [-902.530] (-906.251) * (-904.488) (-904.326) [-904.020] (-905.396) -- 0:01:12
111500 -- (-905.684) (-910.199) (-903.569) [-906.370] * (-901.680) (-903.631) [-903.869] (-905.996) -- 0:01:11
112000 -- (-905.572) (-906.139) [-902.652] (-905.898) * (-904.480) (-903.257) [-902.077] (-903.651) -- 0:01:11
112500 -- [-901.482] (-903.630) (-902.730) (-903.967) * (-903.662) (-905.223) [-901.427] (-902.608) -- 0:01:11
113000 -- (-902.435) (-901.194) [-901.926] (-901.301) * (-906.948) (-902.787) [-902.248] (-903.263) -- 0:01:10
113500 -- (-902.202) (-901.438) (-902.786) [-903.110] * (-905.146) (-904.103) (-903.703) [-903.874] -- 0:01:10
114000 -- (-903.287) [-903.436] (-902.397) (-901.726) * (-907.557) (-906.813) [-903.532] (-902.915) -- 0:01:09
114500 -- (-903.328) (-907.164) [-902.175] (-902.017) * [-902.778] (-909.161) (-905.349) (-903.358) -- 0:01:09
115000 -- (-904.706) (-903.104) [-902.256] (-903.449) * [-902.160] (-907.717) (-912.088) (-902.046) -- 0:01:09
Average standard deviation of split frequencies: 0.025805
115500 -- [-904.410] (-907.476) (-903.555) (-907.573) * [-901.869] (-903.258) (-912.945) (-902.264) -- 0:01:08
116000 -- (-906.233) (-904.127) (-902.681) [-905.061] * (-903.809) [-903.029] (-905.567) (-901.214) -- 0:01:08
116500 -- [-904.138] (-902.349) (-906.047) (-906.904) * [-902.243] (-903.380) (-905.306) (-901.218) -- 0:01:08
117000 -- (-902.787) (-901.831) [-907.142] (-904.227) * (-902.206) [-903.577] (-902.578) (-902.449) -- 0:01:07
117500 -- (-905.017) (-901.804) (-904.244) [-902.118] * (-902.547) [-903.061] (-903.562) (-905.617) -- 0:01:07
118000 -- (-904.155) (-902.622) [-905.154] (-903.510) * (-902.692) (-904.157) [-901.860] (-903.306) -- 0:01:07
118500 -- (-902.864) (-903.395) (-905.264) [-902.280] * [-903.830] (-901.924) (-902.251) (-907.510) -- 0:01:06
119000 -- (-903.627) [-902.985] (-902.325) (-903.659) * (-902.512) [-903.315] (-903.186) (-902.312) -- 0:01:14
119500 -- (-902.213) [-902.790] (-906.246) (-904.446) * (-903.347) (-904.249) (-904.944) [-903.431] -- 0:01:13
120000 -- (-903.552) [-902.881] (-910.058) (-904.746) * (-903.026) [-903.299] (-909.753) (-905.422) -- 0:01:13
Average standard deviation of split frequencies: 0.025198
120500 -- (-902.410) [-902.226] (-905.661) (-905.194) * (-902.438) (-902.886) (-911.433) [-901.768] -- 0:01:12
121000 -- (-906.899) (-902.807) (-904.385) [-903.027] * [-902.046] (-902.863) (-907.093) (-902.134) -- 0:01:12
121500 -- [-903.943] (-905.711) (-901.566) (-906.533) * (-903.451) [-904.732] (-907.057) (-901.221) -- 0:01:12
122000 -- [-906.293] (-902.745) (-901.966) (-909.501) * [-903.652] (-902.763) (-904.672) (-904.581) -- 0:01:11
122500 -- (-902.371) [-903.232] (-901.290) (-907.546) * (-904.780) (-903.185) (-902.011) [-901.334] -- 0:01:11
123000 -- [-903.885] (-904.415) (-903.686) (-903.794) * [-906.158] (-904.370) (-904.361) (-901.943) -- 0:01:11
123500 -- (-902.106) (-904.854) (-902.314) [-902.218] * [-906.492] (-903.259) (-904.085) (-904.481) -- 0:01:10
124000 -- (-903.860) (-907.608) [-902.314] (-903.059) * (-901.593) (-912.903) (-902.352) [-901.247] -- 0:01:10
124500 -- [-903.748] (-907.447) (-901.733) (-904.114) * [-903.372] (-907.900) (-906.342) (-901.984) -- 0:01:10
125000 -- (-904.469) (-908.337) [-901.945] (-902.269) * [-904.309] (-904.883) (-903.112) (-902.087) -- 0:01:10
Average standard deviation of split frequencies: 0.022804
125500 -- (-901.520) (-904.768) [-906.315] (-903.369) * (-904.077) (-904.847) (-903.350) [-902.428] -- 0:01:09
126000 -- (-903.011) (-904.616) [-903.058] (-905.539) * (-906.102) (-905.707) (-904.049) [-905.440] -- 0:01:09
126500 -- (-902.800) (-907.671) [-903.229] (-903.449) * [-901.139] (-903.875) (-907.146) (-902.727) -- 0:01:09
127000 -- [-902.035] (-903.239) (-904.607) (-902.176) * (-910.965) (-902.464) [-908.029] (-904.299) -- 0:01:08
127500 -- [-902.331] (-904.474) (-902.355) (-901.884) * (-903.620) (-909.675) [-901.868] (-905.090) -- 0:01:08
128000 -- (-902.497) (-905.206) (-904.628) [-901.719] * (-903.620) (-907.252) [-903.336] (-906.344) -- 0:01:08
128500 -- (-903.022) (-902.322) (-904.499) [-901.581] * (-903.256) [-903.543] (-902.492) (-902.495) -- 0:01:07
129000 -- (-902.436) (-902.647) (-909.112) [-902.968] * (-902.151) (-903.569) [-904.349] (-903.966) -- 0:01:07
129500 -- (-905.093) [-901.497] (-905.236) (-903.701) * (-904.741) [-903.298] (-902.618) (-906.329) -- 0:01:07
130000 -- (-904.873) [-904.094] (-903.014) (-905.578) * (-902.686) (-905.697) (-902.923) [-904.746] -- 0:01:06
Average standard deviation of split frequencies: 0.020006
130500 -- (-905.031) (-902.206) (-908.924) [-903.496] * (-902.245) [-904.471] (-902.778) (-904.090) -- 0:01:06
131000 -- (-906.288) [-902.485] (-906.375) (-903.778) * [-901.985] (-903.284) (-902.824) (-902.789) -- 0:01:06
131500 -- (-903.371) [-903.822] (-905.146) (-904.772) * (-902.381) (-905.069) [-903.108] (-907.464) -- 0:01:06
132000 -- (-903.934) [-902.869] (-903.080) (-903.550) * (-905.961) (-901.585) (-903.340) [-903.707] -- 0:01:12
132500 -- (-904.158) [-903.571] (-903.407) (-903.989) * (-903.864) [-904.369] (-903.939) (-902.765) -- 0:01:12
133000 -- (-905.012) [-903.673] (-902.790) (-904.570) * (-911.668) (-902.186) (-903.025) [-906.673] -- 0:01:11
133500 -- [-904.494] (-904.914) (-902.239) (-905.406) * (-901.555) (-902.313) [-904.789] (-905.184) -- 0:01:11
134000 -- (-905.175) (-905.772) [-902.162] (-905.940) * [-901.757] (-902.522) (-903.944) (-903.424) -- 0:01:11
134500 -- [-904.529] (-907.322) (-903.711) (-905.059) * (-902.190) (-902.688) [-901.920] (-902.350) -- 0:01:10
135000 -- (-904.720) [-903.748] (-905.098) (-902.939) * (-903.680) (-902.790) (-903.333) [-902.533] -- 0:01:10
Average standard deviation of split frequencies: 0.019972
135500 -- (-904.937) (-902.391) (-904.684) [-902.999] * (-902.872) (-902.732) [-901.831] (-902.279) -- 0:01:10
136000 -- (-903.501) [-903.617] (-904.566) (-902.943) * (-902.103) [-903.737] (-907.297) (-901.539) -- 0:01:09
136500 -- (-904.153) (-903.099) (-905.477) [-901.460] * (-902.913) (-903.421) (-903.187) [-903.604] -- 0:01:09
137000 -- (-904.347) [-901.600] (-908.383) (-902.403) * [-904.252] (-902.695) (-903.485) (-902.432) -- 0:01:09
137500 -- [-903.446] (-901.539) (-902.229) (-902.933) * (-903.232) (-905.561) (-907.182) [-906.937] -- 0:01:09
138000 -- (-903.475) (-901.684) [-903.288] (-902.151) * [-903.509] (-903.731) (-903.131) (-903.476) -- 0:01:08
138500 -- (-902.339) (-904.432) (-902.026) [-903.088] * (-901.307) [-902.653] (-905.293) (-904.574) -- 0:01:08
139000 -- (-901.690) [-902.210] (-901.251) (-905.255) * [-902.205] (-902.747) (-901.714) (-902.621) -- 0:01:08
139500 -- (-903.008) [-903.941] (-901.577) (-906.035) * (-901.665) (-907.074) (-903.070) [-903.041] -- 0:01:07
140000 -- (-903.454) [-903.054] (-901.426) (-904.538) * [-901.366] (-906.659) (-902.342) (-909.414) -- 0:01:07
Average standard deviation of split frequencies: 0.020778
140500 -- (-902.185) (-901.664) (-901.268) [-903.861] * (-903.188) (-903.312) [-901.859] (-905.567) -- 0:01:07
141000 -- (-904.278) (-903.462) [-901.497] (-904.744) * (-903.425) [-901.276] (-904.192) (-903.636) -- 0:01:07
141500 -- [-903.510] (-904.838) (-904.726) (-904.140) * (-902.713) [-902.392] (-902.154) (-903.423) -- 0:01:06
142000 -- [-902.053] (-904.361) (-904.699) (-903.863) * (-902.960) [-902.154] (-901.965) (-904.540) -- 0:01:06
142500 -- [-903.807] (-906.921) (-904.729) (-906.782) * (-901.758) (-906.726) (-902.082) [-904.964] -- 0:01:06
143000 -- [-902.726] (-906.649) (-903.625) (-903.540) * (-903.458) (-907.307) [-906.818] (-903.179) -- 0:01:05
143500 -- (-909.098) (-905.013) [-902.555] (-903.877) * (-905.016) (-906.772) [-903.062] (-904.494) -- 0:01:05
144000 -- (-904.242) [-905.760] (-904.054) (-901.837) * (-909.239) (-902.514) [-902.370] (-901.447) -- 0:01:05
144500 -- [-907.335] (-907.319) (-913.106) (-901.882) * (-904.851) (-902.081) (-904.592) [-901.386] -- 0:01:05
145000 -- (-903.336) (-904.996) (-905.891) [-902.560] * (-902.694) (-901.642) [-905.818] (-903.907) -- 0:01:04
Average standard deviation of split frequencies: 0.018604
145500 -- (-902.132) (-905.425) (-909.574) [-902.933] * (-902.398) (-901.381) [-902.604] (-905.080) -- 0:01:10
146000 -- (-907.892) (-903.218) [-903.984] (-903.092) * [-903.627] (-903.960) (-902.436) (-905.250) -- 0:01:10
146500 -- (-903.454) (-903.175) (-901.921) [-902.300] * (-903.601) [-902.583] (-903.908) (-903.972) -- 0:01:09
147000 -- (-904.482) (-901.883) [-904.060] (-902.276) * [-901.232] (-903.010) (-902.282) (-902.214) -- 0:01:09
147500 -- (-905.862) [-901.600] (-905.264) (-904.543) * (-901.448) [-901.774] (-902.288) (-903.114) -- 0:01:09
148000 -- (-908.319) (-903.286) (-904.950) [-903.922] * (-901.846) (-904.265) [-901.997] (-903.748) -- 0:01:09
148500 -- [-903.122] (-904.879) (-904.827) (-905.722) * (-903.123) (-902.705) (-902.351) [-903.017] -- 0:01:08
149000 -- [-903.443] (-902.865) (-902.535) (-903.975) * (-902.381) (-902.653) [-916.772] (-901.906) -- 0:01:08
149500 -- (-902.505) (-902.287) [-903.740] (-902.882) * (-902.486) [-902.549] (-906.125) (-903.932) -- 0:01:08
150000 -- (-901.587) (-903.665) [-905.071] (-904.379) * (-902.175) (-902.355) [-901.873] (-901.025) -- 0:01:08
Average standard deviation of split frequencies: 0.018475
150500 -- [-901.505] (-903.146) (-903.061) (-905.602) * (-903.590) [-901.291] (-907.142) (-901.532) -- 0:01:07
151000 -- (-902.421) (-903.188) [-903.705] (-904.990) * (-903.783) [-901.427] (-906.188) (-904.346) -- 0:01:07
151500 -- (-903.202) (-902.981) [-903.930] (-902.697) * [-901.611] (-904.204) (-906.009) (-906.275) -- 0:01:07
152000 -- (-907.569) (-903.810) [-902.354] (-902.530) * (-901.193) [-903.673] (-905.565) (-904.612) -- 0:01:06
152500 -- (-902.723) (-903.662) (-901.785) [-903.153] * [-901.071] (-903.492) (-903.849) (-902.764) -- 0:01:06
153000 -- (-905.199) (-902.043) [-901.554] (-903.160) * [-901.526] (-907.437) (-904.339) (-903.283) -- 0:01:06
153500 -- [-901.948] (-901.759) (-902.256) (-902.454) * (-901.508) (-907.703) [-902.580] (-904.140) -- 0:01:06
154000 -- (-907.207) [-901.371] (-907.207) (-902.645) * (-901.907) (-908.176) (-904.280) [-901.830] -- 0:01:05
154500 -- (-901.637) (-902.527) [-905.311] (-903.696) * (-905.475) [-901.686] (-902.277) (-901.796) -- 0:01:05
155000 -- (-902.663) (-904.084) [-901.277] (-904.511) * (-905.714) [-901.877] (-902.342) (-903.127) -- 0:01:05
Average standard deviation of split frequencies: 0.018926
155500 -- (-903.499) (-904.784) [-901.833] (-903.109) * (-901.775) (-902.154) [-902.338] (-901.314) -- 0:01:05
156000 -- (-901.407) [-905.247] (-903.883) (-907.737) * (-905.528) [-904.937] (-901.314) (-902.030) -- 0:01:04
156500 -- (-902.276) (-903.732) (-905.784) [-903.281] * (-904.038) [-902.377] (-902.352) (-903.428) -- 0:01:04
157000 -- (-903.685) [-905.841] (-906.984) (-902.142) * (-905.216) (-902.221) [-906.006] (-901.580) -- 0:01:04
157500 -- (-906.179) [-905.345] (-905.017) (-910.296) * (-902.088) (-902.094) [-904.567] (-902.961) -- 0:01:04
158000 -- [-903.643] (-907.961) (-905.476) (-911.472) * (-903.175) (-903.569) [-902.104] (-903.191) -- 0:01:03
158500 -- (-905.094) (-904.124) [-903.728] (-904.385) * (-904.312) (-902.941) [-901.908] (-902.271) -- 0:01:09
159000 -- (-903.548) [-904.342] (-903.207) (-905.090) * (-906.781) (-905.536) [-902.409] (-903.466) -- 0:01:08
159500 -- (-903.237) [-902.622] (-902.089) (-905.127) * (-909.527) (-905.187) [-901.745] (-905.269) -- 0:01:08
160000 -- (-902.615) [-901.532] (-901.825) (-903.800) * [-908.034] (-902.124) (-902.226) (-905.601) -- 0:01:08
Average standard deviation of split frequencies: 0.019149
160500 -- (-901.829) (-902.489) [-901.605] (-903.421) * (-906.396) [-903.136] (-901.962) (-901.794) -- 0:01:07
161000 -- (-903.328) [-902.874] (-902.956) (-904.561) * (-901.713) (-904.113) (-902.281) [-901.480] -- 0:01:07
161500 -- (-902.249) (-904.361) [-902.795] (-904.375) * (-901.913) [-903.900] (-906.652) (-902.473) -- 0:01:07
162000 -- [-902.375] (-905.266) (-902.708) (-904.583) * (-903.365) [-902.943] (-906.805) (-902.786) -- 0:01:07
162500 -- (-902.996) (-904.537) (-901.545) [-907.538] * (-904.502) [-901.950] (-906.211) (-901.971) -- 0:01:07
163000 -- (-902.872) (-902.965) (-901.545) [-903.719] * (-905.882) (-904.865) (-905.191) [-903.057] -- 0:01:06
163500 -- (-905.225) [-902.969] (-903.513) (-903.666) * (-902.958) (-901.633) (-905.804) [-901.336] -- 0:01:06
164000 -- (-904.466) (-904.359) (-901.567) [-903.576] * (-902.153) (-903.602) (-903.362) [-901.179] -- 0:01:06
164500 -- (-903.824) (-902.387) [-901.515] (-904.354) * (-904.015) (-903.816) (-903.655) [-901.349] -- 0:01:06
165000 -- (-902.072) [-903.332] (-902.028) (-902.511) * (-901.466) (-903.943) (-902.758) [-901.863] -- 0:01:05
Average standard deviation of split frequencies: 0.018033
165500 -- (-906.117) (-903.158) (-905.505) [-907.848] * [-903.978] (-902.831) (-903.731) (-905.214) -- 0:01:05
166000 -- (-908.629) (-905.030) (-903.067) [-905.032] * (-905.690) [-902.505] (-907.030) (-904.674) -- 0:01:05
166500 -- [-904.903] (-904.716) (-902.211) (-902.964) * (-903.076) (-902.474) (-906.326) [-904.543] -- 0:01:05
167000 -- (-904.335) (-904.893) (-903.931) [-904.971] * (-903.516) (-902.820) (-904.995) [-904.258] -- 0:01:04
167500 -- (-910.726) (-905.868) [-902.708] (-904.448) * (-903.791) (-903.596) (-903.097) [-902.064] -- 0:01:04
168000 -- (-902.042) (-904.326) [-903.914] (-907.883) * (-909.642) (-906.312) [-903.961] (-903.055) -- 0:01:04
168500 -- [-904.289] (-901.833) (-903.812) (-904.022) * (-901.941) (-908.713) [-906.024] (-904.375) -- 0:01:04
169000 -- [-904.917] (-902.136) (-906.965) (-903.497) * (-905.784) (-904.380) [-904.545] (-902.742) -- 0:01:03
169500 -- (-902.887) [-902.192] (-906.155) (-903.097) * (-902.201) [-901.947] (-907.053) (-904.486) -- 0:01:03
170000 -- [-902.317] (-905.261) (-902.134) (-902.467) * (-904.405) (-902.288) [-902.867] (-902.852) -- 0:01:03
Average standard deviation of split frequencies: 0.018506
170500 -- (-902.527) (-902.595) [-902.052] (-909.304) * (-903.169) [-903.312] (-903.254) (-901.909) -- 0:01:03
171000 -- [-902.087] (-903.004) (-902.314) (-902.518) * (-903.253) (-902.206) [-908.644] (-903.674) -- 0:01:03
171500 -- [-902.093] (-902.737) (-905.648) (-902.765) * (-903.004) (-904.275) [-905.792] (-901.800) -- 0:01:02
172000 -- (-906.202) (-903.665) (-903.841) [-903.151] * (-903.319) (-904.567) (-902.745) [-901.724] -- 0:01:07
172500 -- (-905.157) (-902.470) (-901.980) [-902.046] * (-903.353) (-907.623) [-904.060] (-902.800) -- 0:01:07
173000 -- (-905.553) (-904.002) (-902.929) [-902.289] * (-903.896) [-903.993] (-903.603) (-903.509) -- 0:01:06
173500 -- (-904.084) (-901.986) (-902.534) [-904.403] * [-902.308] (-905.940) (-902.694) (-901.809) -- 0:01:06
174000 -- (-902.555) [-903.525] (-903.228) (-906.275) * (-904.649) (-902.105) [-903.952] (-902.982) -- 0:01:06
174500 -- (-902.145) (-903.364) [-905.306] (-904.966) * (-904.216) (-902.770) (-908.311) [-903.439] -- 0:01:06
175000 -- [-901.566] (-904.287) (-904.287) (-904.735) * [-903.914] (-902.367) (-904.056) (-905.034) -- 0:01:06
Average standard deviation of split frequencies: 0.018749
175500 -- (-903.539) (-904.126) (-905.109) [-902.065] * (-904.881) [-903.704] (-908.790) (-902.009) -- 0:01:05
176000 -- [-902.640] (-904.783) (-902.582) (-903.115) * (-902.763) [-902.988] (-902.943) (-901.749) -- 0:01:05
176500 -- (-901.652) (-903.194) [-903.718] (-903.832) * (-903.783) (-902.723) [-905.499] (-902.766) -- 0:01:05
177000 -- (-901.558) [-903.582] (-906.912) (-903.742) * (-905.272) (-902.368) (-902.536) [-903.514] -- 0:01:05
177500 -- [-901.961] (-903.093) (-903.315) (-907.353) * (-903.697) (-907.592) [-902.305] (-905.706) -- 0:01:04
178000 -- [-901.338] (-904.406) (-901.952) (-905.083) * (-905.867) (-901.404) (-902.564) [-904.650] -- 0:01:04
178500 -- (-901.338) (-901.875) [-901.935] (-906.961) * (-907.496) [-902.866] (-904.807) (-909.870) -- 0:01:04
179000 -- (-903.518) (-903.014) (-904.933) [-902.858] * (-903.910) (-903.268) (-902.497) [-902.726] -- 0:01:04
179500 -- (-902.015) (-901.825) (-904.345) [-903.528] * (-905.339) (-903.853) (-904.545) [-902.738] -- 0:01:03
180000 -- (-902.368) (-902.922) (-902.796) [-903.418] * (-901.420) (-904.118) [-901.519] (-909.441) -- 0:01:03
Average standard deviation of split frequencies: 0.018004
180500 -- [-907.908] (-904.057) (-902.981) (-903.418) * (-902.999) (-907.243) [-902.913] (-906.714) -- 0:01:03
181000 -- [-904.866] (-908.540) (-906.353) (-901.910) * (-903.393) (-902.747) [-902.895] (-903.633) -- 0:01:03
181500 -- (-905.206) (-906.713) [-902.403] (-903.341) * (-904.934) (-907.089) [-901.983] (-906.601) -- 0:01:03
182000 -- (-904.056) (-905.321) (-903.040) [-905.320] * (-903.787) (-903.947) [-903.431] (-902.731) -- 0:01:02
182500 -- [-903.441] (-907.378) (-905.514) (-905.040) * (-903.773) [-903.464] (-909.027) (-904.251) -- 0:01:02
183000 -- (-902.217) [-906.777] (-903.022) (-902.381) * (-903.105) (-903.247) (-909.271) [-901.265] -- 0:01:02
183500 -- [-905.948] (-902.952) (-902.403) (-902.734) * (-903.086) [-902.895] (-906.289) (-901.332) -- 0:01:02
184000 -- (-904.061) (-904.263) [-902.144] (-903.443) * (-903.003) [-905.538] (-907.081) (-904.880) -- 0:01:02
184500 -- (-903.375) (-905.192) (-904.089) [-901.279] * (-903.222) (-906.572) [-902.854] (-903.802) -- 0:01:01
185000 -- (-902.568) (-905.903) [-902.885] (-901.953) * (-905.311) [-901.716] (-902.807) (-902.243) -- 0:01:06
Average standard deviation of split frequencies: 0.020402
185500 -- (-903.775) (-907.587) [-901.645] (-902.220) * (-905.358) (-905.506) (-903.524) [-902.417] -- 0:01:05
186000 -- (-904.266) (-903.175) (-901.461) [-901.978] * [-905.625] (-907.211) (-903.839) (-903.192) -- 0:01:05
186500 -- [-909.276] (-905.097) (-901.327) (-907.776) * (-907.031) (-904.153) (-903.304) [-902.868] -- 0:01:05
187000 -- (-903.692) (-904.674) (-901.994) [-905.809] * (-911.806) (-903.926) (-906.160) [-901.829] -- 0:01:05
187500 -- [-901.956] (-903.886) (-902.364) (-902.287) * (-908.327) (-904.480) [-904.305] (-901.896) -- 0:01:05
188000 -- (-901.871) [-905.084] (-903.801) (-901.866) * (-903.549) (-903.383) [-904.447] (-901.872) -- 0:01:04
188500 -- (-903.239) [-909.380] (-903.663) (-906.070) * (-903.959) (-902.443) [-901.972] (-903.635) -- 0:01:04
189000 -- (-902.961) (-905.510) [-903.951] (-904.359) * (-908.622) (-902.486) (-901.180) [-902.459] -- 0:01:04
189500 -- (-901.804) (-902.650) (-902.888) [-904.134] * [-902.616] (-902.576) (-902.595) (-902.459) -- 0:01:04
190000 -- (-902.381) (-904.040) (-903.354) [-901.822] * (-904.576) [-901.742] (-904.402) (-905.314) -- 0:01:03
Average standard deviation of split frequencies: 0.020721
190500 -- [-904.117] (-902.508) (-902.267) (-903.273) * (-903.946) [-903.481] (-903.139) (-905.839) -- 0:01:03
191000 -- (-901.474) (-903.067) [-902.299] (-903.597) * [-905.224] (-906.231) (-904.712) (-905.068) -- 0:01:03
191500 -- (-905.530) [-904.233] (-903.322) (-902.361) * (-901.881) (-904.869) [-904.038] (-902.262) -- 0:01:03
192000 -- (-910.030) (-901.913) [-901.825] (-905.461) * (-903.402) [-904.438] (-901.556) (-903.148) -- 0:01:03
192500 -- (-902.683) [-901.761] (-902.478) (-903.579) * (-908.659) (-902.972) [-903.258] (-903.034) -- 0:01:02
193000 -- (-901.992) [-904.549] (-902.299) (-904.342) * [-906.997] (-901.962) (-904.518) (-902.948) -- 0:01:02
193500 -- (-902.284) (-905.119) [-902.607] (-902.575) * (-902.040) (-902.213) (-908.031) [-904.672] -- 0:01:02
194000 -- (-904.244) (-905.174) (-904.898) [-904.185] * [-904.348] (-901.465) (-904.768) (-905.359) -- 0:01:02
194500 -- (-905.678) (-905.650) (-904.898) [-903.958] * [-903.804] (-901.757) (-904.745) (-908.060) -- 0:01:02
195000 -- [-901.814] (-904.568) (-901.652) (-902.974) * (-901.759) [-903.025] (-902.423) (-906.082) -- 0:01:01
Average standard deviation of split frequencies: 0.019699
195500 -- (-901.883) (-903.566) [-904.087] (-907.279) * (-904.448) [-907.287] (-904.420) (-905.654) -- 0:01:01
196000 -- [-904.189] (-902.511) (-901.057) (-905.631) * (-903.547) (-907.680) [-906.753] (-903.486) -- 0:01:01
196500 -- (-903.221) [-901.247] (-902.685) (-903.237) * (-905.534) (-909.270) (-903.387) [-902.047] -- 0:01:01
197000 -- (-903.122) [-905.595] (-905.306) (-903.387) * (-902.977) (-903.286) (-903.413) [-902.236] -- 0:01:01
197500 -- (-902.185) [-905.767] (-910.091) (-905.332) * [-905.487] (-902.782) (-902.422) (-904.200) -- 0:01:00
198000 -- (-904.207) (-902.494) [-905.256] (-904.855) * (-904.728) (-904.787) (-901.079) [-905.418] -- 0:01:00
198500 -- (-904.693) (-901.926) (-906.733) [-903.930] * (-905.818) (-904.705) (-903.206) [-905.636] -- 0:01:04
199000 -- (-902.845) (-902.208) (-905.220) [-903.854] * (-904.393) (-902.412) (-905.764) [-902.427] -- 0:01:04
199500 -- [-902.641] (-907.803) (-902.623) (-903.101) * (-905.528) (-902.524) (-904.432) [-901.590] -- 0:01:04
200000 -- [-902.966] (-903.992) (-902.224) (-904.661) * [-902.556] (-902.195) (-904.983) (-903.852) -- 0:01:04
Average standard deviation of split frequencies: 0.020229
200500 -- (-909.274) (-906.855) [-904.420] (-903.470) * (-904.916) [-902.333] (-906.422) (-905.142) -- 0:01:03
201000 -- (-906.040) (-908.743) (-901.632) [-902.349] * [-904.916] (-901.493) (-905.739) (-904.255) -- 0:01:03
201500 -- (-903.964) (-903.903) (-903.349) [-903.596] * (-902.365) (-902.107) (-901.879) [-905.991] -- 0:01:03
202000 -- [-905.238] (-903.845) (-904.085) (-902.796) * (-904.983) (-901.685) (-902.748) [-904.226] -- 0:01:03
202500 -- (-901.975) (-904.474) (-903.553) [-902.650] * (-902.295) (-902.701) (-901.552) [-902.104] -- 0:01:03
203000 -- [-902.895] (-908.086) (-902.056) (-903.267) * [-907.806] (-902.553) (-904.006) (-903.021) -- 0:01:02
203500 -- (-903.716) (-903.516) [-901.513] (-902.928) * (-908.191) (-903.095) [-903.361] (-901.906) -- 0:01:02
204000 -- (-904.841) (-902.478) (-903.873) [-901.686] * (-902.699) (-901.783) [-901.787] (-903.636) -- 0:01:02
204500 -- (-905.164) [-905.386] (-902.751) (-903.976) * (-904.426) [-901.663] (-905.338) (-901.582) -- 0:01:02
205000 -- [-903.795] (-903.660) (-903.733) (-904.806) * [-902.595] (-903.232) (-905.822) (-902.989) -- 0:01:02
Average standard deviation of split frequencies: 0.018193
205500 -- (-904.653) (-904.695) [-909.199] (-903.676) * [-902.715] (-903.147) (-908.051) (-904.049) -- 0:01:01
206000 -- (-901.524) (-904.566) [-902.373] (-903.211) * [-903.159] (-902.089) (-905.214) (-903.559) -- 0:01:01
206500 -- [-904.560] (-905.615) (-901.834) (-905.303) * [-901.365] (-901.845) (-903.388) (-903.993) -- 0:01:01
207000 -- [-902.579] (-908.478) (-905.474) (-902.523) * (-902.646) [-901.572] (-909.482) (-902.204) -- 0:01:01
207500 -- (-904.956) (-905.940) (-911.206) [-903.688] * (-901.897) (-905.389) [-901.621] (-907.477) -- 0:01:01
208000 -- (-902.600) (-901.617) (-909.316) [-903.578] * (-903.143) (-905.466) [-901.887] (-903.102) -- 0:01:00
208500 -- (-902.483) (-905.063) (-908.779) [-904.789] * (-903.926) (-904.957) (-903.415) [-903.065] -- 0:01:00
209000 -- (-902.881) [-902.641] (-903.794) (-902.230) * (-905.717) (-904.723) [-904.742] (-902.994) -- 0:01:00
209500 -- (-901.922) [-903.045] (-904.574) (-902.676) * (-908.196) (-906.583) (-906.385) [-902.298] -- 0:01:00
210000 -- (-902.406) [-901.441] (-903.213) (-902.648) * (-904.750) (-902.376) [-905.616] (-902.282) -- 0:01:00
Average standard deviation of split frequencies: 0.017548
210500 -- [-901.901] (-903.414) (-904.136) (-904.772) * [-903.514] (-904.804) (-904.661) (-901.992) -- 0:01:03
211000 -- [-902.693] (-906.689) (-902.694) (-907.036) * (-903.192) (-904.184) [-903.091] (-902.468) -- 0:01:03
211500 -- (-905.079) [-902.749] (-905.012) (-906.099) * (-906.150) [-901.228] (-908.768) (-901.795) -- 0:01:03
212000 -- (-904.129) (-903.587) (-902.810) [-902.358] * (-906.867) [-901.745] (-907.172) (-902.642) -- 0:01:03
212500 -- [-905.211] (-904.725) (-904.093) (-903.495) * (-903.996) [-901.872] (-907.653) (-904.136) -- 0:01:03
213000 -- (-907.863) (-904.830) (-904.237) [-902.574] * [-905.480] (-903.325) (-907.088) (-907.595) -- 0:01:02
213500 -- (-905.114) [-905.022] (-903.837) (-903.137) * (-905.422) (-904.802) [-906.756] (-904.448) -- 0:01:02
214000 -- [-903.967] (-905.532) (-904.441) (-902.644) * (-902.775) [-902.838] (-904.429) (-905.797) -- 0:01:02
214500 -- (-903.968) [-904.139] (-905.138) (-905.903) * (-901.269) [-905.153] (-906.481) (-904.413) -- 0:01:02
215000 -- (-902.645) (-902.776) [-903.585] (-903.972) * (-903.564) (-903.648) [-902.074] (-903.979) -- 0:01:02
Average standard deviation of split frequencies: 0.017000
215500 -- (-901.838) [-902.100] (-903.088) (-903.725) * (-905.111) (-905.182) (-901.433) [-901.526] -- 0:01:01
216000 -- (-901.435) (-904.385) [-903.308] (-903.372) * (-905.954) (-903.666) (-901.467) [-903.507] -- 0:01:01
216500 -- (-901.579) (-904.585) [-902.031] (-902.668) * (-905.466) [-903.488] (-904.357) (-901.628) -- 0:01:01
217000 -- (-902.576) (-904.258) (-901.981) [-903.947] * (-903.343) (-905.750) [-908.672] (-906.884) -- 0:01:01
217500 -- [-901.984] (-901.415) (-902.379) (-903.622) * (-903.386) (-904.707) [-905.122] (-904.248) -- 0:01:01
218000 -- (-901.945) (-901.491) [-902.133] (-908.366) * (-905.819) [-905.007] (-902.603) (-907.612) -- 0:01:00
218500 -- (-903.551) (-902.131) [-902.819] (-904.292) * (-905.787) [-905.304] (-901.466) (-905.844) -- 0:01:00
219000 -- (-904.147) [-903.848] (-903.142) (-905.769) * (-905.925) (-902.988) (-904.611) [-906.687] -- 0:01:00
219500 -- (-901.900) [-904.625] (-901.310) (-902.180) * (-903.365) (-906.744) [-902.772] (-902.092) -- 0:01:00
220000 -- (-902.712) (-908.739) [-903.012] (-901.989) * (-903.766) (-902.570) (-903.119) [-902.407] -- 0:01:00
Average standard deviation of split frequencies: 0.015853
220500 -- (-905.572) (-909.203) (-902.197) [-901.766] * (-904.213) (-904.631) [-902.704] (-902.261) -- 0:01:00
221000 -- (-904.922) (-904.824) [-907.165] (-903.571) * (-904.768) [-903.554] (-904.234) (-901.039) -- 0:00:59
221500 -- [-905.532] (-905.664) (-906.572) (-902.836) * [-905.384] (-902.599) (-901.766) (-904.881) -- 0:00:59
222000 -- (-903.226) (-901.831) (-904.624) [-903.232] * [-903.050] (-904.449) (-903.338) (-907.936) -- 0:00:59
222500 -- (-903.011) [-903.664] (-904.939) (-902.541) * (-905.971) (-906.772) [-904.771] (-905.765) -- 0:00:59
223000 -- (-902.050) (-902.401) (-902.958) [-904.381] * (-905.243) (-903.665) (-908.323) [-904.025] -- 0:01:02
223500 -- (-904.533) [-903.423] (-905.272) (-902.664) * [-902.364] (-902.835) (-912.956) (-903.891) -- 0:01:02
224000 -- (-903.422) (-903.229) (-908.003) [-903.844] * [-903.572] (-904.754) (-904.061) (-908.862) -- 0:01:02
224500 -- [-901.959] (-903.535) (-904.255) (-904.091) * (-903.088) (-902.419) (-902.125) [-911.873] -- 0:01:02
225000 -- (-903.132) [-903.751] (-903.550) (-901.585) * [-902.351] (-906.452) (-903.169) (-902.927) -- 0:01:02
Average standard deviation of split frequencies: 0.014601
225500 -- (-905.744) (-903.833) (-903.110) [-903.005] * [-901.807] (-905.940) (-902.994) (-903.171) -- 0:01:01
226000 -- [-904.939] (-905.741) (-902.745) (-905.045) * (-901.632) [-902.247] (-903.760) (-908.698) -- 0:01:01
226500 -- (-902.635) (-906.960) (-903.139) [-902.506] * (-901.894) (-902.758) [-902.721] (-913.300) -- 0:01:01
227000 -- (-903.147) [-905.975] (-903.260) (-903.203) * (-902.696) (-902.542) [-901.276] (-908.115) -- 0:01:01
227500 -- [-902.444] (-905.136) (-902.287) (-902.521) * (-901.397) [-902.417] (-902.099) (-903.835) -- 0:01:01
228000 -- (-904.818) (-905.538) [-902.183] (-903.398) * [-906.173] (-902.369) (-901.880) (-905.549) -- 0:01:00
228500 -- (-902.733) [-902.558] (-903.542) (-902.973) * [-904.010] (-902.211) (-901.971) (-907.817) -- 0:01:00
229000 -- [-901.809] (-902.834) (-905.850) (-903.114) * (-902.129) [-901.337] (-903.397) (-904.243) -- 0:01:00
229500 -- [-905.987] (-903.000) (-905.494) (-904.999) * [-901.585] (-905.122) (-904.023) (-902.868) -- 0:01:00
230000 -- (-906.612) (-902.476) (-903.351) [-902.114] * (-901.734) (-902.391) (-907.575) [-903.587] -- 0:01:00
Average standard deviation of split frequencies: 0.014628
230500 -- (-908.876) [-903.723] (-901.193) (-902.613) * [-902.327] (-903.527) (-905.851) (-903.207) -- 0:01:00
231000 -- (-904.814) [-902.037] (-905.985) (-902.375) * [-902.334] (-904.710) (-903.416) (-904.993) -- 0:00:59
231500 -- [-904.335] (-901.953) (-904.910) (-901.677) * [-901.644] (-902.116) (-903.529) (-904.762) -- 0:00:59
232000 -- (-904.124) [-901.334] (-902.056) (-902.881) * (-903.021) (-902.883) (-902.732) [-903.489] -- 0:00:59
232500 -- [-903.663] (-902.654) (-902.108) (-905.170) * (-908.892) [-901.723] (-903.408) (-903.992) -- 0:00:59
233000 -- (-903.990) [-902.088] (-902.520) (-904.225) * (-902.739) (-907.798) (-906.962) [-902.740] -- 0:00:59
233500 -- [-902.507] (-902.194) (-902.592) (-903.147) * [-907.778] (-906.510) (-904.702) (-905.850) -- 0:00:59
234000 -- [-903.554] (-901.787) (-903.466) (-906.996) * [-904.253] (-905.067) (-906.736) (-904.024) -- 0:00:58
234500 -- (-902.714) [-902.654] (-907.775) (-905.761) * (-902.116) (-902.164) [-901.805] (-904.024) -- 0:00:58
235000 -- (-905.331) (-904.867) [-901.336] (-901.466) * [-902.485] (-901.182) (-901.723) (-902.925) -- 0:01:01
Average standard deviation of split frequencies: 0.015454
235500 -- (-904.425) [-903.137] (-901.996) (-903.087) * (-901.135) [-902.407] (-902.424) (-902.732) -- 0:01:01
236000 -- [-902.831] (-902.381) (-904.267) (-903.181) * [-903.264] (-906.298) (-902.806) (-901.858) -- 0:01:01
236500 -- [-903.165] (-902.532) (-904.081) (-903.684) * (-902.108) (-903.025) (-902.782) [-902.796] -- 0:01:01
237000 -- (-902.028) (-903.913) (-905.615) [-901.530] * (-903.044) (-904.060) (-903.440) [-903.300] -- 0:01:01
237500 -- (-908.753) (-903.444) [-907.020] (-908.615) * (-902.371) (-903.951) (-903.087) [-905.852] -- 0:01:01
238000 -- (-906.182) [-901.739] (-904.193) (-904.842) * (-901.950) (-906.128) (-903.773) [-901.976] -- 0:01:00
238500 -- (-904.779) (-901.003) (-903.264) [-902.304] * (-902.253) (-903.101) [-902.684] (-901.919) -- 0:01:00
239000 -- [-907.606] (-904.793) (-903.670) (-901.441) * (-903.259) (-901.903) [-904.151] (-902.489) -- 0:01:00
239500 -- (-905.229) [-904.306] (-905.384) (-901.315) * (-902.314) (-901.904) [-902.392] (-903.004) -- 0:01:00
240000 -- (-906.068) [-903.796] (-903.328) (-904.491) * [-902.537] (-904.268) (-904.005) (-904.713) -- 0:01:00
Average standard deviation of split frequencies: 0.015561
240500 -- [-905.975] (-909.576) (-903.092) (-904.917) * (-902.714) (-902.387) [-902.807] (-906.776) -- 0:01:00
241000 -- [-902.945] (-909.646) (-901.743) (-903.156) * (-908.468) (-902.194) [-903.880] (-902.274) -- 0:00:59
241500 -- (-903.099) (-908.802) (-901.603) [-908.391] * [-903.193] (-909.490) (-903.183) (-901.610) -- 0:00:59
242000 -- (-907.088) (-903.878) [-902.228] (-902.027) * (-903.881) (-903.395) [-901.925] (-905.711) -- 0:00:59
242500 -- (-907.919) (-909.322) [-901.884] (-904.117) * (-902.389) (-903.317) [-903.187] (-901.402) -- 0:00:59
243000 -- [-903.404] (-902.244) (-902.240) (-903.544) * (-906.508) (-901.574) [-904.580] (-903.269) -- 0:00:59
243500 -- (-901.757) (-901.779) (-903.964) [-904.598] * (-905.170) [-906.301] (-902.147) (-901.582) -- 0:00:59
244000 -- [-903.132] (-901.741) (-904.497) (-904.754) * (-903.448) (-902.742) [-903.016] (-901.839) -- 0:00:58
244500 -- (-902.142) [-902.442] (-902.496) (-903.268) * (-905.828) (-903.598) [-903.386] (-901.425) -- 0:00:58
245000 -- (-905.461) [-903.118] (-902.964) (-902.091) * (-902.479) [-902.996] (-903.365) (-902.697) -- 0:00:58
Average standard deviation of split frequencies: 0.016742
245500 -- (-905.661) (-902.653) [-902.627] (-902.340) * [-903.432] (-902.564) (-902.739) (-904.607) -- 0:00:58
246000 -- (-909.024) (-903.226) [-904.955] (-904.650) * [-902.625] (-904.617) (-905.283) (-903.398) -- 0:00:58
246500 -- (-903.245) [-906.615] (-902.271) (-905.719) * (-902.475) [-903.282] (-902.990) (-902.884) -- 0:00:58
247000 -- [-901.669] (-905.785) (-906.389) (-904.001) * (-902.806) (-902.209) (-902.902) [-901.756] -- 0:00:57
247500 -- [-903.309] (-906.554) (-905.010) (-903.954) * (-902.589) (-901.904) (-904.830) [-901.996] -- 0:01:00
248000 -- (-902.988) (-904.190) (-909.205) [-902.153] * (-902.776) (-903.832) [-905.107] (-902.684) -- 0:01:00
248500 -- (-907.453) (-902.510) [-905.203] (-902.290) * (-906.797) [-902.124] (-902.195) (-902.793) -- 0:01:00
249000 -- (-901.397) [-903.487] (-903.253) (-901.757) * (-905.275) (-903.157) [-903.306] (-903.790) -- 0:01:00
249500 -- (-902.703) (-903.021) (-907.183) [-902.759] * (-908.417) (-902.477) (-904.272) [-903.279] -- 0:01:00
250000 -- (-903.069) (-904.078) (-906.742) [-904.291] * [-906.533] (-907.133) (-902.852) (-903.499) -- 0:01:00
Average standard deviation of split frequencies: 0.015515
250500 -- [-906.458] (-903.161) (-902.591) (-904.390) * (-905.487) (-908.771) (-902.515) [-901.923] -- 0:00:59
251000 -- [-904.714] (-905.903) (-902.563) (-902.955) * (-905.760) (-906.132) (-903.842) [-903.186] -- 0:00:59
251500 -- [-906.746] (-902.508) (-902.978) (-902.826) * (-905.010) (-903.767) [-907.537] (-903.111) -- 0:00:59
252000 -- (-906.598) (-903.674) [-903.793] (-904.763) * (-903.509) (-907.563) [-904.414] (-901.274) -- 0:00:59
252500 -- [-903.413] (-901.881) (-908.470) (-905.088) * (-904.464) (-901.734) (-905.041) [-901.395] -- 0:00:59
253000 -- (-906.388) (-905.386) [-903.243] (-902.829) * (-905.019) [-902.662] (-906.809) (-902.933) -- 0:00:59
253500 -- (-902.510) (-906.478) [-905.930] (-901.924) * [-902.163] (-903.386) (-902.237) (-902.925) -- 0:00:58
254000 -- [-903.825] (-904.623) (-904.230) (-901.673) * (-904.149) (-906.623) (-903.545) [-902.041] -- 0:00:58
254500 -- [-903.910] (-907.419) (-906.378) (-904.379) * (-904.820) (-905.110) [-903.798] (-901.563) -- 0:00:58
255000 -- (-906.079) (-904.410) (-904.412) [-902.267] * (-904.860) (-903.907) (-904.357) [-903.108] -- 0:00:58
Average standard deviation of split frequencies: 0.016573
255500 -- (-905.672) (-910.250) [-902.406] (-902.743) * (-903.382) (-905.134) [-902.822] (-902.420) -- 0:00:58
256000 -- (-905.492) (-903.256) [-901.426] (-904.131) * (-910.831) (-904.388) [-906.399] (-902.956) -- 0:00:58
256500 -- (-903.873) (-902.173) [-905.360] (-906.600) * (-902.806) (-903.704) [-904.943] (-902.575) -- 0:00:57
257000 -- (-903.198) (-901.682) (-902.544) [-902.831] * (-904.906) [-903.774] (-905.178) (-903.420) -- 0:00:57
257500 -- (-903.118) [-904.823] (-908.806) (-903.568) * (-904.226) [-903.939] (-905.413) (-905.350) -- 0:00:57
258000 -- [-905.859] (-902.402) (-904.138) (-903.321) * (-901.966) (-903.694) [-903.904] (-902.237) -- 0:00:57
258500 -- (-903.305) [-905.936] (-904.032) (-902.681) * (-902.594) (-902.062) [-902.952] (-903.707) -- 0:00:57
259000 -- (-903.608) (-905.995) [-906.350] (-902.467) * (-903.459) (-902.217) (-902.512) [-904.993] -- 0:00:57
259500 -- [-903.768] (-902.616) (-906.126) (-905.282) * [-902.642] (-902.895) (-904.376) (-902.319) -- 0:00:57
260000 -- (-903.677) [-901.803] (-906.537) (-906.409) * (-903.033) [-903.877] (-903.952) (-902.560) -- 0:00:59
Average standard deviation of split frequencies: 0.015744
260500 -- (-908.547) [-902.243] (-905.343) (-904.687) * (-904.582) (-902.209) (-903.564) [-902.292] -- 0:00:59
261000 -- [-901.953] (-901.589) (-903.935) (-902.932) * (-903.144) (-902.649) [-904.873] (-902.486) -- 0:00:59
261500 -- [-901.829] (-903.220) (-903.415) (-902.318) * (-905.859) (-903.722) [-901.622] (-905.431) -- 0:00:59
262000 -- (-902.174) (-904.841) (-904.221) [-902.919] * (-909.144) (-904.621) [-902.847] (-903.484) -- 0:00:59
262500 -- [-904.386] (-901.945) (-904.493) (-902.621) * [-905.354] (-907.655) (-901.158) (-902.841) -- 0:00:59
263000 -- (-903.871) (-901.272) [-903.099] (-903.296) * (-907.330) [-902.088] (-901.329) (-903.352) -- 0:00:58
263500 -- [-903.374] (-904.661) (-901.656) (-906.111) * (-901.510) (-903.046) [-901.916] (-904.397) -- 0:00:58
264000 -- (-902.797) (-904.022) [-905.356] (-902.724) * (-906.609) (-904.778) [-903.179] (-903.225) -- 0:00:58
264500 -- (-906.608) [-904.294] (-903.308) (-903.576) * [-903.209] (-904.518) (-902.977) (-903.021) -- 0:00:58
265000 -- (-902.784) (-905.384) (-907.782) [-905.866] * [-902.292] (-903.266) (-904.382) (-902.609) -- 0:00:58
Average standard deviation of split frequencies: 0.015359
265500 -- (-902.397) (-902.971) (-902.594) [-912.543] * (-902.465) (-903.194) (-902.774) [-901.909] -- 0:00:58
266000 -- [-903.976] (-907.049) (-902.055) (-903.134) * (-903.759) (-905.153) (-903.195) [-902.083] -- 0:00:57
266500 -- [-903.387] (-903.208) (-901.978) (-903.185) * (-905.557) [-903.177] (-906.363) (-903.723) -- 0:00:57
267000 -- (-905.417) (-904.434) [-902.621] (-902.039) * (-905.653) (-908.910) [-903.046] (-903.248) -- 0:00:57
267500 -- (-901.724) (-901.325) (-902.434) [-902.082] * (-902.189) (-908.614) [-902.149] (-904.571) -- 0:00:57
268000 -- (-906.635) [-901.195] (-902.793) (-903.326) * (-902.421) [-909.043] (-903.207) (-904.434) -- 0:00:57
268500 -- [-902.174] (-903.692) (-903.723) (-901.314) * (-901.282) (-905.591) (-902.831) [-903.548] -- 0:00:57
269000 -- (-902.418) (-903.743) (-903.929) [-902.937] * [-904.091] (-902.195) (-903.773) (-905.026) -- 0:00:57
269500 -- [-902.748] (-901.829) (-902.036) (-904.978) * (-903.319) (-901.902) [-902.686] (-907.898) -- 0:00:56
270000 -- (-903.713) [-903.988] (-903.028) (-905.418) * (-903.371) (-902.746) [-901.374] (-905.691) -- 0:00:56
Average standard deviation of split frequencies: 0.014030
270500 -- (-903.030) [-901.570] (-903.969) (-903.932) * (-903.261) (-901.753) [-902.197] (-906.280) -- 0:00:56
271000 -- (-904.303) [-901.401] (-902.356) (-905.500) * (-904.843) (-903.768) [-901.698] (-905.003) -- 0:00:56
271500 -- [-902.219] (-903.668) (-908.377) (-909.069) * (-903.611) [-904.064] (-902.687) (-904.612) -- 0:00:56
272000 -- (-907.728) (-903.761) (-904.864) [-905.413] * [-903.475] (-901.958) (-901.466) (-902.856) -- 0:00:56
272500 -- [-907.035] (-903.537) (-904.444) (-903.735) * (-902.570) (-905.120) (-904.387) [-902.856] -- 0:00:58
273000 -- [-904.366] (-905.942) (-905.208) (-902.042) * (-909.406) (-903.036) [-904.423] (-902.560) -- 0:00:58
273500 -- (-907.075) (-904.484) (-902.782) [-901.820] * (-908.598) (-903.846) (-902.745) [-906.175] -- 0:00:58
274000 -- [-904.806] (-905.709) (-902.097) (-903.059) * (-903.613) [-901.340] (-902.418) (-904.683) -- 0:00:58
274500 -- [-903.392] (-904.411) (-902.404) (-902.137) * (-903.738) (-906.145) (-904.971) [-903.830] -- 0:00:58
275000 -- [-901.712] (-905.257) (-901.651) (-904.211) * (-904.476) [-904.661] (-902.889) (-904.047) -- 0:00:58
Average standard deviation of split frequencies: 0.014233
275500 -- (-903.167) [-902.480] (-905.789) (-903.256) * (-902.880) (-904.126) [-905.049] (-903.980) -- 0:00:57
276000 -- (-904.301) [-902.966] (-904.988) (-902.395) * [-902.386] (-905.840) (-905.457) (-903.148) -- 0:00:57
276500 -- (-903.081) (-903.436) (-904.715) [-903.528] * (-905.661) (-903.245) (-903.750) [-902.939] -- 0:00:57
277000 -- [-902.259] (-902.369) (-906.509) (-903.671) * (-901.861) (-902.335) [-902.069] (-903.642) -- 0:00:57
277500 -- [-903.908] (-901.907) (-902.762) (-906.164) * (-903.606) (-905.271) [-901.987] (-906.027) -- 0:00:57
278000 -- (-902.668) [-904.005] (-904.125) (-907.089) * [-902.064] (-903.912) (-902.863) (-908.221) -- 0:00:57
278500 -- (-901.766) (-906.802) [-902.824] (-903.942) * (-908.041) (-907.909) (-903.186) [-902.623] -- 0:00:56
279000 -- (-907.528) (-903.201) [-904.388] (-903.047) * (-904.246) (-907.936) (-902.389) [-904.628] -- 0:00:56
279500 -- (-905.051) [-902.227] (-908.137) (-903.515) * (-904.906) (-902.156) (-902.031) [-902.640] -- 0:00:56
280000 -- (-904.815) (-904.682) (-907.458) [-903.425] * (-902.463) (-909.724) (-904.498) [-901.311] -- 0:00:56
Average standard deviation of split frequencies: 0.014743
280500 -- (-906.283) [-901.988] (-904.444) (-902.045) * [-902.451] (-903.201) (-906.535) (-901.494) -- 0:00:56
281000 -- (-904.029) [-901.163] (-905.619) (-903.491) * [-904.933] (-902.765) (-904.430) (-902.048) -- 0:00:56
281500 -- (-907.702) (-904.368) [-902.950] (-903.549) * [-902.639] (-902.732) (-906.010) (-902.218) -- 0:00:56
282000 -- (-909.451) [-905.783] (-904.596) (-904.529) * [-902.443] (-902.282) (-909.423) (-903.921) -- 0:00:56
282500 -- (-903.633) (-904.379) (-908.032) [-902.582] * (-901.413) (-902.746) (-912.915) [-903.979] -- 0:00:55
283000 -- [-901.429] (-902.302) (-901.165) (-906.802) * [-905.355] (-901.984) (-905.137) (-902.673) -- 0:00:55
283500 -- [-902.929] (-901.962) (-901.790) (-902.683) * (-901.767) (-901.167) [-902.629] (-904.905) -- 0:00:55
284000 -- (-902.397) [-903.053] (-904.337) (-902.333) * (-901.946) (-901.522) [-902.062] (-904.883) -- 0:00:55
284500 -- (-904.080) (-904.669) [-904.596] (-904.250) * (-906.896) [-901.158] (-902.935) (-908.898) -- 0:00:55
285000 -- [-904.765] (-903.348) (-903.718) (-905.291) * (-901.848) (-901.214) [-904.442] (-904.086) -- 0:00:55
Average standard deviation of split frequencies: 0.014227
285500 -- (-904.235) [-904.880] (-905.058) (-905.081) * (-904.049) (-905.617) [-903.534] (-902.124) -- 0:00:57
286000 -- (-904.417) [-902.439] (-903.801) (-905.246) * (-901.704) [-900.999] (-902.853) (-903.183) -- 0:00:57
286500 -- (-901.765) (-903.534) (-906.490) [-904.572] * (-904.468) (-905.935) (-905.691) [-904.573] -- 0:00:57
287000 -- (-905.243) (-907.353) [-902.518] (-907.265) * (-904.872) [-905.378] (-904.643) (-904.272) -- 0:00:57
287500 -- [-905.129] (-905.593) (-903.978) (-906.462) * [-902.436] (-903.175) (-907.517) (-903.730) -- 0:00:57
288000 -- (-901.673) [-909.949] (-903.026) (-904.650) * (-902.867) (-902.583) [-904.485] (-901.652) -- 0:00:56
288500 -- [-902.057] (-909.272) (-902.609) (-902.845) * (-902.867) (-903.277) (-902.059) [-901.308] -- 0:00:56
289000 -- (-905.969) (-904.438) [-903.653] (-903.378) * (-902.190) [-901.780] (-905.133) (-902.092) -- 0:00:56
289500 -- (-907.390) (-906.624) [-905.447] (-902.880) * (-902.807) (-901.729) [-903.439] (-904.375) -- 0:00:56
290000 -- (-902.968) (-904.277) (-902.338) [-902.294] * [-903.265] (-901.729) (-904.217) (-902.246) -- 0:00:56
Average standard deviation of split frequencies: 0.014511
290500 -- (-903.146) [-901.604] (-908.269) (-901.408) * (-903.004) [-902.022] (-906.681) (-902.778) -- 0:00:56
291000 -- (-903.257) [-902.868] (-903.459) (-901.695) * (-902.626) (-901.279) (-903.724) [-902.590] -- 0:00:56
291500 -- (-902.805) (-902.936) [-903.889] (-903.322) * (-901.760) (-903.264) [-903.947] (-903.048) -- 0:00:55
292000 -- (-901.562) (-905.037) (-903.528) [-903.477] * (-904.387) (-904.370) (-902.819) [-901.400] -- 0:00:55
292500 -- (-906.897) [-902.327] (-901.903) (-903.206) * [-905.927] (-903.540) (-904.844) (-902.827) -- 0:00:55
293000 -- (-904.765) [-905.878] (-903.738) (-902.290) * (-905.860) (-902.792) [-901.925] (-905.835) -- 0:00:55
293500 -- (-906.833) [-903.406] (-902.630) (-901.652) * (-903.088) [-901.704] (-903.376) (-905.628) -- 0:00:55
294000 -- (-906.634) [-904.277] (-903.077) (-904.150) * [-902.230] (-902.211) (-903.655) (-903.119) -- 0:00:55
294500 -- (-904.541) (-903.410) (-901.692) [-904.031] * [-901.307] (-906.021) (-905.573) (-905.968) -- 0:00:55
295000 -- [-901.355] (-904.504) (-902.076) (-904.424) * (-903.640) (-904.340) [-901.928] (-904.531) -- 0:00:54
Average standard deviation of split frequencies: 0.013747
295500 -- [-901.959] (-904.450) (-902.460) (-902.746) * (-903.635) (-903.913) (-908.902) [-902.612] -- 0:00:54
296000 -- (-902.085) [-903.034] (-905.313) (-902.356) * (-903.101) [-904.373] (-904.808) (-906.016) -- 0:00:54
296500 -- [-901.857] (-903.240) (-905.494) (-905.135) * (-903.612) (-904.935) (-908.006) [-903.775] -- 0:00:54
297000 -- (-901.890) (-903.480) [-905.213] (-908.506) * [-904.540] (-907.976) (-903.968) (-901.349) -- 0:00:54
297500 -- (-902.490) (-905.687) (-906.643) [-901.750] * (-902.917) [-903.410] (-903.760) (-901.261) -- 0:00:54
298000 -- (-901.306) (-905.672) [-905.503] (-902.997) * (-904.815) [-902.559] (-901.912) (-901.477) -- 0:00:54
298500 -- (-902.192) (-906.036) (-902.743) [-902.372] * [-903.793] (-901.752) (-903.754) (-901.600) -- 0:00:54
299000 -- (-905.841) (-908.280) [-903.644] (-903.977) * (-904.090) (-902.460) [-906.221] (-901.230) -- 0:00:56
299500 -- (-905.135) (-905.208) (-903.937) [-903.616] * (-904.968) (-901.671) (-908.696) [-902.511] -- 0:00:56
300000 -- (-903.138) (-904.393) [-904.869] (-906.292) * (-905.446) [-902.686] (-905.146) (-905.194) -- 0:00:56
Average standard deviation of split frequencies: 0.013946
300500 -- (-903.218) [-903.878] (-902.507) (-906.944) * [-901.910] (-902.268) (-904.360) (-901.927) -- 0:00:55
301000 -- (-902.576) (-902.778) (-904.818) [-903.104] * (-901.773) (-904.183) (-903.963) [-902.717] -- 0:00:55
301500 -- [-903.936] (-902.919) (-903.297) (-902.391) * (-905.807) (-906.289) [-903.489] (-906.066) -- 0:00:55
302000 -- (-907.426) (-901.807) (-904.837) [-903.268] * (-904.382) [-905.506] (-906.804) (-908.859) -- 0:00:55
302500 -- (-903.447) (-902.114) (-903.062) [-901.962] * (-904.779) (-905.045) [-904.029] (-904.578) -- 0:00:55
303000 -- (-905.103) (-901.473) (-901.699) [-901.357] * (-905.214) (-907.141) [-901.239] (-903.882) -- 0:00:55
303500 -- [-904.183] (-902.961) (-903.643) (-904.930) * (-905.053) [-901.469] (-902.001) (-902.705) -- 0:00:55
304000 -- [-902.349] (-902.639) (-902.011) (-903.567) * (-902.571) (-901.794) [-902.062] (-903.716) -- 0:00:54
304500 -- (-905.204) [-903.431] (-902.436) (-904.290) * (-905.761) (-903.252) (-902.457) [-903.856] -- 0:00:54
305000 -- (-902.759) (-903.026) [-903.343] (-907.839) * (-901.728) [-904.000] (-903.714) (-905.861) -- 0:00:54
Average standard deviation of split frequencies: 0.013865
305500 -- [-902.398] (-902.005) (-905.018) (-904.017) * (-906.264) (-903.971) (-902.475) [-903.888] -- 0:00:54
306000 -- (-902.290) (-902.204) (-904.939) [-907.738] * (-902.141) [-901.654] (-902.030) (-909.165) -- 0:00:54
306500 -- (-902.109) (-904.706) [-901.274] (-907.007) * (-902.643) (-907.390) (-902.762) [-905.603] -- 0:00:54
307000 -- (-902.738) (-903.553) (-901.730) [-903.952] * [-902.625] (-905.918) (-906.764) (-902.572) -- 0:00:54
307500 -- (-908.777) [-903.815] (-904.061) (-906.481) * [-911.547] (-902.227) (-904.524) (-905.952) -- 0:00:54
308000 -- (-905.789) (-902.487) [-903.353] (-909.132) * (-902.310) (-903.087) [-901.545] (-905.512) -- 0:00:53
308500 -- (-903.106) (-902.036) (-904.589) [-904.549] * (-903.254) (-902.399) [-902.264] (-902.651) -- 0:00:53
309000 -- [-903.143] (-906.051) (-905.405) (-905.274) * (-905.500) (-903.802) (-906.541) [-904.816] -- 0:00:53
309500 -- (-906.794) (-905.047) [-901.592] (-905.002) * (-902.149) (-902.543) [-906.043] (-903.018) -- 0:00:53
310000 -- (-907.059) (-904.424) (-902.140) [-904.125] * (-902.520) (-901.798) (-903.399) [-904.104] -- 0:00:53
Average standard deviation of split frequencies: 0.013018
310500 -- [-903.825] (-905.009) (-901.882) (-903.892) * (-904.284) [-902.612] (-902.315) (-902.989) -- 0:00:53
311000 -- [-903.272] (-904.471) (-901.959) (-901.758) * (-903.337) (-903.659) [-902.783] (-902.241) -- 0:00:53
311500 -- [-901.855] (-906.209) (-904.578) (-903.589) * (-905.166) (-903.532) (-902.239) [-903.006] -- 0:00:53
312000 -- [-904.197] (-907.143) (-904.309) (-905.843) * (-902.971) (-903.112) [-901.180] (-901.562) -- 0:00:55
312500 -- (-909.732) (-905.648) [-901.953] (-907.407) * (-902.831) [-902.912] (-902.885) (-902.436) -- 0:00:55
313000 -- (-907.622) [-907.136] (-905.968) (-901.588) * (-904.583) (-902.680) [-902.614] (-901.851) -- 0:00:54
313500 -- [-903.618] (-906.692) (-903.158) (-901.555) * (-909.552) [-901.976] (-904.135) (-905.307) -- 0:00:54
314000 -- (-905.319) [-904.649] (-905.341) (-902.376) * [-906.582] (-901.843) (-901.604) (-906.080) -- 0:00:54
314500 -- (-903.468) (-905.572) [-901.258] (-904.167) * [-905.748] (-902.088) (-902.856) (-903.857) -- 0:00:54
315000 -- (-903.815) (-907.878) [-901.395] (-904.067) * (-903.112) [-903.001] (-904.043) (-903.378) -- 0:00:54
Average standard deviation of split frequencies: 0.014006
315500 -- (-902.122) (-901.720) [-905.092] (-906.320) * (-908.283) (-903.295) [-908.326] (-903.245) -- 0:00:54
316000 -- [-902.828] (-901.071) (-902.658) (-904.845) * (-907.264) (-901.980) (-902.905) [-902.000] -- 0:00:54
316500 -- (-902.150) [-901.343] (-902.690) (-903.815) * [-902.377] (-902.984) (-901.913) (-904.393) -- 0:00:53
317000 -- (-903.619) [-907.397] (-906.731) (-905.821) * [-904.346] (-904.533) (-902.629) (-903.919) -- 0:00:53
317500 -- (-909.135) (-902.926) (-904.547) [-902.503] * [-901.553] (-901.640) (-905.536) (-905.220) -- 0:00:53
318000 -- (-908.037) (-903.455) [-901.677] (-906.553) * (-904.414) [-901.729] (-903.673) (-903.561) -- 0:00:53
318500 -- (-905.219) [-902.678] (-903.124) (-902.330) * (-910.640) (-904.714) [-901.613] (-905.973) -- 0:00:53
319000 -- (-905.234) [-904.167] (-902.165) (-905.472) * (-910.266) [-905.512] (-901.707) (-902.158) -- 0:00:53
319500 -- (-902.318) (-904.678) [-901.654] (-902.433) * (-911.023) (-909.015) (-903.270) [-901.906] -- 0:00:53
320000 -- (-902.072) (-902.672) (-906.196) [-902.807] * [-903.717] (-903.543) (-903.321) (-902.196) -- 0:00:53
Average standard deviation of split frequencies: 0.013966
320500 -- (-903.416) (-903.227) (-904.806) [-902.402] * [-902.482] (-901.765) (-902.587) (-901.302) -- 0:00:53
321000 -- (-905.130) (-903.227) [-901.681] (-903.478) * (-904.641) [-903.860] (-901.295) (-901.384) -- 0:00:52
321500 -- (-906.440) [-901.553] (-901.734) (-903.089) * [-904.462] (-903.813) (-901.555) (-905.877) -- 0:00:52
322000 -- (-903.520) (-901.529) (-903.644) [-904.236] * (-903.194) [-904.348] (-903.829) (-904.396) -- 0:00:52
322500 -- (-904.736) [-902.863] (-902.683) (-905.074) * (-902.047) (-903.732) [-903.236] (-909.145) -- 0:00:52
323000 -- [-902.636] (-907.006) (-904.894) (-903.178) * (-904.483) (-905.562) [-903.090] (-906.229) -- 0:00:52
323500 -- (-902.556) [-906.637] (-903.557) (-905.153) * (-903.125) (-902.996) [-905.016] (-904.154) -- 0:00:52
324000 -- (-901.873) [-910.187] (-903.385) (-903.574) * [-904.078] (-905.694) (-903.026) (-905.774) -- 0:00:52
324500 -- [-902.462] (-907.792) (-903.597) (-904.915) * [-902.667] (-902.940) (-902.709) (-904.410) -- 0:00:52
325000 -- (-903.948) [-905.968] (-902.454) (-905.338) * (-902.116) [-902.409] (-902.154) (-903.959) -- 0:00:54
Average standard deviation of split frequencies: 0.013699
325500 -- (-904.771) (-903.322) (-904.934) [-901.471] * (-903.164) [-903.189] (-902.747) (-902.241) -- 0:00:53
326000 -- (-902.581) (-902.928) (-903.544) [-901.228] * (-901.959) (-902.051) (-903.321) [-901.602] -- 0:00:53
326500 -- (-904.039) (-901.516) [-905.306] (-904.873) * (-902.365) (-902.479) [-901.666] (-906.172) -- 0:00:53
327000 -- (-903.094) (-904.881) (-902.155) [-903.388] * [-902.674] (-906.886) (-902.031) (-903.804) -- 0:00:53
327500 -- (-903.266) (-901.465) [-906.828] (-905.415) * (-904.325) (-902.967) [-904.900] (-901.187) -- 0:00:53
328000 -- (-902.920) (-902.225) [-903.757] (-910.886) * (-904.112) (-902.032) (-903.663) [-901.219] -- 0:00:53
328500 -- [-903.223] (-904.109) (-902.250) (-904.593) * (-905.132) (-902.280) [-903.002] (-902.349) -- 0:00:53
329000 -- (-902.059) (-904.310) (-902.885) [-902.900] * (-903.157) [-901.165] (-902.422) (-904.062) -- 0:00:53
329500 -- [-902.074] (-906.476) (-902.495) (-902.390) * (-903.714) (-901.726) [-902.710] (-907.576) -- 0:00:52
330000 -- [-905.429] (-906.711) (-903.637) (-906.618) * (-905.103) (-902.381) (-907.942) [-902.042] -- 0:00:52
Average standard deviation of split frequencies: 0.013431
330500 -- [-907.527] (-903.889) (-903.879) (-905.585) * (-905.516) [-903.819] (-903.476) (-902.961) -- 0:00:52
331000 -- (-908.176) [-905.569] (-905.685) (-901.960) * (-904.363) [-908.255] (-904.578) (-902.327) -- 0:00:52
331500 -- (-906.251) [-903.775] (-905.002) (-903.271) * (-902.520) [-901.365] (-904.230) (-902.698) -- 0:00:52
332000 -- (-904.105) [-907.147] (-907.155) (-903.441) * (-903.796) (-902.796) (-903.362) [-903.451] -- 0:00:52
332500 -- (-903.424) (-907.432) [-901.904] (-906.444) * (-902.374) (-903.937) (-901.636) [-902.822] -- 0:00:52
333000 -- (-903.747) (-905.585) [-903.937] (-903.932) * (-905.560) (-905.881) [-901.321] (-901.547) -- 0:00:52
333500 -- (-904.544) (-902.169) (-903.410) [-904.086] * (-904.347) (-903.142) (-904.442) [-901.954] -- 0:00:51
334000 -- [-903.632] (-902.455) (-903.060) (-903.141) * (-903.346) [-901.173] (-902.848) (-902.838) -- 0:00:51
334500 -- (-905.309) [-902.522] (-903.414) (-901.518) * (-913.721) (-902.732) [-903.222] (-902.863) -- 0:00:51
335000 -- (-905.200) [-901.242] (-902.656) (-904.601) * (-905.547) (-904.077) (-901.762) [-904.490] -- 0:00:51
Average standard deviation of split frequencies: 0.012332
335500 -- (-909.500) (-902.343) (-903.373) [-904.991] * (-904.358) (-902.693) (-901.796) [-903.032] -- 0:00:51
336000 -- (-904.938) (-904.142) [-903.081] (-902.835) * (-904.378) [-903.954] (-901.733) (-902.978) -- 0:00:51
336500 -- (-904.081) [-903.799] (-903.445) (-902.555) * (-903.775) (-901.649) [-902.991] (-902.621) -- 0:00:51
337000 -- [-903.459] (-904.674) (-903.795) (-902.497) * [-902.419] (-903.460) (-902.928) (-901.790) -- 0:00:51
337500 -- [-904.154] (-902.206) (-905.038) (-908.577) * (-902.133) [-901.205] (-902.383) (-907.188) -- 0:00:51
338000 -- (-901.239) (-905.009) (-907.905) [-902.170] * (-902.495) (-901.865) (-905.766) [-901.356] -- 0:00:52
338500 -- [-901.599] (-903.911) (-902.341) (-902.934) * [-904.755] (-901.845) (-902.169) (-901.304) -- 0:00:52
339000 -- (-902.192) [-904.918] (-904.224) (-905.360) * (-905.516) (-902.894) (-905.003) [-902.117] -- 0:00:52
339500 -- (-903.786) [-901.471] (-902.030) (-906.279) * (-904.940) (-902.411) [-904.507] (-902.619) -- 0:00:52
340000 -- (-906.374) (-901.322) [-902.884] (-904.748) * (-903.107) (-902.500) [-906.876] (-903.435) -- 0:00:52
Average standard deviation of split frequencies: 0.013109
340500 -- (-905.723) [-902.970] (-902.387) (-903.934) * [-905.553] (-905.166) (-907.119) (-902.058) -- 0:00:52
341000 -- [-906.826] (-903.493) (-904.150) (-902.593) * [-902.664] (-903.656) (-904.235) (-902.070) -- 0:00:52
341500 -- (-908.964) [-901.782] (-902.979) (-906.335) * (-901.756) (-905.679) (-902.467) [-901.524] -- 0:00:52
342000 -- [-902.365] (-903.661) (-904.964) (-902.290) * [-902.040] (-906.885) (-903.994) (-902.277) -- 0:00:51
342500 -- (-903.347) (-902.182) [-906.233] (-903.065) * (-908.335) (-905.397) [-903.203] (-901.669) -- 0:00:51
343000 -- (-902.669) (-902.064) (-905.595) [-906.263] * (-902.923) [-904.415] (-906.474) (-903.635) -- 0:00:51
343500 -- (-901.983) (-901.774) [-905.135] (-903.697) * (-901.336) (-904.481) [-905.083] (-906.630) -- 0:00:51
344000 -- [-902.681] (-904.395) (-906.783) (-901.837) * (-902.116) [-901.256] (-903.241) (-903.826) -- 0:00:51
344500 -- (-901.767) (-903.258) [-901.625] (-902.550) * (-902.342) [-907.692] (-901.694) (-903.299) -- 0:00:51
345000 -- (-907.277) (-904.056) [-903.572] (-903.345) * [-902.170] (-903.686) (-905.526) (-904.209) -- 0:00:51
Average standard deviation of split frequencies: 0.013624
345500 -- [-905.283] (-902.099) (-906.841) (-901.979) * [-901.535] (-902.215) (-905.113) (-905.003) -- 0:00:51
346000 -- (-902.020) (-901.855) [-902.139] (-902.388) * (-901.631) [-902.911] (-901.549) (-902.538) -- 0:00:51
346500 -- (-904.486) (-904.152) [-902.606] (-904.267) * (-902.477) [-907.452] (-901.972) (-902.554) -- 0:00:50
347000 -- (-902.196) (-903.646) [-904.289] (-902.481) * (-904.039) (-905.208) (-904.470) [-902.553] -- 0:00:50
347500 -- [-903.429] (-905.231) (-903.404) (-906.561) * [-902.658] (-903.871) (-903.644) (-905.996) -- 0:00:50
348000 -- (-905.145) (-902.498) [-902.651] (-901.366) * [-903.442] (-903.473) (-902.225) (-904.959) -- 0:00:50
348500 -- (-904.515) [-903.005] (-904.087) (-901.344) * (-902.750) (-902.882) [-906.639] (-904.053) -- 0:00:50
349000 -- (-902.491) (-904.951) [-903.785] (-902.636) * (-904.686) (-902.498) [-905.354] (-903.529) -- 0:00:50
349500 -- [-903.191] (-901.446) (-907.219) (-901.752) * (-903.573) [-902.195] (-904.238) (-902.177) -- 0:00:50
350000 -- (-905.224) (-902.623) (-904.696) [-902.762] * (-907.481) [-903.007] (-904.516) (-902.893) -- 0:00:50
Average standard deviation of split frequencies: 0.012573
350500 -- (-903.311) [-901.714] (-902.782) (-902.951) * (-907.690) (-903.934) (-908.756) [-902.889] -- 0:00:50
351000 -- [-902.315] (-904.981) (-901.397) (-904.339) * (-902.636) [-904.964] (-903.181) (-904.791) -- 0:00:49
351500 -- (-905.854) (-901.460) [-901.660] (-903.775) * (-901.454) (-905.380) (-904.540) [-902.098] -- 0:00:51
352000 -- (-903.242) (-903.038) (-902.050) [-901.362] * (-902.307) (-903.513) [-905.342] (-903.429) -- 0:00:51
352500 -- (-902.990) (-903.079) [-902.176] (-909.594) * (-902.092) (-904.292) (-906.692) [-903.983] -- 0:00:51
353000 -- (-902.423) (-903.285) (-902.936) [-904.697] * (-902.267) (-904.055) (-905.827) [-904.514] -- 0:00:51
353500 -- (-902.422) (-902.999) [-906.534] (-902.913) * (-905.118) (-902.759) (-903.195) [-903.416] -- 0:00:51
354000 -- [-902.785] (-902.069) (-901.591) (-903.530) * [-902.574] (-907.941) (-903.401) (-903.929) -- 0:00:51
354500 -- (-903.697) [-905.507] (-903.018) (-902.427) * (-902.645) [-901.083] (-903.436) (-902.745) -- 0:00:50
355000 -- (-902.703) [-906.546] (-903.189) (-902.474) * (-904.065) (-901.321) [-904.083] (-902.824) -- 0:00:50
Average standard deviation of split frequencies: 0.012580
355500 -- (-906.233) (-904.227) (-905.570) [-904.085] * [-903.853] (-901.486) (-903.977) (-903.438) -- 0:00:50
356000 -- (-902.317) (-904.098) (-902.585) [-905.377] * (-906.610) [-904.079] (-902.572) (-902.261) -- 0:00:50
356500 -- [-903.008] (-904.322) (-909.416) (-902.202) * (-904.006) (-903.353) (-903.631) [-902.664] -- 0:00:50
357000 -- (-903.784) (-904.594) (-911.046) [-903.123] * (-902.834) (-903.101) (-905.248) [-903.072] -- 0:00:50
357500 -- (-904.654) (-903.133) [-905.752] (-902.976) * (-901.956) (-902.038) [-902.661] (-903.096) -- 0:00:50
358000 -- (-905.068) [-902.388] (-903.314) (-903.607) * (-904.978) [-902.160] (-905.880) (-910.114) -- 0:00:50
358500 -- (-903.682) [-904.598] (-904.130) (-902.084) * (-907.555) (-902.017) [-907.334] (-904.157) -- 0:00:50
359000 -- (-902.201) (-904.441) (-903.586) [-904.576] * (-901.735) (-901.914) (-902.447) [-905.052] -- 0:00:49
359500 -- (-902.087) (-905.104) [-901.918] (-904.991) * [-902.081] (-905.304) (-903.774) (-903.134) -- 0:00:49
360000 -- (-902.296) (-906.078) (-905.430) [-905.444] * (-902.290) [-904.063] (-902.998) (-902.995) -- 0:00:49
Average standard deviation of split frequencies: 0.012090
360500 -- (-904.343) [-902.935] (-901.375) (-903.744) * (-902.905) (-902.378) (-901.331) [-906.775] -- 0:00:49
361000 -- (-904.555) [-905.258] (-903.272) (-905.777) * (-903.893) [-905.801] (-902.000) (-903.853) -- 0:00:49
361500 -- (-902.085) (-904.407) (-902.280) [-902.388] * (-903.781) [-905.679] (-902.032) (-905.727) -- 0:00:49
362000 -- (-904.070) (-904.240) (-905.758) [-902.641] * (-902.244) (-904.415) [-903.581] (-905.826) -- 0:00:49
362500 -- (-901.832) [-902.060] (-903.151) (-902.724) * [-902.336] (-905.304) (-904.167) (-903.591) -- 0:00:49
363000 -- (-902.273) [-902.623] (-901.774) (-902.118) * (-903.519) (-904.411) (-901.681) [-903.794] -- 0:00:49
363500 -- [-901.926] (-903.234) (-905.311) (-902.150) * (-903.002) (-901.501) (-906.568) [-904.821] -- 0:00:49
364000 -- (-902.735) (-910.787) (-906.251) [-901.587] * [-901.178] (-902.338) (-904.495) (-903.200) -- 0:00:50
364500 -- (-902.547) (-907.003) (-902.879) [-901.484] * (-904.198) [-902.300] (-910.178) (-904.581) -- 0:00:50
365000 -- (-905.306) (-905.718) [-903.057] (-902.895) * [-904.348] (-907.706) (-905.742) (-906.148) -- 0:00:50
Average standard deviation of split frequencies: 0.012737
365500 -- (-901.937) (-902.406) [-902.000] (-902.141) * (-902.244) [-902.676] (-901.572) (-904.045) -- 0:00:50
366000 -- (-902.189) (-901.780) [-904.007] (-904.976) * (-902.356) [-902.981] (-904.599) (-901.939) -- 0:00:50
366500 -- (-902.063) (-905.033) [-902.616] (-902.400) * (-904.148) [-901.895] (-904.930) (-902.520) -- 0:00:50
367000 -- [-905.318] (-904.749) (-902.265) (-905.082) * (-905.141) [-904.214] (-901.485) (-902.291) -- 0:00:50
367500 -- [-904.166] (-907.787) (-903.324) (-904.638) * (-908.666) [-901.164] (-905.897) (-901.873) -- 0:00:49
368000 -- (-905.787) (-905.726) [-903.068] (-901.983) * (-905.714) (-906.385) (-909.120) [-902.697] -- 0:00:49
368500 -- [-905.898] (-905.663) (-904.257) (-902.325) * (-903.227) (-901.812) (-902.952) [-901.649] -- 0:00:49
369000 -- [-902.608] (-905.103) (-903.684) (-902.766) * (-904.268) (-902.268) [-904.789] (-902.695) -- 0:00:49
369500 -- (-903.917) (-904.870) [-902.714] (-902.743) * [-904.949] (-909.028) (-903.930) (-911.565) -- 0:00:49
370000 -- (-907.125) [-902.999] (-904.987) (-902.667) * (-906.063) (-907.756) (-902.225) [-901.639] -- 0:00:49
Average standard deviation of split frequencies: 0.011446
370500 -- (-906.645) (-903.611) (-902.233) [-902.615] * (-903.348) (-905.462) (-902.516) [-905.867] -- 0:00:49
371000 -- (-905.476) [-903.100] (-902.374) (-901.652) * (-903.388) (-909.442) (-903.295) [-901.568] -- 0:00:49
371500 -- (-902.743) (-903.938) [-901.965] (-903.005) * (-907.573) [-904.793] (-902.096) (-902.823) -- 0:00:49
372000 -- (-905.743) [-903.876] (-905.229) (-901.612) * [-904.790] (-903.315) (-902.319) (-901.315) -- 0:00:48
372500 -- (-901.861) (-902.418) [-903.425] (-903.244) * [-906.003] (-902.802) (-905.683) (-903.068) -- 0:00:48
373000 -- (-907.845) [-902.700] (-908.439) (-902.146) * (-909.816) (-904.963) (-905.429) [-903.221] -- 0:00:48
373500 -- (-903.300) (-906.094) [-911.436] (-903.205) * (-915.357) [-902.617] (-904.119) (-901.354) -- 0:00:48
374000 -- [-901.950] (-903.857) (-906.466) (-903.018) * (-902.702) (-904.152) (-901.419) [-908.927] -- 0:00:48
374500 -- (-902.031) (-905.437) (-905.279) [-901.296] * (-911.375) [-902.599] (-903.644) (-902.564) -- 0:00:48
375000 -- (-904.899) (-904.403) (-902.363) [-901.932] * [-904.808] (-902.051) (-903.739) (-904.185) -- 0:00:48
Average standard deviation of split frequencies: 0.011519
375500 -- (-903.890) (-902.700) (-903.503) [-904.509] * (-904.140) (-902.637) [-904.452] (-904.440) -- 0:00:48
376000 -- [-902.117] (-903.201) (-906.063) (-905.284) * (-902.380) (-902.448) [-902.298] (-905.561) -- 0:00:48
376500 -- (-903.058) (-904.949) [-902.246] (-906.377) * (-902.374) (-901.927) (-907.053) [-902.648] -- 0:00:48
377000 -- (-903.190) (-904.325) [-902.784] (-903.835) * (-904.521) (-903.737) (-908.668) [-905.247] -- 0:00:49
377500 -- (-905.443) [-904.810] (-904.169) (-903.145) * (-905.240) (-905.056) [-901.884] (-904.764) -- 0:00:49
378000 -- (-903.680) (-906.862) [-908.032] (-904.667) * (-904.920) [-901.654] (-903.990) (-904.839) -- 0:00:49
378500 -- (-903.675) [-901.326] (-904.570) (-901.949) * (-904.111) (-903.737) [-903.367] (-903.326) -- 0:00:49
379000 -- (-902.142) (-901.896) (-902.085) [-902.958] * (-902.807) (-905.217) (-903.269) [-902.651] -- 0:00:49
379500 -- (-903.916) [-902.409] (-906.263) (-902.333) * (-902.980) (-902.788) (-902.490) [-903.811] -- 0:00:49
380000 -- (-901.932) (-902.316) (-905.250) [-901.861] * (-902.982) (-906.061) (-904.059) [-901.883] -- 0:00:48
Average standard deviation of split frequencies: 0.011476
380500 -- (-904.951) (-905.928) [-903.487] (-901.118) * (-903.525) [-903.642] (-901.945) (-901.867) -- 0:00:48
381000 -- (-903.967) (-905.424) [-903.313] (-902.643) * (-902.475) (-903.715) [-902.437] (-902.245) -- 0:00:48
381500 -- (-902.753) (-907.550) (-903.426) [-901.868] * (-903.070) [-908.336] (-902.567) (-904.375) -- 0:00:48
382000 -- (-904.444) (-903.144) [-903.524] (-902.732) * (-903.903) (-903.465) [-901.942] (-903.159) -- 0:00:48
382500 -- (-905.348) (-902.487) [-903.696] (-903.595) * (-902.329) (-901.708) (-904.024) [-903.382] -- 0:00:48
383000 -- (-906.160) [-906.007] (-903.567) (-903.368) * (-904.081) [-906.833] (-904.785) (-906.464) -- 0:00:48
383500 -- (-905.221) (-902.080) [-905.194] (-904.667) * (-902.814) (-902.885) [-902.752] (-902.512) -- 0:00:48
384000 -- (-902.958) (-902.466) [-903.582] (-902.141) * (-901.519) (-904.455) (-902.202) [-903.160] -- 0:00:48
384500 -- (-906.889) [-903.328] (-903.368) (-902.605) * [-905.115] (-904.288) (-904.124) (-903.657) -- 0:00:48
385000 -- (-904.399) (-904.172) (-903.086) [-901.973] * (-901.723) [-903.151] (-904.545) (-903.613) -- 0:00:47
Average standard deviation of split frequencies: 0.010910
385500 -- (-904.154) (-903.730) [-903.627] (-903.217) * (-901.807) (-903.807) (-904.709) [-901.880] -- 0:00:47
386000 -- (-904.149) (-906.332) [-903.310] (-905.097) * (-903.001) (-908.125) (-903.361) [-902.019] -- 0:00:47
386500 -- [-901.890] (-905.653) (-904.501) (-903.603) * (-902.301) (-903.387) [-906.317] (-903.652) -- 0:00:47
387000 -- (-902.987) (-904.660) (-904.562) [-901.989] * (-904.726) [-901.999] (-906.769) (-908.401) -- 0:00:47
387500 -- (-903.359) [-903.359] (-904.413) (-902.254) * (-905.394) [-902.100] (-902.318) (-904.047) -- 0:00:47
388000 -- [-902.325] (-901.959) (-903.811) (-902.712) * [-905.482] (-902.043) (-902.603) (-902.009) -- 0:00:47
388500 -- (-904.469) [-902.060] (-903.527) (-904.342) * (-903.390) (-904.817) (-904.630) [-905.598] -- 0:00:47
389000 -- [-903.205] (-905.119) (-902.041) (-905.563) * [-902.537] (-903.403) (-904.774) (-904.952) -- 0:00:47
389500 -- (-903.040) [-902.865] (-901.979) (-906.323) * [-903.935] (-902.822) (-905.887) (-905.373) -- 0:00:47
390000 -- (-902.234) (-901.984) (-903.676) [-901.740] * [-904.168] (-901.433) (-906.107) (-904.393) -- 0:00:48
Average standard deviation of split frequencies: 0.011262
390500 -- (-901.778) [-902.505] (-901.300) (-903.019) * (-902.465) (-904.018) (-903.051) [-905.093] -- 0:00:48
391000 -- (-901.262) (-902.166) [-902.903] (-905.301) * (-905.175) (-902.663) (-903.957) [-904.367] -- 0:00:48
391500 -- (-902.193) (-903.191) [-902.861] (-905.893) * [-904.756] (-903.508) (-906.262) (-903.343) -- 0:00:48
392000 -- [-901.190] (-905.382) (-902.757) (-904.111) * (-903.351) (-902.705) (-907.836) [-905.110] -- 0:00:48
392500 -- [-901.189] (-907.794) (-902.413) (-903.924) * (-904.092) [-902.662] (-906.254) (-907.550) -- 0:00:47
393000 -- (-907.323) (-902.640) (-905.111) [-902.955] * (-903.463) (-904.872) (-902.602) [-904.102] -- 0:00:47
393500 -- [-903.679] (-902.349) (-902.890) (-903.613) * [-901.295] (-902.363) (-905.672) (-901.602) -- 0:00:47
394000 -- (-904.549) (-904.837) [-903.897] (-903.483) * (-904.550) [-902.411] (-901.063) (-907.271) -- 0:00:47
394500 -- (-903.509) (-905.695) (-906.354) [-905.062] * [-905.292] (-903.893) (-901.233) (-905.162) -- 0:00:47
395000 -- [-903.902] (-903.614) (-901.742) (-901.963) * (-902.527) (-903.911) [-901.848] (-901.480) -- 0:00:47
Average standard deviation of split frequencies: 0.009999
395500 -- [-903.248] (-903.604) (-901.656) (-903.958) * (-905.359) (-905.878) [-903.542] (-905.340) -- 0:00:47
396000 -- (-902.385) [-902.979] (-901.801) (-904.658) * [-901.241] (-902.861) (-903.703) (-903.948) -- 0:00:47
396500 -- (-902.825) [-902.360] (-901.316) (-909.904) * (-904.258) [-905.926] (-906.498) (-903.791) -- 0:00:47
397000 -- (-903.295) (-905.098) (-905.935) [-904.258] * [-901.785] (-905.829) (-905.233) (-905.119) -- 0:00:47
397500 -- (-902.965) (-904.270) (-904.107) [-901.291] * (-901.495) (-905.001) (-903.890) [-902.442] -- 0:00:46
398000 -- (-903.661) [-902.504] (-902.234) (-902.129) * [-903.906] (-904.382) (-906.338) (-902.581) -- 0:00:46
398500 -- (-905.288) (-905.934) (-905.739) [-902.077] * (-904.078) (-902.799) [-903.324] (-903.735) -- 0:00:46
399000 -- [-904.108] (-903.143) (-901.503) (-902.595) * [-904.573] (-901.861) (-904.245) (-901.414) -- 0:00:46
399500 -- (-903.225) (-905.154) [-905.515] (-902.325) * (-906.767) [-902.973] (-902.516) (-901.266) -- 0:00:46
400000 -- (-902.818) [-902.542] (-901.661) (-903.490) * (-903.619) (-904.231) (-907.597) [-902.108] -- 0:00:46
Average standard deviation of split frequencies: 0.010589
400500 -- (-903.994) (-902.988) [-903.423] (-903.490) * [-902.328] (-902.224) (-902.330) (-904.720) -- 0:00:46
401000 -- (-910.081) (-901.959) [-904.886] (-903.009) * (-903.212) [-904.711] (-901.657) (-904.794) -- 0:00:46
401500 -- [-908.081] (-901.829) (-902.184) (-901.849) * [-907.870] (-902.703) (-902.477) (-902.449) -- 0:00:46
402000 -- (-904.878) (-902.513) (-902.839) [-903.145] * [-906.547] (-902.743) (-901.647) (-904.569) -- 0:00:46
402500 -- (-903.257) (-905.842) [-904.159] (-905.001) * (-904.614) [-902.646] (-904.556) (-907.581) -- 0:00:46
403000 -- [-903.130] (-907.441) (-901.881) (-902.304) * (-904.496) (-904.139) [-905.890] (-906.403) -- 0:00:47
403500 -- (-904.959) (-903.788) (-903.540) [-904.007] * (-903.768) (-903.368) [-904.961] (-903.034) -- 0:00:47
404000 -- (-903.202) [-903.766] (-903.487) (-903.117) * (-904.071) (-906.676) (-907.711) [-901.623] -- 0:00:47
404500 -- (-902.122) (-901.916) (-902.206) [-904.139] * (-901.834) (-904.681) (-905.643) [-905.376] -- 0:00:47
405000 -- (-904.127) (-903.296) (-906.119) [-906.391] * (-901.984) (-902.908) (-901.892) [-902.996] -- 0:00:47
Average standard deviation of split frequencies: 0.010992
405500 -- (-902.368) (-903.240) (-904.190) [-905.996] * (-901.949) (-903.192) [-902.056] (-911.434) -- 0:00:46
406000 -- (-901.912) (-907.658) (-910.476) [-902.492] * [-902.371] (-902.800) (-906.025) (-902.409) -- 0:00:46
406500 -- (-902.123) [-904.280] (-908.739) (-903.958) * (-906.271) (-901.899) [-901.909] (-904.203) -- 0:00:46
407000 -- (-903.174) [-905.192] (-903.526) (-903.742) * (-904.881) (-902.127) [-904.522] (-904.286) -- 0:00:46
407500 -- (-902.679) (-903.772) (-901.563) [-905.601] * (-911.110) (-901.823) (-905.759) [-904.821] -- 0:00:46
408000 -- [-902.182] (-902.945) (-904.074) (-903.303) * (-903.326) [-901.644] (-904.013) (-901.496) -- 0:00:46
408500 -- (-903.497) [-904.284] (-901.915) (-902.227) * [-906.346] (-902.436) (-903.520) (-904.862) -- 0:00:46
409000 -- (-902.155) [-903.518] (-901.213) (-902.906) * [-902.361] (-902.290) (-901.503) (-903.162) -- 0:00:46
409500 -- [-902.198] (-903.519) (-902.225) (-903.850) * [-905.542] (-903.141) (-902.497) (-905.398) -- 0:00:46
410000 -- [-903.785] (-904.949) (-902.417) (-902.844) * (-905.337) (-908.000) (-902.372) [-904.678] -- 0:00:46
Average standard deviation of split frequencies: 0.010943
410500 -- (-903.731) [-902.629] (-903.058) (-903.206) * (-903.174) [-901.972] (-901.764) (-904.541) -- 0:00:45
411000 -- [-902.319] (-901.957) (-902.506) (-904.179) * [-901.773] (-901.167) (-906.466) (-907.322) -- 0:00:45
411500 -- [-905.737] (-905.161) (-901.478) (-901.990) * (-901.807) [-901.763] (-905.252) (-905.582) -- 0:00:45
412000 -- (-902.186) (-901.905) [-902.491] (-902.107) * (-903.400) [-902.309] (-903.082) (-905.470) -- 0:00:45
412500 -- [-906.336] (-901.626) (-904.931) (-902.947) * (-903.485) (-906.963) (-906.091) [-906.593] -- 0:00:45
413000 -- (-904.372) (-902.689) (-902.387) [-903.145] * (-904.491) [-906.729] (-903.769) (-904.297) -- 0:00:45
413500 -- (-903.399) (-901.448) [-903.878] (-902.923) * [-903.873] (-902.532) (-904.498) (-904.248) -- 0:00:45
414000 -- (-905.013) [-903.503] (-902.644) (-905.258) * (-903.015) [-906.995] (-903.756) (-907.934) -- 0:00:45
414500 -- (-905.568) (-905.587) (-903.028) [-905.391] * (-907.020) (-905.470) (-905.129) [-904.375] -- 0:00:45
415000 -- (-903.263) (-901.992) (-906.127) [-904.031] * (-914.425) (-904.536) (-905.947) [-905.723] -- 0:00:45
Average standard deviation of split frequencies: 0.011181
415500 -- (-902.314) (-903.678) [-902.425] (-903.733) * (-908.913) (-903.994) (-903.289) [-902.185] -- 0:00:46
416000 -- [-903.388] (-905.322) (-902.234) (-902.477) * (-904.922) (-902.647) (-903.498) [-902.183] -- 0:00:46
416500 -- [-902.201] (-904.906) (-903.777) (-902.144) * (-902.302) [-903.760] (-901.890) (-903.338) -- 0:00:46
417000 -- (-904.276) (-902.959) (-901.954) [-903.917] * [-902.414] (-904.421) (-902.962) (-902.729) -- 0:00:46
417500 -- (-904.343) (-906.947) [-901.955] (-902.391) * (-902.163) [-903.479] (-906.675) (-903.585) -- 0:00:46
418000 -- (-902.617) [-903.631] (-902.976) (-903.550) * [-902.504] (-903.748) (-902.948) (-907.568) -- 0:00:45
418500 -- (-901.832) (-902.519) [-904.343] (-901.616) * (-901.474) (-901.703) [-902.246] (-905.288) -- 0:00:45
419000 -- (-901.677) (-905.811) (-905.763) [-901.217] * (-901.783) (-903.054) (-901.525) [-902.505] -- 0:00:45
419500 -- [-904.582] (-904.455) (-907.344) (-903.876) * (-903.482) (-904.153) [-902.486] (-902.049) -- 0:00:45
420000 -- (-905.061) (-902.337) (-902.201) [-901.814] * (-901.595) [-903.098] (-903.553) (-903.384) -- 0:00:45
Average standard deviation of split frequencies: 0.010608
420500 -- (-902.131) (-901.879) (-903.035) [-902.488] * (-901.446) (-904.541) (-908.103) [-902.669] -- 0:00:45
421000 -- (-907.155) (-904.156) (-902.386) [-902.916] * (-902.922) (-902.472) (-905.735) [-902.251] -- 0:00:45
421500 -- (-904.703) [-908.072] (-903.686) (-904.171) * (-902.238) (-906.155) [-901.720] (-901.402) -- 0:00:45
422000 -- (-906.453) (-901.337) (-902.999) [-901.820] * [-907.342] (-901.240) (-901.552) (-901.240) -- 0:00:45
422500 -- (-901.305) (-903.898) (-903.264) [-901.479] * (-909.570) (-901.350) [-903.467] (-905.981) -- 0:00:45
423000 -- (-903.620) (-904.050) (-902.557) [-902.494] * (-906.889) (-902.261) (-903.288) [-902.043] -- 0:00:45
423500 -- (-902.911) [-905.775] (-902.664) (-901.368) * [-902.304] (-901.540) (-902.960) (-903.014) -- 0:00:44
424000 -- (-904.652) (-901.637) [-903.230] (-901.269) * (-903.342) [-901.591] (-903.030) (-902.571) -- 0:00:44
424500 -- (-903.426) (-901.558) (-907.306) [-902.902] * (-907.280) (-905.282) (-901.806) [-903.161] -- 0:00:44
425000 -- (-905.739) [-904.948] (-905.437) (-903.505) * [-904.647] (-901.362) (-902.723) (-902.476) -- 0:00:44
Average standard deviation of split frequencies: 0.011287
425500 -- (-904.154) (-902.590) (-905.746) [-902.095] * (-904.315) [-907.354] (-902.269) (-909.052) -- 0:00:44
426000 -- (-906.128) (-903.824) [-905.491] (-903.304) * (-904.505) [-901.236] (-901.555) (-906.492) -- 0:00:44
426500 -- (-909.946) [-905.150] (-904.389) (-902.296) * (-913.251) (-902.430) (-904.221) [-903.282] -- 0:00:44
427000 -- (-903.984) (-905.906) [-902.898] (-902.237) * [-902.896] (-901.457) (-905.572) (-903.618) -- 0:00:44
427500 -- (-903.813) (-904.623) (-903.266) [-901.955] * (-903.607) (-903.114) [-903.222] (-903.998) -- 0:00:44
428000 -- (-902.521) (-903.813) (-903.668) [-903.687] * [-905.708] (-902.825) (-904.587) (-903.099) -- 0:00:44
428500 -- (-904.380) (-903.601) [-903.203] (-905.493) * [-903.968] (-902.016) (-903.398) (-904.558) -- 0:00:45
429000 -- (-905.571) (-905.894) (-902.928) [-904.250] * (-904.125) (-906.635) [-901.841] (-906.079) -- 0:00:45
429500 -- [-903.351] (-904.828) (-903.593) (-904.282) * (-902.051) (-902.483) [-903.485] (-907.139) -- 0:00:45
430000 -- (-905.649) [-901.489] (-901.662) (-904.657) * [-904.588] (-901.894) (-903.792) (-902.861) -- 0:00:45
Average standard deviation of split frequencies: 0.010873
430500 -- [-903.609] (-904.701) (-904.459) (-903.925) * (-906.683) (-903.418) (-903.474) [-903.048] -- 0:00:44
431000 -- [-905.309] (-908.824) (-905.176) (-903.347) * (-902.263) (-902.627) (-903.674) [-903.605] -- 0:00:44
431500 -- (-905.160) (-909.440) (-903.021) [-902.012] * [-903.891] (-903.626) (-904.120) (-905.499) -- 0:00:44
432000 -- [-908.247] (-906.419) (-906.137) (-903.834) * (-902.987) (-903.536) (-902.647) [-903.031] -- 0:00:44
432500 -- [-902.726] (-903.793) (-902.375) (-908.072) * [-901.370] (-903.071) (-902.410) (-905.947) -- 0:00:44
433000 -- (-904.322) (-905.786) [-903.419] (-907.139) * (-904.859) (-903.028) [-902.406] (-908.765) -- 0:00:44
433500 -- (-902.530) (-905.906) [-903.419] (-904.802) * (-906.961) (-903.058) (-903.075) [-904.111] -- 0:00:44
434000 -- [-902.129] (-907.985) (-901.606) (-903.067) * (-904.271) (-903.700) (-902.446) [-904.523] -- 0:00:44
434500 -- (-902.561) (-905.357) [-902.058] (-903.108) * [-902.650] (-905.763) (-905.968) (-903.489) -- 0:00:44
435000 -- (-903.212) [-902.549] (-903.832) (-904.961) * (-902.334) (-903.782) [-904.658] (-901.993) -- 0:00:44
Average standard deviation of split frequencies: 0.011488
435500 -- (-902.832) (-901.841) [-902.314] (-905.079) * (-902.889) (-903.638) [-904.021] (-902.637) -- 0:00:44
436000 -- (-903.080) (-904.300) [-905.186] (-904.207) * (-911.885) (-903.174) (-909.266) [-907.286] -- 0:00:43
436500 -- [-901.213] (-902.377) (-901.807) (-904.463) * (-903.541) [-904.349] (-905.128) (-904.615) -- 0:00:43
437000 -- [-902.508] (-901.273) (-904.942) (-904.431) * (-904.848) (-907.275) (-907.381) [-902.001] -- 0:00:43
437500 -- (-904.684) (-901.399) [-904.530] (-911.298) * (-903.266) (-905.569) [-906.216] (-902.069) -- 0:00:43
438000 -- [-902.899] (-904.152) (-902.277) (-902.275) * (-902.831) (-904.715) [-903.928] (-904.384) -- 0:00:43
438500 -- [-902.015] (-905.375) (-902.327) (-904.272) * (-903.324) (-902.861) [-907.825] (-902.524) -- 0:00:43
439000 -- (-903.456) [-903.413] (-903.381) (-901.569) * [-902.357] (-903.079) (-907.360) (-903.855) -- 0:00:43
439500 -- (-903.054) (-903.048) [-903.658] (-902.542) * (-904.155) [-903.210] (-906.144) (-903.906) -- 0:00:43
440000 -- (-904.892) (-902.146) [-904.018] (-908.284) * (-902.515) (-906.004) (-901.978) [-903.692] -- 0:00:43
Average standard deviation of split frequencies: 0.012168
440500 -- (-904.802) (-904.929) (-902.701) [-902.190] * (-902.225) (-905.285) [-902.677] (-903.362) -- 0:00:43
441000 -- (-902.145) (-910.784) [-901.850] (-902.680) * [-904.437] (-903.023) (-905.172) (-903.869) -- 0:00:43
441500 -- (-901.876) (-904.283) [-902.430] (-906.145) * (-902.567) (-903.638) (-903.173) [-904.477] -- 0:00:44
442000 -- (-901.266) (-904.487) (-902.402) [-904.265] * [-902.142] (-903.141) (-901.996) (-907.643) -- 0:00:44
442500 -- (-904.510) [-904.312] (-903.073) (-906.291) * (-902.465) [-904.066] (-903.457) (-903.003) -- 0:00:44
443000 -- (-904.792) (-904.326) (-906.631) [-901.537] * (-902.048) [-903.588] (-903.318) (-902.289) -- 0:00:44
443500 -- [-904.831] (-904.008) (-903.207) (-901.883) * [-904.013] (-903.917) (-902.808) (-902.533) -- 0:00:43
444000 -- (-902.579) (-904.083) [-903.065] (-902.999) * [-903.134] (-902.586) (-903.990) (-903.363) -- 0:00:43
444500 -- (-903.482) (-902.656) (-902.953) [-904.149] * (-906.600) [-902.028] (-907.746) (-904.249) -- 0:00:43
445000 -- (-901.853) (-901.647) [-904.701] (-903.782) * (-904.837) (-902.819) [-903.554] (-907.346) -- 0:00:43
Average standard deviation of split frequencies: 0.012684
445500 -- (-904.265) [-903.354] (-903.776) (-906.816) * (-905.672) (-904.738) [-903.512] (-907.943) -- 0:00:43
446000 -- (-901.930) (-902.919) (-904.601) [-906.404] * (-903.635) (-903.916) [-903.473] (-908.037) -- 0:00:43
446500 -- (-902.845) [-903.635] (-911.068) (-901.757) * [-902.530] (-904.581) (-905.220) (-902.646) -- 0:00:43
447000 -- (-905.860) [-906.057] (-905.530) (-904.585) * (-905.155) (-902.556) [-905.037] (-907.868) -- 0:00:43
447500 -- (-901.980) [-905.270] (-903.617) (-901.785) * (-904.520) [-902.978] (-903.073) (-901.546) -- 0:00:43
448000 -- (-901.485) (-903.185) [-902.623] (-904.855) * [-904.977] (-903.920) (-904.435) (-901.501) -- 0:00:43
448500 -- (-904.182) (-903.926) (-902.628) [-905.844] * (-904.679) (-904.965) [-903.473] (-901.695) -- 0:00:43
449000 -- (-903.951) (-904.330) (-904.131) [-902.802] * (-906.041) (-903.954) (-904.278) [-902.644] -- 0:00:42
449500 -- (-902.233) (-905.906) (-904.459) [-901.412] * [-902.897] (-901.809) (-905.577) (-901.578) -- 0:00:42
450000 -- (-902.939) (-904.318) [-904.169] (-904.315) * (-904.481) [-903.569] (-906.307) (-903.168) -- 0:00:42
Average standard deviation of split frequencies: 0.013206
450500 -- (-903.387) [-901.646] (-904.104) (-903.709) * (-906.521) (-903.178) (-904.920) [-901.897] -- 0:00:42
451000 -- (-902.726) (-905.514) [-905.110] (-902.650) * [-904.975] (-902.853) (-905.431) (-907.424) -- 0:00:42
451500 -- (-902.272) (-905.123) [-904.087] (-902.428) * [-903.094] (-904.096) (-902.076) (-905.422) -- 0:00:42
452000 -- (-903.397) (-903.583) [-902.933] (-904.408) * (-901.648) (-902.856) (-903.152) [-904.008] -- 0:00:42
452500 -- (-907.978) [-905.232] (-902.426) (-902.488) * (-904.424) [-904.566] (-902.996) (-906.234) -- 0:00:42
453000 -- (-907.275) [-907.464] (-904.148) (-902.904) * (-903.637) (-903.621) [-904.894] (-902.511) -- 0:00:42
453500 -- (-903.203) (-901.146) [-903.179] (-902.985) * [-903.524] (-905.601) (-905.215) (-905.382) -- 0:00:42
454000 -- (-903.155) [-901.209] (-904.426) (-902.395) * [-902.328] (-904.142) (-903.678) (-914.320) -- 0:00:43
454500 -- (-904.164) (-904.318) (-905.272) [-902.213] * (-906.427) [-903.885] (-903.454) (-909.037) -- 0:00:43
455000 -- (-902.229) (-903.383) (-901.894) [-902.120] * (-902.737) (-902.643) [-902.714] (-907.547) -- 0:00:43
Average standard deviation of split frequencies: 0.012987
455500 -- (-903.065) (-903.295) (-904.864) [-903.504] * [-902.066] (-902.397) (-903.488) (-904.816) -- 0:00:43
456000 -- (-903.616) (-908.426) (-904.883) [-901.918] * (-902.903) (-904.115) (-907.744) [-903.831] -- 0:00:42
456500 -- (-901.827) (-909.876) [-904.692] (-901.387) * (-902.548) (-902.338) [-903.073] (-902.646) -- 0:00:42
457000 -- [-905.645] (-903.743) (-902.278) (-901.318) * [-902.224] (-902.556) (-908.349) (-902.734) -- 0:00:42
457500 -- [-905.688] (-907.761) (-906.575) (-904.565) * (-901.564) (-904.487) (-904.199) [-902.451] -- 0:00:42
458000 -- (-901.677) (-902.641) (-903.823) [-904.631] * (-903.213) (-903.914) (-903.145) [-902.195] -- 0:00:42
458500 -- (-903.400) (-902.810) [-903.878] (-902.362) * (-904.178) [-902.696] (-901.817) (-904.595) -- 0:00:42
459000 -- (-902.089) [-901.967] (-903.419) (-905.734) * (-905.398) (-903.163) (-902.792) [-901.768] -- 0:00:42
459500 -- (-904.380) (-903.134) (-905.979) [-905.900] * (-903.525) [-909.048] (-903.095) (-902.306) -- 0:00:42
460000 -- (-904.664) (-902.851) [-902.509] (-905.813) * [-902.281] (-903.796) (-903.919) (-904.556) -- 0:00:42
Average standard deviation of split frequencies: 0.012599
460500 -- [-904.577] (-908.973) (-904.719) (-907.629) * (-902.826) (-903.603) (-903.153) [-905.914] -- 0:00:42
461000 -- (-903.019) [-905.834] (-902.790) (-907.354) * [-903.748] (-903.732) (-903.080) (-904.763) -- 0:00:42
461500 -- [-902.507] (-901.922) (-904.085) (-902.384) * [-901.861] (-904.235) (-903.539) (-903.185) -- 0:00:42
462000 -- (-902.318) [-902.694] (-902.404) (-906.862) * [-902.161] (-903.957) (-905.614) (-903.458) -- 0:00:41
462500 -- (-903.735) [-902.896] (-903.511) (-902.757) * (-904.240) (-903.262) [-903.670] (-905.249) -- 0:00:41
463000 -- (-904.710) (-902.968) (-905.032) [-901.985] * [-902.708] (-903.186) (-907.173) (-906.596) -- 0:00:41
463500 -- (-905.887) (-902.118) [-906.040] (-901.593) * (-902.194) [-902.840] (-905.224) (-903.892) -- 0:00:41
464000 -- (-903.759) (-903.890) [-901.274] (-901.393) * [-902.924] (-902.956) (-905.760) (-905.930) -- 0:00:41
464500 -- (-903.095) (-906.338) (-901.193) [-903.636] * (-903.423) (-904.553) (-904.268) [-902.916] -- 0:00:41
465000 -- (-901.654) [-903.125] (-902.524) (-903.237) * [-903.875] (-904.108) (-903.615) (-903.360) -- 0:00:41
Average standard deviation of split frequencies: 0.012771
465500 -- (-902.976) (-901.324) (-902.656) [-904.366] * [-905.755] (-903.631) (-904.011) (-903.478) -- 0:00:41
466000 -- (-901.424) (-901.335) (-904.436) [-903.239] * (-901.729) (-901.944) (-903.011) [-909.242] -- 0:00:41
466500 -- [-901.981] (-901.835) (-902.834) (-903.942) * [-902.363] (-903.225) (-902.949) (-906.882) -- 0:00:41
467000 -- (-902.177) [-902.879] (-905.494) (-903.676) * (-906.351) (-902.449) (-903.672) [-903.871] -- 0:00:42
467500 -- (-902.632) [-902.839] (-903.919) (-903.087) * [-902.258] (-901.900) (-906.533) (-902.218) -- 0:00:42
468000 -- [-905.384] (-903.877) (-905.560) (-903.889) * (-903.789) [-902.365] (-904.061) (-902.855) -- 0:00:42
468500 -- (-904.340) (-911.332) [-905.110] (-903.449) * (-904.312) (-904.067) [-902.540] (-905.379) -- 0:00:41
469000 -- [-904.031] (-905.285) (-902.368) (-903.533) * (-903.404) [-901.712] (-901.681) (-905.099) -- 0:00:41
469500 -- (-904.235) [-902.448] (-903.793) (-902.439) * (-905.700) [-902.889] (-903.495) (-905.843) -- 0:00:41
470000 -- (-902.284) (-902.784) [-904.745] (-906.035) * [-906.308] (-904.396) (-902.770) (-905.020) -- 0:00:41
Average standard deviation of split frequencies: 0.012958
470500 -- (-901.471) [-903.551] (-906.219) (-905.216) * (-906.511) [-905.188] (-905.849) (-902.911) -- 0:00:41
471000 -- (-904.033) (-903.008) (-906.038) [-901.914] * (-902.434) (-902.773) (-903.956) [-903.326] -- 0:00:41
471500 -- (-902.674) [-901.524] (-903.388) (-904.091) * (-903.888) [-904.290] (-903.685) (-902.779) -- 0:00:41
472000 -- [-903.800] (-905.013) (-905.058) (-902.357) * (-902.457) (-901.933) (-904.289) [-901.863] -- 0:00:41
472500 -- (-902.461) (-906.228) [-901.765] (-903.586) * (-904.258) [-901.841] (-906.349) (-901.975) -- 0:00:41
473000 -- (-903.924) (-906.022) (-903.965) [-902.520] * (-901.851) (-902.125) (-906.846) [-901.833] -- 0:00:41
473500 -- (-904.186) (-907.980) (-904.851) [-902.141] * (-901.900) (-904.455) (-905.122) [-902.392] -- 0:00:41
474000 -- (-901.549) (-904.389) (-901.769) [-904.608] * (-906.980) [-901.683] (-905.450) (-903.380) -- 0:00:41
474500 -- (-909.445) [-902.304] (-901.880) (-904.606) * (-911.974) (-902.715) [-903.896] (-902.080) -- 0:00:40
475000 -- (-904.893) (-902.182) [-902.991] (-902.415) * (-902.486) (-902.028) [-904.428] (-902.638) -- 0:00:40
Average standard deviation of split frequencies: 0.012148
475500 -- (-902.070) (-903.276) [-905.081] (-902.686) * (-906.908) (-903.201) [-902.863] (-904.715) -- 0:00:40
476000 -- (-905.304) (-903.897) [-902.290] (-902.242) * (-902.073) (-902.911) (-906.763) [-903.205] -- 0:00:40
476500 -- (-906.046) [-907.020] (-903.696) (-904.724) * [-901.961] (-904.055) (-903.566) (-903.520) -- 0:00:40
477000 -- (-903.597) [-902.642] (-906.277) (-905.142) * (-903.636) (-904.781) (-903.863) [-902.751] -- 0:00:40
477500 -- (-902.041) [-902.020] (-904.769) (-904.023) * (-904.204) (-904.496) (-902.359) [-903.340] -- 0:00:40
478000 -- (-901.526) (-904.049) [-903.104] (-902.215) * [-901.594] (-902.439) (-906.337) (-904.324) -- 0:00:40
478500 -- (-901.306) (-906.107) [-902.219] (-906.292) * [-902.296] (-902.999) (-905.580) (-902.767) -- 0:00:40
479000 -- (-904.403) [-903.230] (-901.505) (-903.553) * (-913.245) (-905.941) (-904.723) [-905.200] -- 0:00:40
479500 -- (-908.448) (-902.655) (-904.376) [-904.639] * (-904.272) (-903.837) (-905.809) [-902.082] -- 0:00:40
480000 -- (-903.965) [-902.229] (-906.417) (-901.316) * (-906.044) (-903.586) [-904.560] (-903.300) -- 0:00:41
Average standard deviation of split frequencies: 0.012030
480500 -- (-903.060) (-905.196) (-904.576) [-901.267] * (-902.863) [-905.577] (-903.051) (-906.024) -- 0:00:41
481000 -- (-904.171) (-903.397) (-905.674) [-901.215] * (-904.502) [-902.447] (-905.026) (-902.747) -- 0:00:41
481500 -- [-905.157] (-908.596) (-902.189) (-901.939) * (-904.232) (-902.558) [-901.786] (-903.066) -- 0:00:40
482000 -- (-902.239) (-906.986) (-903.785) [-903.397] * (-906.789) [-902.571] (-904.204) (-902.528) -- 0:00:40
482500 -- (-901.861) [-902.054] (-902.528) (-904.089) * (-907.863) [-904.582] (-902.551) (-905.783) -- 0:00:40
483000 -- (-902.211) (-903.262) [-902.243] (-905.071) * (-903.072) [-901.705] (-903.126) (-903.204) -- 0:00:40
483500 -- [-902.726] (-902.972) (-902.091) (-902.110) * (-902.004) (-902.162) [-906.974] (-905.575) -- 0:00:40
484000 -- (-904.629) [-902.294] (-902.745) (-903.563) * (-901.673) (-904.398) [-902.971] (-902.052) -- 0:00:40
484500 -- [-903.263] (-902.257) (-904.926) (-907.085) * (-903.867) [-901.805] (-906.391) (-902.244) -- 0:00:40
485000 -- (-904.737) [-904.900] (-905.917) (-903.018) * [-902.656] (-903.820) (-907.683) (-902.748) -- 0:00:40
Average standard deviation of split frequencies: 0.012028
485500 -- (-902.741) (-903.603) [-904.164] (-902.563) * (-902.765) (-901.905) (-903.740) [-904.556] -- 0:00:40
486000 -- (-903.407) [-901.555] (-904.597) (-901.495) * [-902.552] (-903.035) (-903.364) (-906.963) -- 0:00:40
486500 -- [-903.235] (-902.471) (-903.199) (-906.006) * [-903.493] (-904.783) (-903.658) (-903.826) -- 0:00:40
487000 -- (-903.467) (-904.504) [-903.062] (-904.096) * (-905.281) [-903.506] (-904.195) (-904.571) -- 0:00:40
487500 -- [-903.192] (-904.489) (-902.732) (-902.390) * [-906.427] (-907.589) (-902.944) (-903.497) -- 0:00:39
488000 -- (-906.538) (-901.827) (-904.335) [-901.342] * (-904.720) (-904.984) (-902.211) [-901.240] -- 0:00:39
488500 -- (-905.042) (-901.705) [-902.717] (-901.751) * (-905.413) [-904.916] (-904.320) (-905.943) -- 0:00:39
489000 -- (-906.002) (-905.494) (-901.792) [-906.284] * (-905.341) [-903.782] (-903.029) (-904.981) -- 0:00:39
489500 -- (-908.287) [-903.418] (-901.789) (-905.343) * (-911.320) [-904.288] (-902.528) (-907.854) -- 0:00:39
490000 -- (-903.280) (-903.031) [-903.985] (-902.515) * (-904.074) (-903.091) (-901.550) [-902.829] -- 0:00:39
Average standard deviation of split frequencies: 0.012298
490500 -- (-904.431) [-902.370] (-905.422) (-909.378) * (-902.929) [-902.136] (-902.528) (-902.714) -- 0:00:39
491000 -- [-901.971] (-906.274) (-906.671) (-903.303) * (-902.701) (-901.917) (-903.862) [-901.811] -- 0:00:39
491500 -- [-901.427] (-903.312) (-903.163) (-906.743) * (-903.768) (-909.438) (-903.534) [-901.514] -- 0:00:39
492000 -- (-902.054) [-902.287] (-906.126) (-902.792) * (-902.605) (-904.954) (-906.540) [-901.493] -- 0:00:39
492500 -- (-903.048) (-903.662) (-904.162) [-906.915] * (-903.118) (-905.910) (-906.366) [-903.364] -- 0:00:40
493000 -- (-902.750) [-902.847] (-903.339) (-903.080) * (-905.124) [-904.773] (-901.955) (-902.867) -- 0:00:40
493500 -- [-904.768] (-903.753) (-902.615) (-902.232) * [-903.266] (-902.477) (-902.281) (-904.542) -- 0:00:40
494000 -- (-905.857) (-906.429) [-902.859] (-902.285) * [-906.135] (-901.233) (-902.224) (-901.479) -- 0:00:39
494500 -- (-903.834) [-904.188] (-908.855) (-907.097) * [-901.493] (-901.871) (-902.601) (-904.087) -- 0:00:39
495000 -- [-902.735] (-902.735) (-905.819) (-903.562) * (-903.229) (-904.808) [-902.225] (-903.787) -- 0:00:39
Average standard deviation of split frequencies: 0.011468
495500 -- (-907.731) (-903.062) [-904.403] (-903.170) * (-903.292) [-905.708] (-907.303) (-907.484) -- 0:00:39
496000 -- (-905.831) (-903.415) [-903.892] (-903.034) * (-906.153) (-902.115) [-905.448] (-904.287) -- 0:00:39
496500 -- [-904.293] (-902.723) (-905.848) (-903.687) * (-903.710) (-903.499) [-903.313] (-902.657) -- 0:00:39
497000 -- (-902.757) (-902.700) [-901.500] (-903.051) * (-903.751) (-902.275) [-904.584] (-903.960) -- 0:00:39
497500 -- (-903.077) (-904.949) [-904.365] (-902.905) * [-903.124] (-906.838) (-901.840) (-902.309) -- 0:00:39
498000 -- (-902.784) (-904.693) [-901.892] (-904.190) * (-904.913) [-903.484] (-905.140) (-901.981) -- 0:00:39
498500 -- (-908.031) [-901.931] (-902.612) (-907.083) * (-905.191) (-901.888) (-904.435) [-902.595] -- 0:00:39
499000 -- [-904.891] (-901.373) (-901.502) (-910.019) * (-905.033) [-902.261] (-902.768) (-902.570) -- 0:00:39
499500 -- [-904.527] (-904.874) (-906.964) (-906.256) * [-902.891] (-902.562) (-902.636) (-903.839) -- 0:00:39
500000 -- (-902.006) (-901.414) [-902.364] (-905.706) * (-902.262) [-902.849] (-902.530) (-902.193) -- 0:00:39
Average standard deviation of split frequencies: 0.011236
500500 -- (-902.352) (-902.298) [-901.549] (-904.013) * (-903.546) [-901.694] (-902.397) (-902.664) -- 0:00:38
501000 -- (-903.427) [-904.401] (-902.532) (-902.064) * [-902.061] (-902.361) (-904.356) (-901.525) -- 0:00:38
501500 -- [-905.026] (-905.007) (-901.303) (-903.705) * (-901.132) (-906.953) [-903.467] (-902.363) -- 0:00:38
502000 -- (-904.913) (-901.521) [-903.635] (-907.041) * (-903.232) [-902.847] (-904.649) (-903.739) -- 0:00:38
502500 -- [-902.652] (-902.873) (-903.277) (-901.847) * [-902.080] (-901.673) (-901.959) (-903.398) -- 0:00:38
503000 -- (-906.960) (-902.033) (-904.772) [-903.448] * [-902.703] (-905.652) (-905.184) (-903.275) -- 0:00:38
503500 -- (-906.193) [-903.986] (-906.607) (-905.001) * [-904.940] (-904.246) (-902.652) (-902.656) -- 0:00:38
504000 -- (-901.565) (-906.621) (-908.660) [-902.342] * (-905.536) (-907.417) [-903.132] (-901.700) -- 0:00:38
504500 -- (-901.487) [-902.286] (-905.319) (-901.783) * [-906.210] (-904.181) (-902.288) (-903.115) -- 0:00:38
505000 -- (-903.661) (-905.461) [-902.701] (-903.837) * (-903.956) [-903.980] (-902.723) (-902.165) -- 0:00:38
Average standard deviation of split frequencies: 0.010683
505500 -- (-902.964) [-901.631] (-902.069) (-902.355) * (-905.008) (-902.727) (-906.358) [-901.204] -- 0:00:39
506000 -- (-905.385) (-903.507) [-904.447] (-903.962) * (-902.750) [-902.990] (-906.156) (-901.956) -- 0:00:39
506500 -- (-906.423) [-902.462] (-907.817) (-901.693) * [-902.704] (-902.581) (-906.998) (-902.987) -- 0:00:38
507000 -- (-901.730) (-902.862) (-905.085) [-906.112] * (-903.572) [-902.162] (-908.493) (-903.084) -- 0:00:38
507500 -- (-906.657) (-902.517) (-901.962) [-904.978] * [-901.637] (-902.970) (-904.853) (-901.683) -- 0:00:38
508000 -- (-905.960) (-902.051) (-904.223) [-902.086] * [-902.968] (-904.363) (-902.719) (-903.370) -- 0:00:38
508500 -- (-908.758) [-902.968] (-902.802) (-902.313) * [-901.593] (-903.974) (-906.797) (-904.885) -- 0:00:38
509000 -- (-908.546) (-902.460) [-902.587] (-902.211) * (-904.428) [-905.533] (-902.439) (-901.474) -- 0:00:38
509500 -- [-904.796] (-903.628) (-904.149) (-903.589) * [-901.815] (-902.518) (-902.811) (-904.494) -- 0:00:38
510000 -- (-903.476) (-903.966) (-902.672) [-905.305] * [-902.754] (-904.604) (-903.926) (-904.211) -- 0:00:38
Average standard deviation of split frequencies: 0.010647
510500 -- (-902.855) [-904.684] (-902.924) (-903.316) * (-902.087) [-905.232] (-903.358) (-909.131) -- 0:00:38
511000 -- (-906.612) [-903.148] (-904.538) (-902.904) * (-903.222) (-902.164) [-903.280] (-902.078) -- 0:00:38
511500 -- (-905.370) (-901.799) (-903.455) [-904.551] * (-904.438) (-902.952) (-904.930) [-902.290] -- 0:00:38
512000 -- (-903.383) (-902.263) [-901.861] (-903.444) * (-903.742) (-902.433) [-902.235] (-902.408) -- 0:00:38
512500 -- (-903.307) [-905.491] (-902.888) (-906.299) * (-903.949) (-903.569) [-902.201] (-902.527) -- 0:00:38
513000 -- (-901.850) (-902.845) [-903.382] (-908.501) * (-901.141) (-904.373) [-902.298] (-901.887) -- 0:00:37
513500 -- (-902.608) (-902.442) (-905.959) [-903.868] * [-902.311] (-904.187) (-901.823) (-901.887) -- 0:00:37
514000 -- (-904.774) (-903.798) (-902.359) [-901.795] * [-904.099] (-904.160) (-905.581) (-904.806) -- 0:00:37
514500 -- [-903.078] (-901.359) (-904.895) (-902.118) * (-904.296) (-906.961) [-902.781] (-901.434) -- 0:00:37
515000 -- [-903.631] (-903.165) (-902.809) (-903.459) * (-902.718) (-902.919) [-904.006] (-903.130) -- 0:00:37
Average standard deviation of split frequencies: 0.010415
515500 -- (-902.832) (-903.245) (-902.852) [-902.680] * [-905.162] (-904.354) (-903.843) (-902.769) -- 0:00:37
516000 -- (-903.665) (-904.553) [-906.308] (-903.218) * [-903.511] (-903.133) (-901.440) (-902.871) -- 0:00:37
516500 -- (-904.555) [-903.493] (-902.213) (-902.127) * (-903.469) (-903.957) [-903.067] (-903.801) -- 0:00:37
517000 -- (-904.235) (-902.691) (-902.053) [-901.400] * (-903.526) (-906.192) (-902.000) [-901.792] -- 0:00:37
517500 -- (-902.447) (-902.046) [-902.292] (-903.822) * (-904.555) (-902.581) (-902.957) [-902.646] -- 0:00:37
518000 -- (-904.195) (-901.971) [-903.080] (-905.487) * (-906.152) (-903.696) (-905.233) [-902.524] -- 0:00:38
518500 -- [-904.137] (-905.346) (-903.621) (-904.929) * [-905.719] (-902.026) (-908.375) (-901.568) -- 0:00:38
519000 -- [-902.566] (-905.432) (-905.764) (-902.390) * (-903.783) [-903.137] (-903.295) (-902.132) -- 0:00:37
519500 -- (-903.306) (-904.462) (-906.177) [-903.085] * (-904.893) (-903.687) (-903.383) [-902.731] -- 0:00:37
520000 -- (-901.965) [-905.493] (-901.491) (-907.361) * (-901.582) (-902.236) [-903.568] (-905.606) -- 0:00:37
Average standard deviation of split frequencies: 0.010201
520500 -- (-903.557) (-906.221) [-902.592] (-902.939) * (-901.493) (-903.756) [-902.734] (-904.883) -- 0:00:37
521000 -- [-903.937] (-904.688) (-902.007) (-902.265) * [-901.400] (-903.902) (-904.996) (-902.385) -- 0:00:37
521500 -- (-903.181) (-904.306) (-902.051) [-906.857] * (-901.468) (-901.883) (-906.359) [-904.576] -- 0:00:37
522000 -- (-906.958) (-904.418) [-903.570] (-909.919) * (-902.722) (-904.203) (-906.205) [-903.678] -- 0:00:37
522500 -- (-904.756) (-905.277) [-904.075] (-905.187) * (-901.635) [-905.352] (-905.757) (-908.322) -- 0:00:37
523000 -- (-905.477) [-903.368] (-904.506) (-906.056) * [-901.489] (-902.907) (-909.617) (-901.895) -- 0:00:37
523500 -- (-904.961) (-902.217) [-903.547] (-908.266) * (-901.649) (-902.353) (-909.581) [-906.069] -- 0:00:37
524000 -- (-904.472) (-912.209) [-903.451] (-904.585) * (-903.273) (-903.865) [-902.601] (-902.246) -- 0:00:37
524500 -- [-907.096] (-905.211) (-906.598) (-905.121) * (-904.952) [-904.359] (-904.612) (-902.039) -- 0:00:37
525000 -- (-907.061) (-903.246) (-907.951) [-902.518] * (-902.848) (-905.110) [-904.442] (-902.982) -- 0:00:37
Average standard deviation of split frequencies: 0.010336
525500 -- (-903.913) [-904.137] (-903.975) (-902.420) * (-901.639) [-902.222] (-902.289) (-902.721) -- 0:00:37
526000 -- (-901.986) [-906.406] (-903.385) (-905.224) * (-901.848) [-901.775] (-902.148) (-902.137) -- 0:00:36
526500 -- [-905.701] (-901.516) (-902.055) (-903.150) * (-906.598) (-902.762) (-906.889) [-903.150] -- 0:00:36
527000 -- (-903.353) (-902.802) [-904.699] (-904.333) * (-903.937) [-901.772] (-908.468) (-905.484) -- 0:00:36
527500 -- (-902.893) (-903.337) [-903.369] (-902.403) * [-906.414] (-905.339) (-904.061) (-903.726) -- 0:00:36
528000 -- [-901.933] (-904.144) (-904.019) (-903.884) * (-903.220) (-902.522) (-904.525) [-902.840] -- 0:00:36
528500 -- [-902.254] (-905.843) (-902.822) (-903.322) * [-903.221] (-904.057) (-903.369) (-901.938) -- 0:00:36
529000 -- [-902.635] (-901.900) (-903.598) (-903.050) * (-904.974) [-902.567] (-902.704) (-903.700) -- 0:00:36
529500 -- (-905.568) [-901.653] (-904.344) (-903.962) * [-902.712] (-902.037) (-901.538) (-904.638) -- 0:00:36
530000 -- (-903.023) (-904.861) [-902.926] (-904.181) * (-904.874) (-906.380) (-904.668) [-904.378] -- 0:00:36
Average standard deviation of split frequencies: 0.010008
530500 -- [-903.080] (-910.120) (-903.373) (-903.260) * [-904.906] (-903.040) (-906.062) (-905.796) -- 0:00:36
531000 -- (-905.235) [-903.158] (-905.755) (-903.534) * (-902.510) (-903.973) (-908.133) [-901.975] -- 0:00:37
531500 -- [-902.657] (-901.207) (-903.618) (-903.914) * [-903.128] (-906.135) (-905.608) (-902.153) -- 0:00:37
532000 -- (-905.002) (-902.766) [-905.164] (-904.664) * (-901.908) [-903.240] (-909.511) (-906.305) -- 0:00:36
532500 -- (-903.309) (-901.819) (-903.384) [-902.759] * (-902.305) (-904.230) (-903.120) [-905.271] -- 0:00:36
533000 -- (-901.768) [-904.154] (-904.449) (-903.685) * (-903.260) [-905.325] (-903.128) (-901.425) -- 0:00:36
533500 -- (-901.832) [-903.738] (-903.388) (-909.337) * (-902.108) (-905.107) (-905.968) [-901.461] -- 0:00:36
534000 -- (-901.954) [-904.798] (-904.550) (-903.789) * (-903.858) (-904.623) [-904.712] (-903.158) -- 0:00:36
534500 -- (-902.333) (-903.718) [-901.456] (-909.583) * (-903.881) [-904.489] (-904.097) (-905.214) -- 0:00:36
535000 -- (-902.784) (-903.535) [-901.643] (-909.153) * (-903.068) (-902.247) (-903.818) [-903.849] -- 0:00:36
Average standard deviation of split frequencies: 0.009850
535500 -- (-904.767) [-902.274] (-902.488) (-903.640) * (-903.948) (-901.965) (-907.889) [-901.868] -- 0:00:36
536000 -- (-903.759) [-902.419] (-904.123) (-903.983) * [-902.148] (-904.641) (-904.935) (-901.876) -- 0:00:36
536500 -- (-907.624) (-903.459) (-903.876) [-905.084] * (-901.306) [-905.310] (-905.290) (-905.881) -- 0:00:36
537000 -- (-904.720) (-902.178) [-902.555] (-904.306) * (-902.473) (-901.527) [-902.087] (-907.544) -- 0:00:36
537500 -- [-903.741] (-906.096) (-904.391) (-903.137) * (-901.441) (-904.606) (-902.690) [-906.818] -- 0:00:36
538000 -- (-902.329) (-902.568) (-902.214) [-902.725] * [-901.148] (-911.127) (-903.626) (-907.914) -- 0:00:36
538500 -- (-901.224) [-906.387] (-903.608) (-903.437) * [-901.197] (-905.245) (-901.636) (-902.943) -- 0:00:35
539000 -- [-901.296] (-908.865) (-905.007) (-902.632) * [-902.805] (-905.045) (-902.811) (-902.866) -- 0:00:35
539500 -- (-903.399) [-901.715] (-904.073) (-906.445) * (-903.174) [-904.281] (-903.386) (-902.642) -- 0:00:35
540000 -- (-903.811) [-901.552] (-901.571) (-902.715) * (-905.504) (-902.589) (-904.344) [-901.576] -- 0:00:35
Average standard deviation of split frequencies: 0.009209
540500 -- (-902.111) [-904.061] (-903.400) (-902.972) * (-906.639) (-902.692) [-901.400] (-903.137) -- 0:00:35
541000 -- [-904.823] (-904.853) (-903.463) (-903.791) * (-906.188) (-906.498) [-901.950] (-903.861) -- 0:00:35
541500 -- (-904.892) (-902.336) (-905.725) [-901.624] * [-905.511] (-904.269) (-907.261) (-903.265) -- 0:00:35
542000 -- (-904.906) [-903.659] (-901.325) (-902.467) * (-902.389) (-902.356) (-905.200) [-901.885] -- 0:00:35
542500 -- (-902.781) (-902.858) (-902.045) [-902.356] * [-903.256] (-901.821) (-903.221) (-905.033) -- 0:00:35
543000 -- (-902.136) (-901.758) (-901.375) [-903.009] * (-903.084) (-901.608) [-903.821] (-909.052) -- 0:00:35
543500 -- (-902.251) [-903.182] (-905.057) (-905.926) * (-904.504) (-902.267) (-903.915) [-903.482] -- 0:00:36
544000 -- [-902.522] (-901.529) (-901.651) (-903.223) * (-904.287) [-901.800] (-901.108) (-906.162) -- 0:00:36
544500 -- (-904.394) (-901.664) (-904.183) [-903.666] * [-902.802] (-903.311) (-901.416) (-902.792) -- 0:00:35
545000 -- (-903.381) (-906.122) [-902.538] (-903.730) * (-902.948) (-904.085) [-902.887] (-901.276) -- 0:00:35
Average standard deviation of split frequencies: 0.009767
545500 -- (-903.256) (-904.116) [-904.472] (-907.123) * (-902.500) (-904.321) (-904.322) [-903.164] -- 0:00:35
546000 -- [-902.836] (-904.353) (-903.461) (-903.289) * (-904.986) (-902.625) (-903.381) [-901.997] -- 0:00:35
546500 -- (-903.037) (-902.403) (-902.554) [-901.851] * (-905.021) [-903.745] (-904.248) (-903.191) -- 0:00:35
547000 -- [-902.642] (-902.341) (-903.628) (-905.955) * (-904.196) (-904.239) (-903.178) [-901.609] -- 0:00:35
547500 -- (-909.468) (-905.364) (-901.488) [-903.706] * [-905.668] (-907.382) (-903.049) (-901.470) -- 0:00:35
548000 -- (-906.012) (-903.452) [-902.064] (-903.931) * (-904.723) (-905.876) [-903.840] (-901.907) -- 0:00:35
548500 -- [-902.410] (-905.388) (-905.905) (-903.110) * (-903.393) (-903.893) (-901.972) [-901.591] -- 0:00:35
549000 -- [-903.884] (-902.136) (-907.812) (-901.972) * (-903.933) [-905.169] (-906.964) (-905.157) -- 0:00:35
549500 -- (-903.488) [-903.398] (-903.951) (-901.951) * [-902.105] (-903.125) (-904.994) (-902.599) -- 0:00:35
550000 -- (-909.534) [-902.795] (-904.186) (-901.280) * (-901.459) [-903.137] (-904.599) (-905.412) -- 0:00:35
Average standard deviation of split frequencies: 0.009791
550500 -- (-905.806) [-902.902] (-904.618) (-902.266) * (-901.258) (-904.835) (-902.326) [-904.330] -- 0:00:35
551000 -- (-903.045) (-902.657) (-903.578) [-902.586] * [-901.947] (-907.455) (-901.680) (-902.701) -- 0:00:35
551500 -- (-904.886) (-902.407) (-903.620) [-903.133] * (-902.295) (-903.226) [-902.194] (-902.819) -- 0:00:34
552000 -- [-902.996] (-902.853) (-904.416) (-904.888) * (-903.212) (-902.594) (-908.695) [-901.554] -- 0:00:34
552500 -- (-902.091) (-902.507) (-902.678) [-902.753] * (-902.239) (-901.586) (-902.444) [-901.359] -- 0:00:34
553000 -- (-905.090) (-903.180) [-906.011] (-902.532) * [-902.274] (-904.690) (-902.668) (-902.869) -- 0:00:34
553500 -- (-905.574) (-903.695) [-903.474] (-905.811) * (-906.525) (-901.708) (-907.523) [-902.194] -- 0:00:34
554000 -- [-903.571] (-901.335) (-902.248) (-907.755) * (-904.534) [-904.925] (-906.234) (-904.858) -- 0:00:34
554500 -- (-905.557) (-904.720) [-903.153] (-902.179) * [-905.727] (-903.748) (-901.413) (-904.206) -- 0:00:34
555000 -- (-902.747) [-902.063] (-903.877) (-903.651) * (-904.837) (-903.663) (-901.262) [-909.845] -- 0:00:34
Average standard deviation of split frequencies: 0.009379
555500 -- (-904.501) (-902.162) [-902.568] (-902.185) * [-905.903] (-903.018) (-903.507) (-903.231) -- 0:00:34
556000 -- (-905.311) [-902.245] (-902.685) (-902.593) * (-904.923) (-902.764) [-907.164] (-902.850) -- 0:00:34
556500 -- [-902.388] (-903.212) (-904.664) (-904.418) * [-902.517] (-905.681) (-901.932) (-904.883) -- 0:00:35
557000 -- (-902.004) (-901.382) (-903.966) [-904.073] * (-903.931) (-903.207) (-905.177) [-904.156] -- 0:00:34
557500 -- (-904.843) (-903.053) (-905.658) [-905.315] * (-901.629) (-903.246) (-901.784) [-903.878] -- 0:00:34
558000 -- (-902.152) (-902.402) [-904.845] (-905.374) * (-903.714) (-903.725) (-902.285) [-903.264] -- 0:00:34
558500 -- [-903.374] (-904.537) (-902.516) (-906.470) * (-903.384) (-901.782) (-903.097) [-902.582] -- 0:00:34
559000 -- [-902.375] (-904.646) (-904.037) (-905.864) * (-907.499) [-901.183] (-902.235) (-903.920) -- 0:00:34
559500 -- (-904.568) (-906.215) [-904.440] (-904.160) * (-908.448) (-902.224) [-901.928] (-907.873) -- 0:00:34
560000 -- [-903.915] (-906.085) (-909.048) (-904.366) * [-902.437] (-902.857) (-901.957) (-903.037) -- 0:00:34
Average standard deviation of split frequencies: 0.009298
560500 -- (-902.885) (-902.040) (-906.383) [-903.173] * (-905.910) (-905.102) [-902.789] (-902.189) -- 0:00:34
561000 -- [-904.299] (-903.629) (-902.026) (-904.852) * (-908.278) (-903.005) [-902.032] (-902.651) -- 0:00:34
561500 -- (-904.192) (-904.819) [-906.266] (-904.574) * (-904.388) (-902.430) [-901.256] (-902.756) -- 0:00:34
562000 -- (-902.746) (-903.804) (-904.514) [-901.858] * (-904.022) [-903.520] (-901.756) (-904.349) -- 0:00:34
562500 -- (-905.340) (-905.546) [-903.631] (-904.990) * (-902.946) (-905.864) (-905.045) [-904.484] -- 0:00:34
563000 -- (-902.776) [-902.644] (-903.253) (-903.799) * (-903.327) (-903.838) (-901.669) [-902.765] -- 0:00:34
563500 -- [-901.048] (-904.285) (-904.408) (-904.626) * [-902.052] (-903.783) (-901.394) (-905.191) -- 0:00:34
564000 -- [-902.692] (-902.841) (-903.299) (-904.582) * (-903.047) (-906.707) (-905.372) [-902.305] -- 0:00:34
564500 -- [-900.942] (-902.403) (-903.049) (-901.550) * (-902.830) (-903.600) [-903.914] (-901.781) -- 0:00:33
565000 -- (-906.633) (-902.942) [-902.580] (-902.150) * (-906.308) (-902.871) (-902.840) [-902.402] -- 0:00:33
Average standard deviation of split frequencies: 0.009700
565500 -- (-910.880) (-902.702) (-904.599) [-904.509] * (-902.052) [-906.083] (-902.908) (-901.846) -- 0:00:33
566000 -- [-902.238] (-902.347) (-905.518) (-902.807) * (-904.012) (-902.252) (-904.291) [-902.633] -- 0:00:33
566500 -- [-903.577] (-903.549) (-906.842) (-906.668) * (-905.172) [-904.077] (-902.554) (-902.393) -- 0:00:33
567000 -- (-905.256) (-904.155) [-907.222] (-906.011) * (-904.543) [-901.835] (-902.163) (-902.520) -- 0:00:33
567500 -- (-904.869) (-903.301) (-902.125) [-904.376] * (-904.486) [-901.938] (-901.490) (-904.371) -- 0:00:33
568000 -- (-907.665) [-902.386] (-904.580) (-903.767) * (-904.396) [-902.062] (-903.305) (-909.176) -- 0:00:33
568500 -- [-905.161] (-904.396) (-903.621) (-905.876) * [-904.320] (-909.468) (-903.001) (-906.098) -- 0:00:33
569000 -- (-902.649) (-903.576) [-901.834] (-906.367) * (-903.801) [-902.831] (-902.259) (-905.550) -- 0:00:33
569500 -- (-901.314) (-903.970) [-901.570] (-903.463) * (-904.954) [-903.366] (-903.463) (-904.072) -- 0:00:34
570000 -- [-901.919] (-903.936) (-901.156) (-901.243) * (-906.724) (-902.720) (-903.975) [-902.370] -- 0:00:33
Average standard deviation of split frequencies: 0.010301
570500 -- [-901.494] (-902.046) (-902.923) (-903.576) * [-902.756] (-902.599) (-902.186) (-905.644) -- 0:00:33
571000 -- (-901.384) (-905.104) (-906.566) [-903.356] * (-902.337) [-903.766] (-904.034) (-905.836) -- 0:00:33
571500 -- [-904.624] (-904.697) (-902.332) (-904.660) * (-905.412) [-904.282] (-908.946) (-901.880) -- 0:00:33
572000 -- (-904.144) (-903.889) (-910.251) [-901.191] * (-904.331) (-902.049) (-905.401) [-904.924] -- 0:00:33
572500 -- (-902.052) [-901.437] (-905.841) (-902.138) * (-904.845) (-902.268) (-903.109) [-903.749] -- 0:00:33
573000 -- (-902.103) (-903.865) [-904.127] (-902.448) * (-905.441) (-905.637) (-907.137) [-904.210] -- 0:00:33
573500 -- [-902.350] (-904.212) (-905.807) (-903.080) * (-904.542) (-903.881) (-909.143) [-902.386] -- 0:00:33
574000 -- (-902.877) [-904.989] (-902.877) (-902.117) * (-904.095) (-901.202) [-909.460] (-901.603) -- 0:00:33
574500 -- [-902.221] (-903.370) (-904.852) (-904.013) * (-901.684) [-901.580] (-903.333) (-903.071) -- 0:00:33
575000 -- (-905.206) (-906.871) (-903.479) [-901.507] * (-902.218) [-901.060] (-902.795) (-904.627) -- 0:00:33
Average standard deviation of split frequencies: 0.010350
575500 -- [-904.935] (-902.789) (-905.183) (-904.792) * [-906.276] (-903.441) (-903.112) (-906.232) -- 0:00:33
576000 -- (-904.119) (-903.878) (-905.701) [-905.112] * [-902.692] (-904.640) (-901.954) (-903.324) -- 0:00:33
576500 -- [-905.441] (-901.328) (-902.508) (-902.547) * (-906.648) (-902.917) (-903.378) [-903.043] -- 0:00:33
577000 -- (-907.041) (-902.615) [-902.295] (-903.606) * (-902.197) [-901.507] (-901.926) (-904.877) -- 0:00:32
577500 -- (-904.805) [-902.272] (-902.861) (-904.971) * (-906.470) [-903.030] (-904.018) (-903.188) -- 0:00:32
578000 -- (-905.399) (-902.581) [-904.838] (-902.261) * [-901.745] (-902.549) (-902.265) (-902.408) -- 0:00:32
578500 -- (-902.833) [-902.911] (-902.634) (-903.060) * (-902.782) (-904.026) (-902.532) [-902.476] -- 0:00:32
579000 -- (-901.620) (-904.017) [-902.417] (-903.438) * (-906.553) (-904.230) [-903.186] (-904.263) -- 0:00:32
579500 -- (-902.187) (-904.830) [-902.938] (-905.801) * [-905.217] (-902.199) (-904.887) (-904.311) -- 0:00:32
580000 -- (-909.158) (-906.691) (-905.349) [-901.530] * (-904.935) (-902.859) (-901.965) [-903.919] -- 0:00:32
Average standard deviation of split frequencies: 0.010554
580500 -- (-907.037) (-902.802) (-902.718) [-901.684] * (-903.640) [-903.228] (-902.691) (-905.317) -- 0:00:32
581000 -- (-907.603) (-904.382) (-904.750) [-904.325] * (-907.276) (-902.446) [-903.701] (-902.776) -- 0:00:32
581500 -- (-903.093) (-902.693) (-903.640) [-903.404] * (-903.424) (-904.876) (-902.828) [-907.031] -- 0:00:32
582000 -- [-903.240] (-902.000) (-901.259) (-901.921) * [-902.502] (-903.206) (-901.787) (-902.770) -- 0:00:33
582500 -- (-903.765) [-902.064] (-901.847) (-902.447) * (-902.007) [-901.886] (-904.121) (-902.901) -- 0:00:32
583000 -- (-906.619) (-906.354) [-903.433] (-904.184) * (-904.800) [-902.307] (-903.301) (-902.821) -- 0:00:32
583500 -- (-902.183) [-905.510] (-905.773) (-904.683) * (-905.822) [-902.474] (-903.272) (-903.436) -- 0:00:32
584000 -- (-904.713) (-905.722) [-905.762] (-902.170) * (-903.956) [-901.738] (-903.908) (-901.148) -- 0:00:32
584500 -- [-903.954] (-901.850) (-903.129) (-901.287) * (-904.652) (-902.538) (-903.635) [-904.800] -- 0:00:32
585000 -- [-903.215] (-901.666) (-907.022) (-901.541) * [-901.603] (-901.329) (-902.700) (-903.908) -- 0:00:32
Average standard deviation of split frequencies: 0.010268
585500 -- (-905.752) (-901.193) (-902.844) [-901.517] * [-901.561] (-907.596) (-903.585) (-905.626) -- 0:00:32
586000 -- (-906.479) (-903.848) (-903.419) [-902.312] * (-904.547) [-901.705] (-902.831) (-902.575) -- 0:00:32
586500 -- (-905.300) (-906.925) [-907.772] (-905.083) * (-905.504) (-902.758) [-902.392] (-903.060) -- 0:00:32
587000 -- [-903.785] (-904.561) (-902.365) (-902.355) * (-904.475) (-902.740) [-902.402] (-904.131) -- 0:00:32
587500 -- (-902.666) [-903.642] (-904.322) (-908.092) * [-903.595] (-904.616) (-903.308) (-902.700) -- 0:00:32
588000 -- (-902.069) (-904.369) (-904.575) [-903.049] * (-903.349) [-902.831] (-904.459) (-904.696) -- 0:00:32
588500 -- (-903.620) (-902.184) [-901.737] (-901.806) * [-904.452] (-902.759) (-905.970) (-901.842) -- 0:00:32
589000 -- [-905.086] (-905.572) (-902.091) (-902.624) * (-908.275) (-904.609) (-905.203) [-901.659] -- 0:00:32
589500 -- (-902.989) (-903.245) (-902.990) [-901.886] * (-906.703) [-905.262] (-905.708) (-903.897) -- 0:00:32
590000 -- (-902.644) (-903.521) (-905.195) [-904.995] * [-902.041] (-904.433) (-903.646) (-902.243) -- 0:00:31
Average standard deviation of split frequencies: 0.010475
590500 -- (-902.387) (-903.336) (-903.175) [-904.100] * (-904.114) (-904.084) (-902.536) [-902.221] -- 0:00:31
591000 -- (-902.470) (-903.707) [-905.635] (-903.775) * (-905.813) [-901.724] (-905.771) (-903.555) -- 0:00:31
591500 -- (-903.968) (-905.226) (-907.868) [-906.399] * (-901.361) [-903.260] (-903.242) (-902.317) -- 0:00:31
592000 -- (-903.303) [-904.155] (-905.634) (-903.049) * (-901.354) [-902.100] (-903.002) (-904.170) -- 0:00:31
592500 -- (-903.036) [-902.914] (-903.218) (-904.444) * (-902.312) (-902.022) [-904.695] (-904.083) -- 0:00:31
593000 -- (-902.779) (-902.179) [-902.054] (-905.958) * (-902.717) (-902.984) (-902.948) [-902.800] -- 0:00:31
593500 -- (-903.743) [-901.250] (-901.753) (-904.590) * (-903.535) [-906.208] (-908.325) (-905.513) -- 0:00:31
594000 -- (-907.537) (-902.742) (-901.489) [-903.251] * (-905.046) (-902.736) (-904.927) [-904.297] -- 0:00:31
594500 -- (-903.645) (-904.065) [-902.311] (-905.190) * (-903.042) (-904.475) [-904.365] (-902.268) -- 0:00:32
595000 -- [-902.700] (-901.642) (-911.869) (-902.907) * (-902.742) (-902.581) (-903.527) [-903.387] -- 0:00:31
Average standard deviation of split frequencies: 0.009590
595500 -- (-902.341) (-904.754) [-902.581] (-903.171) * (-902.548) (-908.290) (-903.470) [-903.669] -- 0:00:31
596000 -- [-905.475] (-903.637) (-903.267) (-903.850) * (-901.826) (-903.565) [-906.239] (-905.143) -- 0:00:31
596500 -- [-902.279] (-904.352) (-905.456) (-902.657) * (-904.003) (-906.793) (-907.067) [-903.091] -- 0:00:31
597000 -- (-905.846) [-903.314] (-905.715) (-903.629) * (-903.392) [-901.397] (-902.710) (-903.077) -- 0:00:31
597500 -- (-904.626) (-902.946) (-903.374) [-902.174] * [-905.517] (-904.607) (-902.682) (-904.360) -- 0:00:31
598000 -- [-902.485] (-905.582) (-907.376) (-901.913) * [-903.493] (-904.068) (-902.500) (-904.851) -- 0:00:31
598500 -- [-902.596] (-909.968) (-906.282) (-903.273) * (-904.529) [-902.547] (-903.495) (-904.634) -- 0:00:31
599000 -- (-908.554) (-906.610) [-902.700] (-903.956) * (-904.148) (-901.730) (-902.594) [-901.552] -- 0:00:31
599500 -- (-907.276) (-904.691) (-903.180) [-902.160] * (-904.275) (-904.439) [-905.548] (-905.124) -- 0:00:31
600000 -- (-903.267) [-901.262] (-902.282) (-906.349) * (-904.377) [-901.465] (-906.072) (-904.056) -- 0:00:31
Average standard deviation of split frequencies: 0.009565
600500 -- (-901.441) (-902.053) [-903.134] (-906.054) * (-904.759) (-904.848) (-904.863) [-901.754] -- 0:00:31
601000 -- (-904.533) (-902.705) [-903.278] (-901.558) * (-902.340) [-905.670] (-902.730) (-902.399) -- 0:00:31
601500 -- (-902.791) (-901.970) (-904.167) [-901.375] * (-902.287) [-905.472] (-903.327) (-903.544) -- 0:00:31
602000 -- (-902.540) (-906.844) [-903.576] (-901.925) * [-903.677] (-903.424) (-903.288) (-905.599) -- 0:00:31
602500 -- [-903.917] (-903.587) (-903.167) (-902.995) * (-904.363) (-903.416) (-902.781) [-904.066] -- 0:00:31
603000 -- (-903.923) [-902.155] (-901.660) (-903.446) * (-902.189) (-904.298) [-903.951] (-905.086) -- 0:00:30
603500 -- [-902.473] (-901.811) (-902.050) (-903.076) * (-901.587) (-904.045) [-902.485] (-904.316) -- 0:00:30
604000 -- [-902.955] (-904.400) (-903.345) (-902.603) * [-909.494] (-903.037) (-905.145) (-903.623) -- 0:00:30
604500 -- (-902.098) (-903.769) (-902.743) [-902.406] * (-902.302) (-902.991) [-903.778] (-906.227) -- 0:00:30
605000 -- (-901.738) (-908.537) (-902.842) [-901.666] * (-903.133) [-901.917] (-905.569) (-903.193) -- 0:00:30
Average standard deviation of split frequencies: 0.010064
605500 -- (-903.020) (-908.142) (-901.657) [-902.292] * [-901.976] (-905.243) (-903.153) (-904.792) -- 0:00:30
606000 -- (-904.422) [-902.342] (-904.009) (-903.734) * [-901.915] (-906.374) (-901.910) (-903.235) -- 0:00:30
606500 -- (-905.203) (-902.959) [-901.414] (-905.177) * (-902.809) (-907.588) (-903.211) [-902.681] -- 0:00:30
607000 -- [-904.561] (-902.925) (-901.395) (-903.928) * [-902.661] (-902.571) (-904.913) (-907.697) -- 0:00:30
607500 -- [-902.168] (-905.248) (-902.760) (-902.361) * (-903.776) [-902.046] (-903.716) (-902.982) -- 0:00:31
608000 -- (-902.790) (-901.528) (-902.213) [-903.053] * (-901.055) (-902.026) (-903.665) [-901.470] -- 0:00:30
608500 -- (-902.409) (-901.790) (-905.016) [-904.741] * (-901.218) (-901.660) (-903.243) [-904.070] -- 0:00:30
609000 -- (-903.063) [-901.248] (-904.370) (-902.885) * [-901.630] (-903.646) (-903.411) (-902.034) -- 0:00:30
609500 -- (-904.909) (-901.983) (-901.893) [-904.563] * (-902.228) [-902.085] (-905.380) (-903.733) -- 0:00:30
610000 -- [-906.426] (-901.940) (-902.374) (-902.625) * (-903.630) (-901.432) (-906.722) [-902.797] -- 0:00:30
Average standard deviation of split frequencies: 0.010084
610500 -- (-907.470) (-902.955) [-902.598] (-902.583) * (-901.821) [-902.558] (-905.264) (-906.339) -- 0:00:30
611000 -- [-905.435] (-904.688) (-904.864) (-902.528) * (-904.880) (-903.528) [-905.506] (-906.177) -- 0:00:30
611500 -- (-907.143) (-906.729) (-904.820) [-901.804] * [-902.248] (-902.074) (-902.770) (-902.279) -- 0:00:30
612000 -- (-903.046) (-902.105) (-903.253) [-904.006] * (-903.345) (-902.496) (-902.848) [-903.283] -- 0:00:30
612500 -- (-903.404) [-906.406] (-903.708) (-902.935) * [-903.254] (-901.467) (-902.666) (-903.754) -- 0:00:30
613000 -- [-902.196] (-903.842) (-902.160) (-903.410) * [-903.840] (-902.373) (-904.888) (-904.175) -- 0:00:30
613500 -- (-903.561) [-905.560] (-905.856) (-903.654) * (-903.943) (-904.695) [-905.639] (-902.135) -- 0:00:30
614000 -- [-903.209] (-904.065) (-908.632) (-902.533) * (-903.059) (-906.558) [-902.976] (-902.819) -- 0:00:30
614500 -- (-902.031) (-906.547) (-902.832) [-901.676] * (-903.913) [-904.007] (-904.207) (-906.125) -- 0:00:30
615000 -- (-903.199) [-904.075] (-902.895) (-901.929) * [-902.754] (-904.505) (-905.992) (-904.634) -- 0:00:30
Average standard deviation of split frequencies: 0.009422
615500 -- [-901.387] (-901.733) (-902.835) (-908.095) * (-902.792) [-902.680] (-905.856) (-904.091) -- 0:00:29
616000 -- (-901.639) [-901.883] (-905.706) (-903.963) * [-903.586] (-901.991) (-904.108) (-904.471) -- 0:00:29
616500 -- (-901.620) (-904.623) (-904.747) [-902.468] * (-903.984) [-902.876] (-904.581) (-908.380) -- 0:00:29
617000 -- [-904.237] (-903.973) (-904.456) (-903.719) * (-905.463) (-903.094) (-901.999) [-901.485] -- 0:00:29
617500 -- [-904.057] (-904.899) (-902.371) (-901.702) * [-901.921] (-901.165) (-902.001) (-904.714) -- 0:00:29
618000 -- [-903.082] (-908.231) (-902.608) (-901.470) * (-903.282) [-902.529] (-901.783) (-903.529) -- 0:00:29
618500 -- (-902.475) (-905.686) [-904.751] (-902.017) * (-906.049) (-904.068) [-903.772] (-904.171) -- 0:00:29
619000 -- (-903.570) (-903.906) (-902.396) [-902.587] * (-904.959) (-904.448) (-903.782) [-904.129] -- 0:00:29
619500 -- (-903.941) (-902.761) (-903.114) [-902.062] * (-906.367) (-904.824) (-905.951) [-902.101] -- 0:00:29
620000 -- [-902.828] (-902.467) (-903.052) (-903.227) * (-903.051) (-902.659) (-904.584) [-904.966] -- 0:00:30
Average standard deviation of split frequencies: 0.009779
620500 -- (-904.501) (-906.536) [-903.685] (-902.561) * (-901.881) [-902.322] (-904.264) (-903.597) -- 0:00:29
621000 -- [-904.244] (-905.475) (-902.633) (-902.845) * (-903.051) (-902.259) [-903.190] (-903.804) -- 0:00:29
621500 -- (-904.179) (-903.575) (-901.888) [-902.238] * (-902.646) [-902.997] (-905.059) (-904.051) -- 0:00:29
622000 -- (-904.446) (-902.515) (-906.739) [-905.844] * [-902.380] (-904.084) (-904.707) (-903.214) -- 0:00:29
622500 -- (-906.722) (-904.697) (-907.821) [-906.330] * (-904.483) (-904.467) (-906.066) [-902.688] -- 0:00:29
623000 -- [-902.189] (-902.924) (-908.322) (-903.751) * (-904.217) (-903.605) (-905.318) [-902.132] -- 0:00:29
623500 -- (-902.810) (-902.635) [-902.764] (-904.085) * (-903.320) (-902.004) [-901.737] (-902.081) -- 0:00:29
624000 -- (-901.713) (-901.664) (-903.524) [-903.880] * (-904.307) (-904.187) (-908.094) [-903.996] -- 0:00:29
624500 -- [-902.270] (-904.120) (-902.773) (-901.576) * (-903.671) (-903.568) (-903.183) [-904.389] -- 0:00:29
625000 -- [-903.793] (-902.662) (-905.901) (-902.025) * (-904.510) (-903.675) [-904.585] (-901.727) -- 0:00:29
Average standard deviation of split frequencies: 0.010119
625500 -- [-902.716] (-901.774) (-904.480) (-903.757) * (-904.152) [-902.707] (-904.312) (-905.382) -- 0:00:29
626000 -- (-904.938) (-902.575) [-902.951] (-903.114) * (-902.163) [-901.672] (-905.513) (-901.593) -- 0:00:29
626500 -- (-902.087) (-903.464) [-902.220] (-902.515) * (-902.786) [-904.469] (-904.266) (-911.811) -- 0:00:29
627000 -- (-903.596) (-905.208) (-903.229) [-905.553] * [-902.312] (-902.418) (-901.352) (-906.502) -- 0:00:29
627500 -- (-909.479) (-902.443) (-902.378) [-903.805] * [-902.226] (-902.614) (-904.194) (-906.078) -- 0:00:29
628000 -- (-909.082) (-905.440) (-902.843) [-902.003] * [-903.377] (-903.129) (-904.722) (-901.737) -- 0:00:29
628500 -- (-906.215) (-905.005) [-902.258] (-903.920) * [-901.702] (-903.189) (-906.351) (-901.019) -- 0:00:28
629000 -- (-903.951) (-904.793) [-903.559] (-901.937) * (-903.433) (-905.257) [-901.251] (-903.009) -- 0:00:28
629500 -- (-902.976) [-905.735] (-901.874) (-901.718) * (-906.733) (-903.646) (-901.548) [-902.595] -- 0:00:28
630000 -- (-902.480) (-906.026) [-901.587] (-903.988) * (-903.550) [-902.684] (-905.770) (-902.999) -- 0:00:28
Average standard deviation of split frequencies: 0.010838
630500 -- [-903.190] (-914.561) (-902.673) (-902.162) * (-902.793) (-903.779) [-904.061] (-901.730) -- 0:00:28
631000 -- (-905.570) [-902.919] (-902.455) (-901.969) * (-901.888) (-902.336) (-904.967) [-903.120] -- 0:00:28
631500 -- (-905.581) (-905.147) [-902.879] (-901.704) * [-902.727] (-902.915) (-902.257) (-904.210) -- 0:00:28
632000 -- (-903.194) (-903.687) (-903.371) [-902.788] * (-904.389) (-903.337) [-901.411] (-903.821) -- 0:00:28
632500 -- [-904.739] (-902.540) (-904.195) (-904.526) * (-904.469) [-906.313] (-902.559) (-902.108) -- 0:00:28
633000 -- [-901.694] (-902.809) (-903.813) (-902.398) * (-901.264) (-903.841) [-902.683] (-901.995) -- 0:00:28
633500 -- (-903.855) (-903.599) (-903.419) [-901.507] * (-901.246) (-901.412) (-902.918) [-902.185] -- 0:00:28
634000 -- (-903.292) (-902.345) [-902.281] (-901.258) * (-901.937) [-904.754] (-903.651) (-902.138) -- 0:00:28
634500 -- (-904.269) (-902.375) [-903.015] (-908.206) * (-902.804) (-902.522) [-902.764] (-901.517) -- 0:00:28
635000 -- [-901.866] (-910.539) (-901.639) (-904.756) * (-903.236) [-903.826] (-904.570) (-901.549) -- 0:00:28
Average standard deviation of split frequencies: 0.010145
635500 -- (-902.159) (-903.411) [-901.690] (-903.281) * (-904.181) (-905.892) (-902.359) [-904.940] -- 0:00:28
636000 -- [-905.580] (-902.134) (-903.282) (-904.100) * (-905.360) (-905.408) (-906.556) [-903.620] -- 0:00:28
636500 -- [-903.653] (-901.636) (-901.856) (-907.680) * (-902.853) (-902.039) (-906.581) [-903.487] -- 0:00:28
637000 -- [-903.596] (-902.096) (-903.342) (-902.469) * (-903.232) (-903.129) [-905.734] (-905.822) -- 0:00:28
637500 -- [-903.195] (-909.659) (-904.305) (-901.321) * (-902.802) [-902.084] (-902.894) (-906.597) -- 0:00:28
638000 -- (-902.673) (-904.513) [-902.778] (-902.915) * (-901.716) [-904.353] (-908.898) (-903.018) -- 0:00:28
638500 -- (-903.035) (-903.874) (-903.641) [-902.712] * (-902.007) (-902.124) (-904.727) [-904.819] -- 0:00:28
639000 -- [-903.063] (-903.483) (-903.407) (-901.398) * (-904.196) (-901.642) [-903.221] (-905.118) -- 0:00:28
639500 -- (-902.598) (-902.252) [-905.550] (-902.539) * (-902.849) (-902.845) (-904.142) [-902.860] -- 0:00:28
640000 -- (-902.502) (-903.831) [-903.394] (-902.622) * (-906.873) (-903.660) [-902.273] (-902.756) -- 0:00:28
Average standard deviation of split frequencies: 0.010163
640500 -- (-902.053) (-904.955) (-902.859) [-904.450] * (-904.837) (-902.336) (-902.401) [-901.994] -- 0:00:28
641000 -- (-908.198) (-904.025) [-904.102] (-903.731) * (-902.148) (-901.592) [-905.174] (-905.318) -- 0:00:28
641500 -- (-906.342) [-901.167] (-904.344) (-903.663) * (-902.827) (-901.710) [-902.580] (-909.316) -- 0:00:27
642000 -- [-902.915] (-901.306) (-907.046) (-904.125) * (-905.835) (-903.649) (-902.925) [-905.271] -- 0:00:27
642500 -- (-901.140) [-904.345] (-905.980) (-903.610) * (-902.201) (-902.723) [-902.880] (-904.725) -- 0:00:27
643000 -- (-902.909) (-904.629) [-902.342] (-902.549) * (-904.005) (-904.872) (-901.302) [-902.231] -- 0:00:27
643500 -- (-903.845) [-907.272] (-902.520) (-904.627) * [-904.059] (-904.407) (-902.605) (-902.545) -- 0:00:27
644000 -- (-902.712) [-905.713] (-901.489) (-902.989) * (-903.902) (-902.511) (-902.423) [-902.594] -- 0:00:27
644500 -- (-903.556) (-903.703) (-905.208) [-903.761] * (-904.791) (-902.644) [-903.246] (-904.861) -- 0:00:27
645000 -- (-906.852) (-902.617) [-906.887] (-902.392) * (-902.832) (-903.563) (-903.387) [-902.088] -- 0:00:27
Average standard deviation of split frequencies: 0.009760
645500 -- [-903.130] (-905.603) (-906.564) (-904.201) * (-901.194) (-904.356) (-906.355) [-901.230] -- 0:00:28
646000 -- (-902.382) (-903.101) [-901.308] (-901.802) * (-903.631) (-909.429) [-903.458] (-904.740) -- 0:00:27
646500 -- [-903.056] (-904.546) (-902.262) (-901.852) * (-902.461) (-908.609) [-903.078] (-902.726) -- 0:00:27
647000 -- (-901.316) [-902.704] (-906.497) (-903.407) * (-902.829) [-907.729] (-904.105) (-903.551) -- 0:00:27
647500 -- (-902.148) (-902.745) [-902.858] (-903.764) * (-903.889) (-909.099) [-901.837] (-904.833) -- 0:00:27
648000 -- (-901.401) (-902.397) [-902.163] (-902.279) * (-911.182) [-902.725] (-901.545) (-908.014) -- 0:00:27
648500 -- (-902.466) [-902.134] (-904.458) (-905.625) * [-902.921] (-904.932) (-902.523) (-906.459) -- 0:00:27
649000 -- (-902.870) (-904.164) (-905.214) [-903.383] * (-904.150) (-904.867) (-902.549) [-903.129] -- 0:00:27
649500 -- (-901.730) (-904.353) [-905.803] (-902.650) * [-904.141] (-904.423) (-906.523) (-901.652) -- 0:00:27
650000 -- (-903.690) (-904.421) [-903.526] (-904.716) * (-905.485) (-903.549) (-903.616) [-906.245] -- 0:00:27
Average standard deviation of split frequencies: 0.009554
650500 -- (-910.840) (-903.867) [-906.104] (-903.631) * [-902.137] (-903.393) (-902.053) (-901.747) -- 0:00:27
651000 -- [-902.866] (-904.010) (-905.654) (-902.221) * [-901.656] (-905.021) (-901.300) (-904.841) -- 0:00:27
651500 -- (-906.916) (-906.344) [-902.448] (-901.153) * (-902.877) [-905.334] (-901.160) (-905.945) -- 0:00:27
652000 -- (-903.584) [-903.138] (-905.340) (-902.231) * [-903.018] (-904.060) (-902.755) (-901.851) -- 0:00:27
652500 -- (-902.459) (-906.712) (-903.471) [-901.485] * (-902.024) (-904.862) [-901.655] (-902.908) -- 0:00:27
653000 -- (-904.435) (-903.852) (-906.825) [-901.564] * (-902.201) (-903.340) (-903.586) [-904.234] -- 0:00:27
653500 -- (-905.011) [-903.727] (-902.232) (-902.441) * [-904.299] (-902.841) (-905.152) (-902.989) -- 0:00:27
654000 -- (-903.691) (-904.489) [-902.604] (-903.667) * (-903.898) [-902.378] (-904.212) (-903.063) -- 0:00:26
654500 -- (-904.117) [-906.219] (-903.953) (-903.049) * (-903.016) [-901.730] (-905.810) (-903.434) -- 0:00:26
655000 -- (-902.603) (-904.710) (-905.826) [-902.622] * (-903.540) (-905.340) [-904.071] (-903.424) -- 0:00:26
Average standard deviation of split frequencies: 0.009072
655500 -- [-903.771] (-903.698) (-905.073) (-903.124) * (-904.793) (-905.285) [-903.097] (-905.155) -- 0:00:26
656000 -- [-904.684] (-905.907) (-903.334) (-908.047) * [-904.531] (-904.558) (-904.442) (-901.755) -- 0:00:26
656500 -- (-904.220) (-905.095) [-905.521] (-907.258) * (-904.132) (-905.389) [-902.057] (-902.120) -- 0:00:26
657000 -- [-905.140] (-906.558) (-904.008) (-903.594) * (-904.400) (-904.564) [-905.950] (-901.823) -- 0:00:26
657500 -- (-901.945) (-905.506) [-902.273] (-902.211) * (-905.340) [-903.998] (-902.619) (-903.258) -- 0:00:27
658000 -- [-902.693] (-903.447) (-905.959) (-903.855) * (-907.957) (-906.067) (-903.503) [-901.881] -- 0:00:27
658500 -- [-903.380] (-905.607) (-906.036) (-904.139) * (-902.981) [-906.003] (-906.818) (-902.515) -- 0:00:26
659000 -- (-903.898) (-906.079) [-902.690] (-904.828) * (-901.150) (-903.716) [-903.358] (-907.386) -- 0:00:26
659500 -- [-903.467] (-904.660) (-902.770) (-905.719) * (-902.419) [-903.350] (-902.923) (-903.211) -- 0:00:26
660000 -- (-902.674) (-904.263) [-902.334] (-904.089) * (-914.602) (-902.744) [-903.589] (-904.904) -- 0:00:26
Average standard deviation of split frequencies: 0.009633
660500 -- [-902.224] (-902.963) (-902.929) (-907.545) * [-903.951] (-901.893) (-902.261) (-905.408) -- 0:00:26
661000 -- [-906.744] (-905.668) (-902.121) (-904.339) * [-903.239] (-904.752) (-902.390) (-902.767) -- 0:00:26
661500 -- (-905.030) [-903.522] (-901.406) (-904.564) * [-905.213] (-902.841) (-903.148) (-903.837) -- 0:00:26
662000 -- (-901.308) (-904.673) (-903.021) [-904.202] * (-906.538) (-901.231) [-901.722] (-902.208) -- 0:00:26
662500 -- [-901.807] (-904.844) (-901.863) (-903.195) * [-903.395] (-901.998) (-905.168) (-904.311) -- 0:00:26
663000 -- (-903.927) (-902.631) [-901.244] (-902.097) * (-901.926) [-901.811] (-901.347) (-902.760) -- 0:00:26
663500 -- (-901.433) (-903.900) (-903.275) [-906.367] * (-902.955) (-903.353) [-904.006] (-904.237) -- 0:00:26
664000 -- (-904.031) (-906.566) [-902.541] (-906.811) * [-904.640] (-902.800) (-903.230) (-902.709) -- 0:00:26
664500 -- [-901.519] (-902.992) (-902.993) (-905.225) * (-902.476) (-904.227) [-904.585] (-901.966) -- 0:00:26
665000 -- (-902.177) (-902.635) (-902.907) [-905.299] * (-905.771) (-902.950) [-901.741] (-904.605) -- 0:00:26
Average standard deviation of split frequencies: 0.009290
665500 -- [-901.782] (-903.158) (-902.772) (-906.488) * (-904.863) [-903.091] (-902.239) (-904.189) -- 0:00:26
666000 -- (-902.616) (-902.948) (-903.162) [-902.662] * (-903.390) (-902.580) (-909.448) [-906.115] -- 0:00:26
666500 -- (-901.821) (-903.770) [-902.486] (-901.895) * (-905.829) (-903.697) [-901.663] (-904.789) -- 0:00:26
667000 -- (-902.952) (-907.245) (-902.326) [-905.761] * (-907.283) (-903.171) [-904.138] (-903.022) -- 0:00:25
667500 -- (-903.160) (-903.388) (-901.211) [-905.070] * (-905.945) (-908.995) (-902.236) [-903.979] -- 0:00:25
668000 -- [-901.724] (-902.127) (-904.247) (-904.414) * (-904.476) [-903.731] (-902.519) (-909.508) -- 0:00:25
668500 -- (-902.874) (-902.943) [-904.144] (-903.464) * [-903.936] (-905.155) (-904.294) (-902.676) -- 0:00:25
669000 -- (-902.431) (-901.537) (-903.861) [-905.292] * (-904.646) (-902.387) (-906.507) [-902.348] -- 0:00:25
669500 -- (-903.879) [-903.315] (-902.897) (-903.553) * (-901.527) (-901.774) [-904.556] (-904.562) -- 0:00:25
670000 -- (-904.263) [-902.821] (-902.059) (-905.120) * [-905.665] (-906.128) (-902.343) (-904.500) -- 0:00:25
Average standard deviation of split frequencies: 0.009181
670500 -- (-903.694) (-909.108) [-904.859] (-904.535) * (-904.036) (-902.842) [-901.417] (-902.564) -- 0:00:26
671000 -- (-901.747) [-901.763] (-903.318) (-903.778) * (-909.721) [-902.938] (-902.707) (-901.950) -- 0:00:25
671500 -- [-901.710] (-901.122) (-904.020) (-901.843) * (-902.066) (-903.785) [-903.140] (-902.848) -- 0:00:25
672000 -- (-904.482) (-902.324) [-902.245] (-902.975) * (-902.079) (-904.174) [-902.236] (-902.443) -- 0:00:25
672500 -- (-903.992) (-903.026) [-902.244] (-903.975) * (-901.688) (-907.413) [-902.052] (-902.946) -- 0:00:25
673000 -- (-903.431) (-904.835) (-903.456) [-906.709] * [-902.615] (-904.582) (-903.557) (-903.108) -- 0:00:25
673500 -- (-903.345) (-904.789) (-902.812) [-904.054] * (-901.401) [-904.408] (-902.153) (-903.416) -- 0:00:25
674000 -- [-903.713] (-903.627) (-904.364) (-904.212) * (-902.328) [-902.425] (-902.295) (-904.733) -- 0:00:25
674500 -- (-903.687) (-904.850) [-910.470] (-904.006) * [-905.759] (-902.523) (-902.227) (-901.635) -- 0:00:25
675000 -- (-904.465) (-905.107) [-909.916] (-901.736) * (-903.666) [-903.963] (-903.193) (-902.954) -- 0:00:25
Average standard deviation of split frequencies: 0.009312
675500 -- (-905.187) [-902.916] (-904.864) (-902.830) * (-904.469) (-903.183) [-904.130] (-908.805) -- 0:00:25
676000 -- (-902.642) [-902.550] (-901.739) (-902.985) * (-904.898) (-901.955) [-902.147] (-910.164) -- 0:00:25
676500 -- (-903.966) [-902.854] (-902.396) (-904.542) * [-904.445] (-904.227) (-905.120) (-906.819) -- 0:00:25
677000 -- (-903.154) (-904.809) [-908.650] (-905.784) * [-904.585] (-904.815) (-902.302) (-907.082) -- 0:00:25
677500 -- (-902.273) [-901.968] (-907.118) (-906.033) * (-910.555) (-905.818) (-902.035) [-903.558] -- 0:00:25
678000 -- [-901.908] (-903.185) (-903.963) (-906.232) * (-903.404) (-906.536) [-906.103] (-902.858) -- 0:00:25
678500 -- [-903.153] (-902.740) (-902.885) (-903.718) * (-901.519) (-905.894) (-902.194) [-902.411] -- 0:00:25
679000 -- [-902.573] (-901.310) (-907.502) (-901.801) * [-902.552] (-906.239) (-902.470) (-903.419) -- 0:00:25
679500 -- (-902.877) (-901.554) [-903.526] (-904.176) * (-903.430) [-906.057] (-905.347) (-906.519) -- 0:00:24
680000 -- [-906.625] (-902.546) (-902.022) (-906.271) * (-902.551) [-902.147] (-908.673) (-903.496) -- 0:00:24
Average standard deviation of split frequencies: 0.009370
680500 -- (-905.239) (-902.984) [-901.937] (-906.333) * [-907.327] (-903.280) (-902.325) (-903.139) -- 0:00:24
681000 -- (-910.576) [-901.987] (-901.788) (-903.277) * (-905.518) [-902.974] (-902.539) (-903.435) -- 0:00:24
681500 -- (-908.481) (-903.086) [-901.770] (-905.276) * [-903.804] (-902.036) (-901.976) (-906.001) -- 0:00:24
682000 -- (-901.393) [-902.750] (-904.256) (-907.368) * (-905.599) [-903.767] (-903.572) (-903.840) -- 0:00:24
682500 -- (-902.954) (-901.791) [-903.135] (-902.213) * [-903.533] (-905.093) (-905.072) (-902.899) -- 0:00:24
683000 -- (-902.714) [-901.624] (-906.370) (-901.597) * [-902.099] (-904.162) (-903.000) (-903.436) -- 0:00:24
683500 -- (-902.693) (-904.548) (-902.943) [-905.674] * (-903.601) (-903.423) (-901.824) [-902.995] -- 0:00:25
684000 -- [-903.001] (-902.997) (-904.364) (-901.695) * [-901.513] (-901.720) (-909.487) (-903.164) -- 0:00:24
684500 -- (-903.602) (-904.614) [-903.604] (-903.071) * (-908.424) (-902.410) [-902.573] (-902.556) -- 0:00:24
685000 -- (-905.557) [-906.380] (-905.371) (-905.244) * (-903.980) (-905.892) (-902.961) [-902.065] -- 0:00:24
Average standard deviation of split frequencies: 0.009055
685500 -- (-902.861) [-903.064] (-901.630) (-903.725) * (-904.523) [-902.216] (-905.949) (-902.430) -- 0:00:24
686000 -- [-902.542] (-902.693) (-902.597) (-903.235) * (-904.638) (-901.934) [-906.518] (-907.461) -- 0:00:24
686500 -- (-902.039) (-901.756) [-906.819] (-903.784) * (-903.864) [-906.844] (-902.857) (-907.933) -- 0:00:24
687000 -- (-901.731) [-904.410] (-907.635) (-903.883) * (-909.532) (-909.410) [-901.562] (-903.953) -- 0:00:24
687500 -- (-901.472) (-903.747) (-905.761) [-905.797] * (-902.560) (-902.413) (-904.293) [-904.804] -- 0:00:24
688000 -- (-902.209) (-904.200) (-901.817) [-903.176] * [-902.242] (-904.179) (-903.686) (-904.486) -- 0:00:24
688500 -- [-901.069] (-904.013) (-903.198) (-902.093) * (-902.239) [-904.111] (-903.766) (-904.566) -- 0:00:24
689000 -- (-901.737) (-902.795) (-900.965) [-903.047] * [-902.192] (-903.485) (-903.729) (-904.208) -- 0:00:24
689500 -- (-902.721) (-902.272) (-902.638) [-903.716] * [-902.297] (-910.691) (-904.283) (-902.749) -- 0:00:24
690000 -- (-901.817) (-902.829) (-903.711) [-904.510] * (-902.898) (-903.126) [-903.717] (-904.631) -- 0:00:24
Average standard deviation of split frequencies: 0.008231
690500 -- [-904.945] (-905.297) (-905.220) (-907.052) * (-905.077) (-902.392) [-903.087] (-909.005) -- 0:00:24
691000 -- (-902.869) [-903.885] (-902.901) (-905.594) * (-906.211) (-904.028) [-903.142] (-908.207) -- 0:00:24
691500 -- [-905.305] (-903.829) (-902.707) (-902.965) * (-903.280) [-904.343] (-902.299) (-904.800) -- 0:00:24
692000 -- [-902.709] (-903.413) (-904.831) (-902.894) * (-902.982) [-905.659] (-901.487) (-903.571) -- 0:00:24
692500 -- [-902.109] (-903.319) (-908.112) (-905.330) * (-903.424) (-901.548) (-906.398) [-905.955] -- 0:00:23
693000 -- (-904.922) (-902.391) (-903.825) [-908.222] * (-902.868) [-903.643] (-906.043) (-906.602) -- 0:00:23
693500 -- (-903.623) (-903.481) (-904.312) [-905.310] * (-903.400) (-902.694) (-903.854) [-904.657] -- 0:00:23
694000 -- [-901.278] (-904.635) (-904.379) (-904.660) * [-902.299] (-901.614) (-905.082) (-902.114) -- 0:00:23
694500 -- (-902.129) [-903.430] (-907.676) (-906.609) * (-902.780) (-902.729) [-901.712] (-904.316) -- 0:00:23
695000 -- (-902.123) (-903.372) (-904.255) [-901.395] * (-901.660) [-902.235] (-902.788) (-901.822) -- 0:00:23
Average standard deviation of split frequencies: 0.008287
695500 -- (-903.424) (-904.514) [-905.182] (-903.652) * [-903.263] (-902.786) (-902.934) (-902.253) -- 0:00:23
696000 -- (-904.254) (-901.547) (-902.899) [-903.372] * (-903.624) (-903.025) [-903.634] (-901.779) -- 0:00:23
696500 -- [-901.362] (-902.904) (-901.753) (-904.000) * (-910.806) [-901.362] (-901.763) (-902.258) -- 0:00:23
697000 -- (-904.377) (-902.176) [-901.577] (-902.651) * (-902.124) (-906.278) (-901.927) [-902.748] -- 0:00:23
697500 -- (-902.711) (-901.198) [-901.803] (-904.725) * [-901.177] (-909.692) (-905.627) (-903.407) -- 0:00:23
698000 -- [-902.108] (-902.999) (-903.918) (-903.373) * (-903.504) [-906.833] (-905.247) (-902.525) -- 0:00:23
698500 -- [-909.587] (-903.636) (-907.116) (-905.175) * (-901.458) (-906.698) [-904.325] (-903.556) -- 0:00:23
699000 -- (-904.018) [-903.426] (-903.980) (-906.639) * [-902.223] (-905.871) (-902.152) (-906.021) -- 0:00:23
699500 -- (-901.863) [-903.485] (-904.762) (-906.386) * (-905.662) [-902.377] (-907.153) (-903.455) -- 0:00:23
700000 -- (-904.621) (-901.866) (-906.616) [-904.335] * [-903.754] (-902.157) (-903.779) (-904.496) -- 0:00:23
Average standard deviation of split frequencies: 0.007695
700500 -- (-904.443) (-901.969) (-902.397) [-903.856] * (-901.728) (-902.471) [-905.643] (-902.229) -- 0:00:23
701000 -- [-901.458] (-901.781) (-902.750) (-906.577) * [-905.231] (-903.889) (-905.909) (-903.605) -- 0:00:23
701500 -- (-901.979) [-902.108] (-901.078) (-903.784) * (-903.613) (-902.158) [-903.507] (-901.952) -- 0:00:23
702000 -- (-905.981) (-902.151) [-902.466] (-901.830) * (-901.203) (-903.120) [-903.660] (-907.243) -- 0:00:23
702500 -- (-903.772) (-905.868) [-904.028] (-902.130) * (-903.206) [-903.257] (-903.055) (-906.309) -- 0:00:23
703000 -- (-905.307) [-903.361] (-903.397) (-904.060) * (-903.057) [-904.133] (-903.134) (-905.987) -- 0:00:23
703500 -- (-905.264) [-903.206] (-903.190) (-911.520) * (-903.255) [-904.163] (-902.670) (-901.941) -- 0:00:23
704000 -- [-903.169] (-904.089) (-905.503) (-903.498) * (-902.728) [-902.526] (-902.980) (-903.404) -- 0:00:23
704500 -- (-903.985) [-903.533] (-905.289) (-902.586) * (-902.098) (-904.004) (-902.066) [-903.457] -- 0:00:23
705000 -- (-902.751) (-902.704) [-905.217] (-902.961) * (-902.859) [-905.336] (-902.954) (-904.189) -- 0:00:23
Average standard deviation of split frequencies: 0.007637
705500 -- (-903.116) (-902.374) [-903.507] (-903.690) * (-902.261) [-903.348] (-905.071) (-906.800) -- 0:00:22
706000 -- [-902.847] (-903.174) (-905.948) (-902.155) * [-903.112] (-904.842) (-903.836) (-903.326) -- 0:00:22
706500 -- (-904.374) (-903.444) [-903.251] (-905.164) * (-902.330) (-905.335) (-907.100) [-904.303] -- 0:00:22
707000 -- (-901.765) [-903.856] (-903.983) (-902.774) * (-902.370) [-905.856] (-905.246) (-904.647) -- 0:00:22
707500 -- (-902.363) [-902.143] (-903.063) (-906.462) * [-901.183] (-904.960) (-901.954) (-903.459) -- 0:00:22
708000 -- (-902.323) (-901.961) [-901.925] (-903.194) * (-901.859) (-903.987) [-901.974] (-902.777) -- 0:00:22
708500 -- (-904.828) (-902.277) (-902.951) [-904.190] * (-901.969) (-904.950) (-902.478) [-902.057] -- 0:00:22
709000 -- (-906.902) (-902.441) (-906.660) [-906.094] * (-907.211) (-903.834) (-905.671) [-903.403] -- 0:00:22
709500 -- (-903.751) [-902.114] (-903.154) (-905.378) * [-902.305] (-904.457) (-904.395) (-903.117) -- 0:00:22
710000 -- [-903.835] (-901.984) (-906.328) (-902.955) * (-901.571) [-903.471] (-905.010) (-901.424) -- 0:00:22
Average standard deviation of split frequencies: 0.008194
710500 -- (-902.138) (-903.300) [-904.531] (-904.838) * (-901.610) (-903.782) (-902.882) [-902.366] -- 0:00:22
711000 -- [-904.861] (-902.933) (-901.698) (-906.371) * (-903.062) (-904.709) (-904.229) [-901.625] -- 0:00:22
711500 -- (-904.633) [-903.968] (-901.336) (-904.247) * [-902.603] (-904.370) (-903.684) (-901.502) -- 0:00:22
712000 -- (-903.194) [-904.459] (-903.649) (-903.759) * (-902.908) (-903.318) [-903.546] (-902.279) -- 0:00:22
712500 -- [-902.569] (-906.977) (-902.060) (-903.966) * (-901.552) [-902.075] (-903.634) (-903.108) -- 0:00:22
713000 -- (-903.791) (-902.909) [-902.084] (-901.997) * (-902.117) [-904.538] (-902.999) (-904.960) -- 0:00:22
713500 -- (-902.433) [-903.029] (-903.650) (-904.823) * (-903.658) (-902.774) (-902.486) [-904.617] -- 0:00:22
714000 -- (-901.829) (-904.239) (-902.326) [-903.224] * (-903.778) (-902.724) (-901.155) [-903.893] -- 0:00:22
714500 -- (-902.491) [-901.829] (-909.366) (-908.113) * [-902.682] (-901.757) (-901.213) (-905.247) -- 0:00:22
715000 -- [-901.670] (-903.913) (-906.520) (-912.473) * (-907.444) (-903.100) (-902.025) [-901.310] -- 0:00:22
Average standard deviation of split frequencies: 0.008271
715500 -- (-902.387) (-903.781) [-903.920] (-908.233) * [-903.035] (-903.739) (-901.856) (-901.919) -- 0:00:22
716000 -- (-903.208) [-904.353] (-902.613) (-902.382) * (-904.323) (-905.253) (-901.737) [-902.550] -- 0:00:22
716500 -- (-904.022) (-902.944) [-905.050] (-902.254) * (-905.789) (-903.509) [-901.866] (-902.114) -- 0:00:22
717000 -- (-907.390) (-903.082) (-905.705) [-904.506] * [-902.433] (-902.739) (-902.021) (-907.629) -- 0:00:22
717500 -- (-901.752) (-904.613) (-903.185) [-903.998] * (-904.691) (-902.670) (-903.399) [-901.862] -- 0:00:22
718000 -- (-901.427) (-904.069) [-904.895] (-904.078) * (-903.513) (-901.380) [-902.623] (-903.532) -- 0:00:21
718500 -- (-907.121) (-903.402) (-904.040) [-906.627] * (-906.100) (-902.672) (-902.025) [-902.554] -- 0:00:21
719000 -- [-902.271] (-901.178) (-901.874) (-903.840) * (-902.817) (-906.222) [-902.245] (-902.511) -- 0:00:21
719500 -- (-905.167) (-901.351) (-901.896) [-903.417] * (-902.042) (-902.841) [-905.807] (-903.665) -- 0:00:21
720000 -- (-903.527) (-902.406) (-907.568) [-903.703] * (-904.766) [-902.652] (-903.306) (-903.109) -- 0:00:21
Average standard deviation of split frequencies: 0.008422
720500 -- (-903.005) (-901.886) [-909.062] (-906.462) * (-903.558) (-902.950) [-902.558] (-907.184) -- 0:00:21
721000 -- [-903.271] (-902.200) (-903.084) (-906.035) * [-903.492] (-903.336) (-905.212) (-905.340) -- 0:00:21
721500 -- [-901.282] (-901.772) (-903.847) (-904.594) * (-902.599) [-902.452] (-902.566) (-903.352) -- 0:00:21
722000 -- (-902.579) (-902.277) [-902.602] (-903.423) * (-905.033) [-903.051] (-904.689) (-903.543) -- 0:00:21
722500 -- [-902.674] (-907.488) (-903.317) (-905.017) * (-904.553) (-902.434) [-902.803] (-906.106) -- 0:00:21
723000 -- (-902.668) [-903.133] (-903.759) (-904.429) * (-902.275) (-901.622) [-901.279] (-902.551) -- 0:00:21
723500 -- (-903.286) [-901.362] (-906.566) (-904.120) * (-903.485) (-901.379) (-901.287) [-902.438] -- 0:00:21
724000 -- (-902.008) [-901.139] (-901.362) (-902.914) * (-904.612) [-902.543] (-904.169) (-902.109) -- 0:00:21
724500 -- (-902.799) [-907.444] (-903.391) (-902.965) * [-902.994] (-901.293) (-905.145) (-901.323) -- 0:00:21
725000 -- (-906.558) (-901.900) [-902.848] (-903.187) * [-903.124] (-901.832) (-902.278) (-903.691) -- 0:00:21
Average standard deviation of split frequencies: 0.008212
725500 -- [-903.748] (-901.717) (-906.213) (-904.479) * (-902.793) (-904.761) (-903.608) [-902.536] -- 0:00:21
726000 -- [-902.053] (-901.697) (-906.143) (-902.729) * (-904.335) (-901.775) (-905.264) [-904.231] -- 0:00:21
726500 -- (-902.310) (-901.662) (-903.569) [-903.648] * [-901.845] (-902.000) (-905.390) (-901.910) -- 0:00:21
727000 -- (-901.874) [-901.434] (-902.798) (-904.300) * (-903.643) (-903.426) (-902.466) [-903.352] -- 0:00:21
727500 -- (-901.512) (-901.469) [-904.717] (-904.308) * [-904.324] (-901.288) (-906.567) (-903.201) -- 0:00:21
728000 -- [-902.748] (-901.455) (-905.230) (-907.939) * [-904.336] (-904.734) (-907.445) (-901.550) -- 0:00:21
728500 -- (-902.457) (-909.450) (-909.373) [-903.806] * (-905.020) [-901.231] (-905.944) (-902.297) -- 0:00:21
729000 -- [-903.047] (-909.223) (-901.486) (-903.800) * (-902.923) [-902.628] (-902.723) (-903.736) -- 0:00:21
729500 -- (-904.971) (-900.989) (-903.280) [-902.116] * (-901.328) (-902.739) [-904.307] (-902.446) -- 0:00:21
730000 -- (-905.085) (-906.241) (-906.720) [-902.628] * (-903.382) (-903.187) (-907.039) [-905.487] -- 0:00:21
Average standard deviation of split frequencies: 0.007823
730500 -- [-904.222] (-906.851) (-902.260) (-907.696) * (-909.434) [-902.734] (-903.262) (-904.420) -- 0:00:21
731000 -- (-903.680) (-905.246) [-902.454] (-903.992) * (-905.715) (-901.776) (-904.392) [-904.731] -- 0:00:20
731500 -- (-903.896) (-901.595) [-902.830] (-905.452) * (-906.789) (-902.509) [-901.602] (-902.400) -- 0:00:20
732000 -- (-904.917) (-901.442) (-901.676) [-903.163] * [-904.757] (-901.211) (-903.525) (-903.074) -- 0:00:20
732500 -- (-911.098) (-901.957) [-904.416] (-902.669) * (-902.837) [-903.214] (-904.113) (-903.943) -- 0:00:20
733000 -- (-907.873) (-904.490) [-903.685] (-905.845) * [-902.102] (-903.090) (-902.440) (-901.748) -- 0:00:20
733500 -- (-906.305) [-901.546] (-902.196) (-901.147) * (-901.466) (-903.475) (-902.886) [-902.904] -- 0:00:20
734000 -- (-908.115) [-901.174] (-902.826) (-904.161) * (-902.619) (-906.486) (-903.044) [-902.105] -- 0:00:20
734500 -- (-905.530) [-903.228] (-902.464) (-902.208) * (-905.213) (-901.440) (-903.089) [-902.573] -- 0:00:20
735000 -- (-904.437) (-901.637) (-901.476) [-901.068] * (-902.450) (-902.335) (-901.601) [-901.392] -- 0:00:20
Average standard deviation of split frequencies: 0.007987
735500 -- (-905.182) [-904.261] (-903.964) (-902.245) * [-904.378] (-904.587) (-904.063) (-902.125) -- 0:00:20
736000 -- (-905.119) (-905.011) (-903.562) [-902.820] * (-902.599) (-901.868) (-903.572) [-901.791] -- 0:00:20
736500 -- (-906.792) (-902.820) (-904.315) [-902.734] * (-902.353) (-901.325) (-901.632) [-903.358] -- 0:00:20
737000 -- (-907.487) (-902.699) (-902.169) [-901.451] * [-902.397] (-901.080) (-902.010) (-902.063) -- 0:00:20
737500 -- (-906.487) (-903.133) [-902.855] (-901.427) * (-906.651) (-901.254) [-904.252] (-903.083) -- 0:00:20
738000 -- (-904.649) [-902.236] (-907.154) (-901.553) * (-906.896) (-903.037) [-901.607] (-905.551) -- 0:00:20
738500 -- (-907.304) (-903.696) [-901.484] (-902.667) * (-906.726) (-905.841) [-902.636] (-904.413) -- 0:00:20
739000 -- [-904.616] (-907.088) (-904.262) (-905.618) * (-905.971) (-903.864) (-902.786) [-904.417] -- 0:00:20
739500 -- (-905.967) (-902.711) [-902.272] (-906.674) * (-903.438) (-910.462) (-906.672) [-903.591] -- 0:00:20
740000 -- (-901.686) [-902.685] (-904.612) (-901.386) * (-903.843) (-903.957) (-905.290) [-901.256] -- 0:00:20
Average standard deviation of split frequencies: 0.008155
740500 -- (-903.649) [-903.144] (-901.479) (-901.452) * (-903.751) [-905.487] (-908.531) (-904.684) -- 0:00:20
741000 -- (-904.414) (-903.156) (-903.482) [-901.070] * (-905.205) [-903.514] (-905.121) (-902.250) -- 0:00:20
741500 -- (-902.877) (-902.967) (-906.911) [-901.608] * (-905.165) [-903.160] (-906.515) (-903.853) -- 0:00:20
742000 -- (-902.187) (-902.097) [-904.520] (-905.789) * [-904.913] (-904.004) (-903.097) (-901.605) -- 0:00:20
742500 -- (-903.460) (-901.253) [-903.392] (-906.713) * (-903.087) (-901.722) (-906.896) [-902.681] -- 0:00:20
743000 -- [-903.506] (-903.986) (-905.331) (-902.239) * [-902.329] (-903.619) (-903.816) (-901.988) -- 0:00:20
743500 -- (-902.140) (-904.470) [-903.435] (-903.179) * (-901.360) [-903.145] (-906.047) (-904.074) -- 0:00:20
744000 -- (-904.018) (-905.952) [-902.472] (-904.583) * [-901.440] (-902.938) (-905.961) (-904.558) -- 0:00:19
744500 -- [-906.025] (-903.149) (-901.663) (-902.714) * (-902.520) (-903.416) [-904.264] (-903.746) -- 0:00:19
745000 -- (-903.262) (-905.803) [-903.929] (-901.887) * [-905.490] (-902.611) (-901.876) (-903.977) -- 0:00:19
Average standard deviation of split frequencies: 0.008017
745500 -- (-903.448) (-903.028) [-902.025] (-903.163) * (-904.001) (-903.416) (-912.404) [-903.525] -- 0:00:19
746000 -- (-903.549) (-901.579) [-902.806] (-902.903) * (-905.773) (-904.240) [-902.663] (-902.073) -- 0:00:19
746500 -- (-903.151) (-901.579) (-902.363) [-903.724] * (-902.910) (-903.545) (-905.522) [-906.967] -- 0:00:19
747000 -- (-904.251) [-903.065] (-905.492) (-903.196) * (-907.717) (-905.035) (-902.825) [-904.615] -- 0:00:19
747500 -- (-904.408) [-903.209] (-902.522) (-903.832) * [-904.270] (-905.267) (-902.903) (-904.195) -- 0:00:19
748000 -- [-906.250] (-907.353) (-902.416) (-904.404) * (-902.431) (-902.714) (-902.171) [-902.030] -- 0:00:19
748500 -- (-903.503) (-903.603) [-902.935] (-903.988) * [-903.302] (-903.098) (-901.629) (-906.003) -- 0:00:19
749000 -- [-903.963] (-904.553) (-902.062) (-904.747) * (-910.196) [-903.632] (-902.559) (-905.789) -- 0:00:19
749500 -- (-906.144) [-902.282] (-901.374) (-903.516) * (-905.927) (-906.063) [-902.821] (-903.319) -- 0:00:19
750000 -- (-904.177) (-902.347) [-902.937] (-906.213) * [-910.826] (-904.350) (-903.148) (-902.438) -- 0:00:19
Average standard deviation of split frequencies: 0.008282
750500 -- (-902.627) (-903.855) [-902.445] (-902.508) * (-901.940) (-907.618) (-904.494) [-902.653] -- 0:00:19
751000 -- (-907.390) [-901.779] (-901.993) (-902.507) * (-902.590) (-907.499) [-902.187] (-905.004) -- 0:00:19
751500 -- (-903.161) (-902.313) [-902.736] (-902.385) * (-902.228) (-904.371) [-901.663] (-907.538) -- 0:00:19
752000 -- (-902.621) (-903.368) [-905.843] (-902.436) * [-902.814] (-902.133) (-902.261) (-902.338) -- 0:00:19
752500 -- (-902.742) (-902.905) (-902.989) [-902.568] * (-903.294) [-901.247] (-905.155) (-906.466) -- 0:00:19
753000 -- (-904.626) (-902.852) (-902.952) [-902.944] * (-903.251) [-903.560] (-902.673) (-902.443) -- 0:00:19
753500 -- (-905.202) (-902.678) (-903.877) [-903.219] * (-902.088) [-903.370] (-903.486) (-902.023) -- 0:00:19
754000 -- (-902.870) [-905.544] (-901.500) (-903.277) * (-907.231) (-905.102) [-903.209] (-901.712) -- 0:00:19
754500 -- (-903.944) (-906.342) (-902.487) [-902.384] * (-902.432) (-903.632) (-901.352) [-903.742] -- 0:00:19
755000 -- (-903.903) [-902.775] (-903.819) (-903.828) * (-901.621) (-904.095) [-903.436] (-903.144) -- 0:00:19
Average standard deviation of split frequencies: 0.008184
755500 -- (-901.504) (-902.453) [-905.076] (-905.663) * [-903.194] (-908.124) (-904.778) (-903.873) -- 0:00:19
756000 -- (-906.052) (-904.198) [-904.240] (-903.456) * (-903.974) (-904.251) (-904.981) [-903.357] -- 0:00:19
756500 -- (-905.033) (-905.109) [-905.246] (-903.738) * (-903.269) (-905.494) (-903.421) [-905.121] -- 0:00:18
757000 -- (-904.681) (-902.631) (-902.545) [-905.858] * (-905.258) (-903.053) [-901.714] (-905.821) -- 0:00:18
757500 -- (-906.725) (-902.924) [-901.268] (-904.306) * (-904.402) (-903.322) [-902.437] (-907.422) -- 0:00:18
758000 -- (-902.369) [-904.956] (-903.463) (-902.371) * (-906.554) (-902.342) [-902.173] (-905.094) -- 0:00:18
758500 -- (-904.462) (-904.028) [-903.308] (-902.432) * (-908.876) (-903.533) (-902.158) [-903.550] -- 0:00:18
759000 -- (-906.055) [-903.647] (-901.156) (-901.460) * (-901.898) [-902.303] (-903.121) (-904.523) -- 0:00:18
759500 -- [-907.264] (-902.327) (-904.607) (-903.270) * (-901.525) (-901.893) [-901.831] (-902.067) -- 0:00:18
760000 -- (-902.311) (-901.529) [-904.008] (-903.349) * (-905.738) (-903.713) (-902.138) [-901.621] -- 0:00:18
Average standard deviation of split frequencies: 0.008095
760500 -- (-902.943) (-902.424) (-902.646) [-904.357] * (-902.907) (-902.106) [-903.329] (-903.231) -- 0:00:18
761000 -- (-901.370) [-902.991] (-902.217) (-901.451) * [-902.986] (-903.726) (-905.143) (-903.648) -- 0:00:18
761500 -- (-901.517) (-903.397) (-902.588) [-901.663] * (-902.592) (-903.698) [-901.951] (-904.883) -- 0:00:18
762000 -- (-904.961) [-903.232] (-901.961) (-905.080) * (-905.809) [-902.681] (-902.683) (-902.926) -- 0:00:18
762500 -- (-902.719) (-903.434) [-902.347] (-903.405) * (-904.620) [-905.105] (-907.163) (-908.560) -- 0:00:18
763000 -- [-903.175] (-903.403) (-902.872) (-904.562) * (-903.231) (-902.736) (-903.276) [-902.889] -- 0:00:18
763500 -- (-901.964) (-902.892) [-901.973] (-902.424) * [-903.384] (-907.323) (-904.162) (-902.485) -- 0:00:18
764000 -- (-903.660) [-901.230] (-904.075) (-903.669) * (-902.975) (-904.171) (-906.642) [-903.410] -- 0:00:18
764500 -- [-906.454] (-901.184) (-904.605) (-902.523) * (-902.029) (-904.652) [-904.946] (-908.401) -- 0:00:18
765000 -- (-901.145) (-902.433) [-905.662] (-902.969) * (-901.174) (-902.823) [-904.619] (-904.867) -- 0:00:18
Average standard deviation of split frequencies: 0.008652
765500 -- (-901.335) (-904.623) (-902.123) [-904.887] * [-901.232] (-904.643) (-902.558) (-905.315) -- 0:00:18
766000 -- [-901.972] (-906.282) (-903.689) (-903.868) * [-904.531] (-902.648) (-902.832) (-904.086) -- 0:00:18
766500 -- [-902.906] (-905.591) (-905.829) (-902.481) * (-903.260) (-902.272) (-907.694) [-904.622] -- 0:00:18
767000 -- [-903.805] (-904.585) (-901.463) (-902.626) * (-904.965) (-903.340) (-902.792) [-906.456] -- 0:00:18
767500 -- (-904.750) (-907.552) [-902.180] (-902.678) * (-903.761) [-904.773] (-907.224) (-901.910) -- 0:00:18
768000 -- [-902.582] (-907.672) (-905.790) (-901.446) * (-904.443) (-903.719) [-904.506] (-903.283) -- 0:00:18
768500 -- (-903.179) (-902.460) (-903.108) [-903.436] * (-904.236) (-904.336) (-906.305) [-905.807] -- 0:00:18
769000 -- (-904.375) [-902.915] (-902.159) (-904.433) * [-904.873] (-901.338) (-903.591) (-908.144) -- 0:00:18
769500 -- (-905.673) [-902.041] (-904.116) (-905.508) * (-903.112) (-901.907) (-904.989) [-905.359] -- 0:00:17
770000 -- (-903.334) (-902.362) [-902.256] (-903.873) * (-904.392) [-903.462] (-901.283) (-906.819) -- 0:00:17
Average standard deviation of split frequencies: 0.008384
770500 -- (-907.716) (-904.645) (-902.807) [-902.524] * (-905.534) (-905.833) [-902.729] (-909.220) -- 0:00:17
771000 -- (-903.298) (-902.289) [-901.995] (-903.086) * [-902.054] (-904.935) (-902.094) (-902.704) -- 0:00:17
771500 -- (-905.001) (-902.762) (-906.313) [-906.000] * (-902.818) (-904.134) [-903.057] (-905.433) -- 0:00:17
772000 -- [-904.200] (-905.701) (-902.458) (-901.998) * (-901.682) [-905.614] (-903.332) (-904.708) -- 0:00:17
772500 -- (-905.714) (-902.914) [-902.289] (-907.336) * [-902.648] (-906.147) (-903.025) (-901.551) -- 0:00:17
773000 -- [-903.575] (-909.607) (-907.376) (-905.490) * (-908.081) (-904.424) [-903.259] (-902.681) -- 0:00:17
773500 -- [-903.429] (-902.657) (-904.880) (-903.416) * (-904.897) (-908.472) [-905.579] (-905.285) -- 0:00:17
774000 -- (-902.834) (-903.570) (-903.409) [-902.959] * (-901.875) (-903.050) [-904.176] (-903.910) -- 0:00:17
774500 -- (-903.467) [-904.457] (-901.430) (-903.837) * [-903.543] (-904.746) (-901.535) (-901.840) -- 0:00:17
775000 -- (-906.484) (-901.960) (-902.283) [-905.957] * (-904.019) [-901.554] (-901.527) (-903.401) -- 0:00:17
Average standard deviation of split frequencies: 0.008398
775500 -- (-907.122) (-903.146) [-902.703] (-902.339) * (-902.940) [-905.910] (-902.176) (-902.130) -- 0:00:17
776000 -- (-902.869) (-906.439) [-904.903] (-902.744) * (-903.886) [-902.168] (-903.571) (-901.473) -- 0:00:17
776500 -- (-905.298) (-903.328) [-902.706] (-902.537) * (-902.519) (-901.211) [-901.769] (-901.340) -- 0:00:17
777000 -- (-906.385) [-903.769] (-902.684) (-902.553) * (-904.237) [-902.776] (-904.624) (-902.638) -- 0:00:17
777500 -- [-903.271] (-906.086) (-902.759) (-903.747) * [-904.462] (-903.348) (-902.855) (-901.765) -- 0:00:17
778000 -- (-902.559) [-902.637] (-902.456) (-903.801) * (-904.086) [-903.219] (-906.443) (-904.925) -- 0:00:17
778500 -- (-902.722) (-903.475) (-902.715) [-902.749] * (-903.955) (-905.691) (-907.067) [-904.640] -- 0:00:17
779000 -- [-904.125] (-907.056) (-901.959) (-902.037) * (-901.631) (-907.100) [-905.650] (-907.406) -- 0:00:17
779500 -- (-904.995) [-905.536] (-903.002) (-904.498) * (-902.330) (-906.224) (-904.225) [-903.590] -- 0:00:17
780000 -- (-902.203) [-905.092] (-902.567) (-904.828) * (-901.706) (-903.452) (-905.909) [-906.968] -- 0:00:17
Average standard deviation of split frequencies: 0.008907
780500 -- [-901.390] (-902.088) (-903.875) (-903.257) * (-902.711) (-907.151) (-906.759) [-904.521] -- 0:00:17
781000 -- (-903.104) [-905.756] (-902.798) (-902.512) * (-905.177) [-905.323] (-905.632) (-902.105) -- 0:00:17
781500 -- (-905.113) [-903.913] (-901.879) (-905.013) * (-902.770) [-903.342] (-901.496) (-902.192) -- 0:00:17
782000 -- [-903.747] (-905.046) (-907.012) (-903.916) * (-906.984) (-903.821) (-903.158) [-901.760] -- 0:00:17
782500 -- (-902.003) (-905.085) [-902.917] (-904.607) * (-902.169) (-904.464) (-906.687) [-904.086] -- 0:00:16
783000 -- (-904.500) (-902.336) [-904.423] (-902.055) * (-902.872) (-904.872) [-903.693] (-904.220) -- 0:00:16
783500 -- (-902.104) (-907.678) [-903.491] (-904.875) * (-902.585) (-903.778) [-903.787] (-904.693) -- 0:00:16
784000 -- [-907.816] (-904.647) (-905.636) (-902.425) * (-907.075) (-905.747) (-904.149) [-902.456] -- 0:00:16
784500 -- (-904.548) (-906.598) [-902.587] (-903.964) * (-901.957) [-901.914] (-903.183) (-905.954) -- 0:00:16
785000 -- (-904.025) (-904.816) [-903.487] (-902.360) * (-904.927) (-901.440) (-904.036) [-905.383] -- 0:00:16
Average standard deviation of split frequencies: 0.009279
785500 -- (-904.460) [-902.483] (-901.474) (-903.729) * [-901.671] (-905.532) (-905.376) (-904.184) -- 0:00:16
786000 -- [-903.540] (-908.758) (-902.711) (-902.540) * (-901.802) [-904.092] (-905.850) (-907.775) -- 0:00:16
786500 -- (-902.610) (-907.404) [-902.828] (-903.172) * (-903.424) [-901.731] (-910.531) (-902.979) -- 0:00:16
787000 -- (-902.383) (-906.527) [-902.003] (-903.958) * (-904.446) [-901.828] (-907.423) (-906.147) -- 0:00:16
787500 -- (-903.640) (-906.856) (-904.574) [-901.359] * [-902.600] (-905.484) (-903.519) (-903.674) -- 0:00:16
788000 -- [-904.398] (-904.636) (-904.492) (-901.736) * (-902.988) (-903.853) [-903.691] (-901.909) -- 0:00:16
788500 -- (-902.551) [-902.959] (-905.542) (-908.975) * (-903.713) (-904.854) (-902.363) [-901.834] -- 0:00:16
789000 -- (-904.675) (-904.483) [-905.900] (-904.791) * (-903.716) [-905.881] (-903.642) (-903.500) -- 0:00:16
789500 -- [-905.017] (-902.739) (-902.450) (-901.730) * [-902.397] (-903.904) (-904.765) (-903.136) -- 0:00:16
790000 -- (-905.184) (-906.315) (-904.774) [-902.697] * (-901.922) [-901.424] (-904.767) (-907.456) -- 0:00:16
Average standard deviation of split frequencies: 0.009390
790500 -- (-904.725) (-903.437) [-907.984] (-902.674) * (-904.095) [-902.102] (-902.751) (-902.020) -- 0:00:16
791000 -- (-904.591) (-906.179) [-904.749] (-904.381) * (-903.634) (-902.078) (-903.936) [-902.649] -- 0:00:16
791500 -- (-905.025) (-903.737) [-903.056] (-902.726) * [-903.347] (-903.403) (-903.855) (-908.452) -- 0:00:16
792000 -- (-903.801) [-904.230] (-906.610) (-903.260) * [-904.481] (-904.265) (-903.889) (-901.944) -- 0:00:16
792500 -- (-905.300) [-903.893] (-905.128) (-902.221) * (-901.464) (-907.205) [-903.882] (-902.156) -- 0:00:16
793000 -- (-906.200) (-905.716) [-904.896] (-902.919) * (-902.609) (-902.180) (-904.499) [-903.683] -- 0:00:16
793500 -- (-903.491) (-904.399) (-905.480) [-902.587] * [-901.888] (-903.369) (-908.992) (-902.908) -- 0:00:16
794000 -- (-904.316) (-903.175) (-906.262) [-904.389] * [-903.562] (-903.470) (-901.791) (-906.556) -- 0:00:16
794500 -- [-902.164] (-901.540) (-902.840) (-904.692) * (-901.700) [-902.410] (-902.501) (-902.574) -- 0:00:16
795000 -- [-902.164] (-902.367) (-902.943) (-907.333) * (-902.857) [-903.416] (-902.598) (-904.712) -- 0:00:15
Average standard deviation of split frequencies: 0.008957
795500 -- (-904.156) [-903.646] (-903.516) (-904.718) * (-901.981) (-902.619) [-901.723] (-903.180) -- 0:00:15
796000 -- (-905.587) (-905.516) [-903.443] (-904.656) * [-905.189] (-901.785) (-903.310) (-904.721) -- 0:00:15
796500 -- [-902.507] (-905.138) (-905.360) (-902.521) * (-904.187) (-904.537) (-902.580) [-902.537] -- 0:00:15
797000 -- (-903.521) [-901.893] (-902.604) (-902.188) * (-904.697) (-902.250) (-903.917) [-902.497] -- 0:00:15
797500 -- [-906.731] (-903.448) (-903.123) (-902.448) * (-905.106) (-906.379) (-905.448) [-903.483] -- 0:00:15
798000 -- (-902.914) (-902.376) (-902.896) [-901.344] * (-902.971) (-905.276) (-902.244) [-904.158] -- 0:00:15
798500 -- (-901.815) [-905.278] (-901.846) (-904.619) * (-906.718) [-905.502] (-909.157) (-905.319) -- 0:00:15
799000 -- (-903.521) (-903.561) [-904.258] (-909.418) * [-903.548] (-902.565) (-901.762) (-906.344) -- 0:00:15
799500 -- (-901.830) [-902.457] (-904.394) (-907.718) * (-905.120) [-904.980] (-903.184) (-902.982) -- 0:00:15
800000 -- (-903.327) [-904.013] (-904.699) (-908.345) * (-903.517) (-902.097) (-902.542) [-902.501] -- 0:00:15
Average standard deviation of split frequencies: 0.009052
800500 -- (-906.666) (-903.844) [-901.942] (-908.209) * (-903.326) (-905.233) (-904.532) [-902.187] -- 0:00:15
801000 -- (-905.292) [-901.203] (-902.901) (-903.152) * [-903.042] (-902.463) (-903.004) (-903.010) -- 0:00:15
801500 -- (-904.567) (-903.037) [-901.664] (-902.958) * (-904.825) (-902.377) [-902.236] (-901.693) -- 0:00:15
802000 -- [-901.180] (-904.609) (-904.195) (-908.092) * (-904.769) [-902.531] (-903.272) (-905.893) -- 0:00:15
802500 -- [-902.671] (-906.685) (-904.770) (-903.645) * (-905.371) (-906.848) (-905.629) [-901.449] -- 0:00:15
803000 -- [-902.301] (-904.251) (-902.292) (-902.973) * [-902.877] (-907.945) (-903.762) (-902.392) -- 0:00:15
803500 -- [-901.591] (-902.493) (-906.346) (-905.926) * (-903.876) [-902.790] (-903.142) (-904.373) -- 0:00:15
804000 -- (-903.228) (-906.654) [-903.253] (-901.876) * (-902.030) (-903.100) (-903.414) [-904.337] -- 0:00:15
804500 -- (-903.213) (-905.650) [-902.421] (-905.981) * (-901.760) (-902.606) [-903.434] (-903.594) -- 0:00:15
805000 -- (-903.017) (-903.978) (-901.464) [-902.569] * [-904.152] (-902.569) (-909.032) (-901.579) -- 0:00:15
Average standard deviation of split frequencies: 0.008883
805500 -- (-902.991) (-906.308) [-901.584] (-904.398) * (-903.539) (-902.218) (-906.110) [-903.126] -- 0:00:15
806000 -- (-902.323) (-903.910) [-902.462] (-903.909) * (-902.003) (-903.012) [-902.150] (-902.221) -- 0:00:15
806500 -- (-901.724) [-903.311] (-905.073) (-902.643) * (-905.007) (-901.367) [-903.912] (-903.527) -- 0:00:15
807000 -- (-903.841) [-902.926] (-905.552) (-907.030) * [-903.514] (-904.265) (-902.467) (-903.265) -- 0:00:15
807500 -- (-903.998) (-904.866) [-903.279] (-906.495) * [-902.864] (-902.436) (-902.892) (-902.224) -- 0:00:15
808000 -- [-903.568] (-903.282) (-901.534) (-909.445) * (-903.720) (-904.892) (-906.424) [-902.017] -- 0:00:14
808500 -- (-903.370) [-903.156] (-902.262) (-907.242) * [-902.900] (-902.925) (-907.121) (-902.979) -- 0:00:14
809000 -- [-902.567] (-902.966) (-902.061) (-903.569) * (-901.639) (-902.896) [-904.533] (-903.091) -- 0:00:14
809500 -- (-902.017) (-903.330) (-902.011) [-902.598] * (-903.807) (-903.119) [-901.200] (-910.213) -- 0:00:14
810000 -- [-903.531] (-904.776) (-903.201) (-908.935) * (-904.467) [-903.695] (-901.319) (-905.484) -- 0:00:14
Average standard deviation of split frequencies: 0.009304
810500 -- [-902.576] (-901.766) (-902.506) (-903.868) * (-903.164) (-902.662) [-905.160] (-902.385) -- 0:00:14
811000 -- (-905.420) (-901.843) (-902.610) [-903.509] * (-903.698) (-906.326) (-903.331) [-901.906] -- 0:00:14
811500 -- (-903.548) [-903.089] (-901.641) (-904.385) * [-902.262] (-902.378) (-904.467) (-907.462) -- 0:00:14
812000 -- (-905.761) [-901.356] (-901.599) (-907.242) * (-901.409) (-902.449) (-909.345) [-904.120] -- 0:00:14
812500 -- (-902.765) [-901.716] (-902.671) (-902.264) * [-902.270] (-904.891) (-903.956) (-905.100) -- 0:00:14
813000 -- [-902.910] (-905.061) (-902.974) (-902.946) * (-903.586) (-901.934) (-904.575) [-903.773] -- 0:00:14
813500 -- (-902.739) [-901.934] (-902.904) (-904.233) * (-902.510) (-903.061) (-903.209) [-902.198] -- 0:00:14
814000 -- [-902.827] (-903.804) (-903.827) (-908.133) * (-903.444) (-905.441) (-906.089) [-905.322] -- 0:00:14
814500 -- (-904.478) (-904.435) [-904.252] (-902.658) * (-902.035) (-905.722) (-901.830) [-901.970] -- 0:00:14
815000 -- (-903.286) (-903.009) (-902.188) [-902.785] * (-909.432) (-904.563) (-907.917) [-901.615] -- 0:00:14
Average standard deviation of split frequencies: 0.008846
815500 -- (-901.517) (-902.654) (-903.502) [-902.729] * (-904.931) (-902.940) [-906.870] (-901.991) -- 0:00:14
816000 -- [-902.586] (-903.671) (-902.498) (-902.362) * (-905.715) (-902.767) [-907.345] (-905.486) -- 0:00:14
816500 -- (-904.063) [-902.700] (-908.001) (-908.278) * (-904.859) [-901.700] (-905.572) (-903.528) -- 0:00:14
817000 -- [-906.869] (-902.513) (-907.465) (-905.000) * (-904.825) [-901.268] (-904.912) (-905.016) -- 0:00:14
817500 -- (-906.744) (-901.827) (-904.676) [-902.064] * (-904.581) [-901.474] (-903.907) (-902.381) -- 0:00:14
818000 -- (-902.244) (-902.927) (-904.709) [-901.767] * (-902.837) [-903.881] (-903.517) (-902.381) -- 0:00:14
818500 -- (-902.262) (-902.600) (-902.571) [-902.074] * (-901.815) (-903.030) (-904.280) [-902.965] -- 0:00:14
819000 -- [-901.800] (-901.629) (-902.770) (-905.294) * (-904.002) (-904.355) (-906.300) [-902.511] -- 0:00:14
819500 -- (-904.125) (-904.616) [-902.810] (-902.281) * (-904.403) (-906.749) [-906.558] (-903.582) -- 0:00:14
820000 -- (-905.218) (-901.941) [-903.646] (-901.810) * (-907.516) (-906.741) [-904.262] (-902.780) -- 0:00:14
Average standard deviation of split frequencies: 0.008437
820500 -- [-905.075] (-902.452) (-902.481) (-901.376) * (-907.604) (-904.424) (-904.445) [-903.786] -- 0:00:14
821000 -- (-906.325) (-902.427) [-903.066] (-902.315) * (-902.007) (-902.597) [-904.397] (-902.616) -- 0:00:13
821500 -- (-908.363) [-902.223] (-901.592) (-909.322) * (-901.842) (-902.527) (-905.135) [-903.688] -- 0:00:13
822000 -- (-905.674) (-904.445) [-902.966] (-904.318) * [-903.846] (-902.014) (-901.924) (-901.525) -- 0:00:13
822500 -- (-904.562) (-902.955) (-906.131) [-903.406] * (-904.113) [-903.064] (-905.318) (-901.282) -- 0:00:13
823000 -- (-903.676) [-903.186] (-904.734) (-907.089) * (-905.263) (-902.147) (-905.915) [-901.715] -- 0:00:13
823500 -- [-903.112] (-903.545) (-904.337) (-903.621) * (-904.751) [-902.318] (-903.005) (-902.707) -- 0:00:13
824000 -- (-903.391) (-903.628) (-905.406) [-904.345] * [-905.270] (-906.764) (-902.923) (-905.469) -- 0:00:13
824500 -- (-902.144) [-901.350] (-907.997) (-903.243) * [-901.586] (-904.199) (-905.497) (-902.430) -- 0:00:13
825000 -- [-902.369] (-902.700) (-902.654) (-904.873) * [-901.911] (-904.969) (-904.838) (-902.581) -- 0:00:13
Average standard deviation of split frequencies: 0.007954
825500 -- (-902.333) (-905.464) (-902.485) [-901.604] * (-903.847) [-903.307] (-908.071) (-901.353) -- 0:00:13
826000 -- (-903.314) [-905.080] (-902.279) (-905.675) * (-905.307) (-903.107) (-904.655) [-905.380] -- 0:00:13
826500 -- (-908.530) (-907.613) (-902.531) [-901.820] * (-905.619) (-901.834) (-904.867) [-903.376] -- 0:00:13
827000 -- (-909.920) (-903.191) (-904.752) [-903.663] * (-904.337) (-902.579) (-902.871) [-902.357] -- 0:00:13
827500 -- (-902.357) [-904.602] (-904.858) (-902.817) * (-904.046) (-903.528) (-902.930) [-901.525] -- 0:00:13
828000 -- (-901.519) (-903.383) (-903.567) [-904.735] * (-907.047) [-903.636] (-902.474) (-901.376) -- 0:00:13
828500 -- (-902.897) (-905.030) [-904.480] (-904.049) * (-907.921) (-902.680) (-902.213) [-903.329] -- 0:00:13
829000 -- (-903.333) (-906.086) (-903.319) [-904.698] * (-906.263) (-906.797) [-902.322] (-902.472) -- 0:00:13
829500 -- (-906.416) [-904.824] (-901.790) (-905.496) * (-903.728) (-905.790) (-906.976) [-901.931] -- 0:00:13
830000 -- (-908.490) (-906.659) (-905.427) [-908.028] * (-905.150) (-901.745) [-903.093] (-902.786) -- 0:00:13
Average standard deviation of split frequencies: 0.007626
830500 -- [-905.170] (-903.740) (-901.877) (-904.845) * (-906.300) [-901.546] (-902.036) (-903.417) -- 0:00:13
831000 -- (-905.243) (-904.739) [-902.382] (-902.425) * (-901.061) (-905.418) (-901.746) [-904.096] -- 0:00:13
831500 -- (-906.050) (-906.388) (-907.324) [-901.425] * (-901.180) (-904.149) (-903.194) [-904.358] -- 0:00:13
832000 -- (-902.406) (-904.373) (-907.766) [-902.081] * (-901.276) [-905.188] (-902.997) (-906.929) -- 0:00:13
832500 -- [-906.065] (-903.164) (-905.791) (-902.641) * (-906.310) (-905.740) (-904.948) [-905.962] -- 0:00:13
833000 -- (-902.596) (-905.763) [-904.447] (-902.577) * (-903.488) (-905.122) (-903.360) [-902.958] -- 0:00:13
833500 -- (-908.191) (-906.166) [-903.763] (-902.364) * (-906.184) (-905.741) [-902.709] (-903.038) -- 0:00:12
834000 -- (-903.422) [-902.534] (-905.115) (-902.415) * [-902.359] (-904.578) (-910.339) (-903.041) -- 0:00:12
834500 -- (-903.154) (-906.661) [-904.670] (-903.763) * [-901.690] (-905.480) (-904.751) (-901.793) -- 0:00:12
835000 -- (-903.205) [-903.674] (-903.637) (-907.460) * (-901.648) (-902.526) (-904.158) [-902.391] -- 0:00:12
Average standard deviation of split frequencies: 0.007894
835500 -- [-902.443] (-904.247) (-903.084) (-905.071) * (-903.650) (-903.003) [-903.923] (-902.979) -- 0:00:12
836000 -- (-906.246) (-902.498) (-904.882) [-905.569] * (-904.333) [-903.011] (-904.488) (-908.019) -- 0:00:12
836500 -- (-906.615) (-907.865) (-907.270) [-901.716] * (-905.274) (-905.122) (-904.543) [-902.272] -- 0:00:12
837000 -- (-903.843) [-901.408] (-901.752) (-904.209) * (-903.790) (-905.954) [-904.537] (-904.944) -- 0:00:12
837500 -- (-901.468) (-903.000) (-901.752) [-902.550] * [-901.826] (-901.824) (-904.010) (-904.453) -- 0:00:12
838000 -- (-902.653) (-902.349) (-901.829) [-906.034] * [-903.224] (-904.017) (-902.830) (-903.244) -- 0:00:12
838500 -- (-903.976) [-904.004] (-902.501) (-902.301) * (-902.103) [-903.894] (-905.532) (-904.097) -- 0:00:12
839000 -- (-904.581) (-902.804) [-901.835] (-904.562) * [-905.395] (-903.241) (-903.087) (-901.471) -- 0:00:12
839500 -- (-902.273) (-901.591) (-902.825) [-904.928] * (-905.057) (-901.671) (-901.821) [-903.251] -- 0:00:12
840000 -- (-904.720) [-902.351] (-902.937) (-902.994) * [-901.971] (-904.670) (-901.763) (-904.035) -- 0:00:12
Average standard deviation of split frequencies: 0.008096
840500 -- [-902.591] (-902.513) (-902.494) (-906.722) * (-902.386) [-907.127] (-902.149) (-904.321) -- 0:00:12
841000 -- (-903.111) (-904.611) [-904.946] (-905.456) * (-901.916) (-902.246) [-902.664] (-903.659) -- 0:00:12
841500 -- (-903.643) (-901.793) [-901.553] (-906.701) * (-901.726) (-902.221) [-903.899] (-903.953) -- 0:00:12
842000 -- (-903.200) (-902.728) (-901.553) [-901.876] * [-901.884] (-901.666) (-902.231) (-904.378) -- 0:00:12
842500 -- (-903.640) [-901.432] (-902.628) (-902.269) * (-903.053) (-901.976) (-903.722) [-901.975] -- 0:00:12
843000 -- (-904.287) (-902.143) (-902.515) [-908.423] * [-903.804] (-901.812) (-904.230) (-903.844) -- 0:00:12
843500 -- (-903.906) (-902.233) [-903.316] (-902.679) * [-904.906] (-902.484) (-902.526) (-902.962) -- 0:00:12
844000 -- (-901.999) (-905.951) (-903.355) [-903.819] * (-902.548) (-907.279) [-902.181] (-902.540) -- 0:00:12
844500 -- (-909.188) [-903.468] (-905.140) (-903.474) * (-902.064) (-908.233) [-902.385] (-902.485) -- 0:00:12
845000 -- (-903.849) (-904.981) (-903.833) [-902.810] * (-901.826) [-904.415] (-902.640) (-901.898) -- 0:00:12
Average standard deviation of split frequencies: 0.008393
845500 -- [-902.246] (-901.333) (-903.029) (-904.951) * [-902.524] (-906.363) (-903.246) (-903.890) -- 0:00:12
846000 -- [-903.382] (-903.347) (-910.350) (-904.280) * [-904.316] (-903.106) (-902.997) (-903.146) -- 0:00:12
846500 -- [-903.015] (-906.162) (-907.854) (-905.518) * [-901.877] (-904.194) (-903.055) (-902.541) -- 0:00:11
847000 -- [-907.409] (-905.963) (-903.154) (-901.561) * (-902.111) [-905.080] (-903.431) (-903.739) -- 0:00:11
847500 -- (-904.686) (-903.018) [-902.739] (-903.141) * (-902.744) [-905.768] (-905.296) (-902.887) -- 0:00:11
848000 -- (-902.795) (-906.803) [-903.614] (-904.804) * (-906.481) (-903.212) [-904.612] (-903.390) -- 0:00:11
848500 -- [-901.937] (-902.482) (-904.385) (-905.566) * [-904.024] (-907.454) (-904.023) (-904.064) -- 0:00:11
849000 -- [-903.609] (-902.451) (-903.952) (-902.183) * (-903.314) [-902.174] (-903.763) (-903.507) -- 0:00:11
849500 -- (-906.200) (-903.398) [-904.073] (-902.561) * (-903.061) (-901.602) [-905.912] (-903.535) -- 0:00:11
850000 -- (-904.933) (-907.500) (-903.448) [-902.105] * [-905.895] (-902.030) (-904.324) (-904.528) -- 0:00:11
Average standard deviation of split frequencies: 0.008278
850500 -- [-902.376] (-902.575) (-902.274) (-903.107) * (-906.002) (-907.159) (-908.106) [-901.920] -- 0:00:11
851000 -- [-901.819] (-904.091) (-903.942) (-902.322) * (-901.642) (-905.497) [-902.266] (-907.146) -- 0:00:11
851500 -- (-905.309) (-903.361) (-904.533) [-902.952] * (-902.526) (-905.074) [-903.072] (-904.157) -- 0:00:11
852000 -- (-904.211) (-902.989) [-902.647] (-908.345) * (-903.404) [-903.855] (-902.285) (-903.515) -- 0:00:11
852500 -- (-908.434) (-902.640) [-903.198] (-902.782) * (-902.476) (-904.570) [-905.033] (-903.827) -- 0:00:11
853000 -- [-903.002] (-904.509) (-902.849) (-901.928) * (-901.945) (-906.817) (-903.696) [-904.086] -- 0:00:11
853500 -- (-904.049) [-902.537] (-903.082) (-902.823) * (-903.529) (-909.397) [-902.888] (-904.128) -- 0:00:11
854000 -- [-902.409] (-904.334) (-902.164) (-904.431) * (-902.734) (-908.994) (-902.337) [-902.028] -- 0:00:11
854500 -- [-903.127] (-903.505) (-902.442) (-904.751) * [-903.597] (-905.851) (-902.692) (-906.965) -- 0:00:11
855000 -- [-902.191] (-907.170) (-902.927) (-901.218) * (-905.000) (-901.851) (-902.748) [-902.365] -- 0:00:11
Average standard deviation of split frequencies: 0.008742
855500 -- (-901.386) (-902.519) (-904.952) [-901.939] * (-904.679) [-901.798] (-903.483) (-902.729) -- 0:00:11
856000 -- (-901.589) [-903.048] (-904.585) (-903.819) * (-904.449) (-902.345) [-902.699] (-905.479) -- 0:00:11
856500 -- [-902.293] (-903.245) (-903.097) (-905.414) * (-903.109) (-902.080) (-907.195) [-903.198] -- 0:00:11
857000 -- (-901.651) (-903.699) [-901.911] (-903.120) * (-903.878) (-901.638) (-903.882) [-903.461] -- 0:00:11
857500 -- (-902.679) (-905.877) (-902.957) [-902.051] * (-903.902) (-903.918) (-902.534) [-903.787] -- 0:00:11
858000 -- (-903.988) [-901.910] (-902.929) (-905.006) * (-904.848) (-903.168) (-901.570) [-903.232] -- 0:00:11
858500 -- (-903.415) (-903.833) [-905.129] (-903.555) * (-902.927) (-902.857) [-904.405] (-903.693) -- 0:00:11
859000 -- (-904.786) [-902.009] (-905.423) (-902.501) * [-903.528] (-905.141) (-906.238) (-902.174) -- 0:00:10
859500 -- (-903.541) (-901.517) (-902.634) [-904.848] * (-902.476) (-904.864) (-905.690) [-901.906] -- 0:00:10
860000 -- (-904.814) (-901.548) [-903.194] (-905.133) * [-903.135] (-902.537) (-904.889) (-901.906) -- 0:00:10
Average standard deviation of split frequencies: 0.008935
860500 -- [-904.061] (-905.379) (-907.114) (-902.589) * (-902.060) (-902.236) [-904.737] (-903.937) -- 0:00:10
861000 -- (-905.375) [-901.727] (-903.841) (-904.781) * [-903.318] (-903.811) (-901.530) (-902.667) -- 0:00:10
861500 -- (-904.380) (-903.968) (-905.286) [-901.517] * [-901.707] (-905.662) (-901.593) (-904.497) -- 0:00:10
862000 -- (-908.255) (-902.658) (-903.472) [-904.015] * (-906.179) (-904.879) [-901.788] (-902.384) -- 0:00:10
862500 -- (-905.012) (-901.560) [-908.549] (-903.383) * [-903.374] (-902.370) (-903.569) (-909.118) -- 0:00:10
863000 -- [-906.434] (-902.926) (-901.893) (-906.793) * (-902.258) (-901.820) (-903.614) [-903.032] -- 0:00:10
863500 -- (-906.192) [-902.643] (-902.864) (-904.356) * (-902.153) [-905.625] (-903.678) (-901.923) -- 0:00:10
864000 -- (-904.797) (-902.920) [-902.482] (-903.471) * (-901.206) (-903.932) (-903.634) [-904.645] -- 0:00:10
864500 -- (-904.223) [-903.396] (-902.876) (-906.137) * (-901.248) (-901.268) (-904.174) [-901.878] -- 0:00:10
865000 -- (-903.450) [-903.414] (-902.062) (-903.583) * (-903.778) (-904.193) [-904.312] (-902.320) -- 0:00:10
Average standard deviation of split frequencies: 0.009458
865500 -- (-903.358) (-904.888) [-901.928] (-902.632) * (-903.316) (-905.644) (-901.840) [-904.702] -- 0:00:10
866000 -- (-906.325) (-905.547) (-903.712) [-902.079] * (-901.442) (-905.815) (-902.999) [-904.942] -- 0:00:10
866500 -- (-906.176) (-902.957) (-904.148) [-904.694] * [-903.363] (-903.027) (-902.433) (-903.393) -- 0:00:10
867000 -- (-906.096) [-903.595] (-902.128) (-903.507) * (-904.554) (-902.655) [-902.247] (-903.246) -- 0:00:10
867500 -- [-904.103] (-903.018) (-903.951) (-902.570) * (-908.159) [-902.016] (-902.854) (-901.921) -- 0:00:10
868000 -- (-902.591) (-904.626) (-903.908) [-903.736] * (-904.175) (-902.261) [-903.332] (-902.793) -- 0:00:10
868500 -- (-902.266) [-902.905] (-902.870) (-902.855) * (-902.036) [-904.156] (-907.548) (-901.837) -- 0:00:10
869000 -- (-902.366) (-902.469) [-903.171] (-904.441) * (-902.710) (-907.810) [-903.463] (-904.452) -- 0:00:10
869500 -- (-901.043) (-901.644) (-903.189) [-904.646] * (-902.218) (-908.526) [-903.188] (-903.362) -- 0:00:10
870000 -- (-901.066) (-903.047) (-902.204) [-905.023] * (-902.505) [-906.330] (-903.785) (-905.675) -- 0:00:10
Average standard deviation of split frequencies: 0.009204
870500 -- (-901.344) (-903.252) (-902.901) [-905.898] * (-902.769) (-901.983) (-903.650) [-901.982] -- 0:00:10
871000 -- (-903.219) [-904.133] (-905.589) (-907.933) * (-903.728) (-904.908) (-904.501) [-903.065] -- 0:00:10
871500 -- (-902.026) [-901.697] (-902.884) (-904.580) * (-903.752) [-902.594] (-901.882) (-903.596) -- 0:00:10
872000 -- [-901.637] (-901.456) (-902.144) (-906.201) * (-904.454) (-902.096) [-902.016] (-902.396) -- 0:00:09
872500 -- (-901.574) [-902.249] (-902.407) (-905.478) * [-903.534] (-901.979) (-903.531) (-903.808) -- 0:00:09
873000 -- (-902.209) (-901.595) (-901.940) [-904.089] * (-908.097) (-909.345) [-902.791] (-902.290) -- 0:00:09
873500 -- [-904.448] (-905.739) (-903.492) (-901.610) * (-906.090) [-901.440] (-904.831) (-906.251) -- 0:00:09
874000 -- (-902.565) [-904.539] (-904.404) (-904.139) * (-902.687) [-903.766] (-902.170) (-902.649) -- 0:00:09
874500 -- (-907.675) (-904.978) [-904.409] (-906.854) * (-905.676) (-906.432) [-904.257] (-902.893) -- 0:00:09
875000 -- (-907.149) (-906.265) [-902.209] (-901.104) * (-902.219) (-904.636) [-902.053] (-903.088) -- 0:00:09
Average standard deviation of split frequencies: 0.009081
875500 -- (-903.183) [-901.559] (-907.619) (-901.491) * [-903.024] (-901.291) (-904.225) (-902.099) -- 0:00:09
876000 -- [-904.238] (-905.738) (-904.680) (-901.512) * [-903.057] (-904.805) (-901.852) (-907.045) -- 0:00:09
876500 -- (-901.982) (-905.012) (-905.118) [-902.180] * (-903.445) (-902.239) [-907.028] (-904.486) -- 0:00:09
877000 -- (-906.836) [-902.321] (-906.753) (-902.588) * (-902.519) (-904.778) (-910.561) [-906.469] -- 0:00:09
877500 -- [-902.955] (-905.544) (-904.336) (-906.095) * (-902.453) (-902.515) (-906.963) [-904.775] -- 0:00:09
878000 -- [-903.178] (-906.117) (-905.140) (-905.150) * (-903.764) (-905.429) (-903.622) [-903.662] -- 0:00:09
878500 -- (-906.140) (-901.609) (-902.336) [-904.023] * (-904.276) (-902.753) (-902.012) [-904.019] -- 0:00:09
879000 -- (-903.822) [-906.041] (-903.199) (-904.020) * (-902.854) [-903.382] (-902.377) (-903.726) -- 0:00:09
879500 -- (-903.184) [-901.842] (-903.776) (-901.750) * (-902.791) (-901.861) [-901.709] (-905.954) -- 0:00:09
880000 -- (-902.932) (-905.302) [-901.308] (-902.723) * (-902.822) [-901.885] (-901.703) (-902.106) -- 0:00:09
Average standard deviation of split frequencies: 0.009200
880500 -- (-902.548) (-903.597) [-902.740] (-902.189) * (-903.630) (-902.190) (-904.198) [-903.611] -- 0:00:09
881000 -- [-903.371] (-905.995) (-903.443) (-906.326) * (-901.600) [-901.414] (-904.710) (-902.041) -- 0:00:09
881500 -- [-904.612] (-904.435) (-902.952) (-907.454) * [-904.073] (-902.117) (-906.340) (-902.817) -- 0:00:09
882000 -- [-906.977] (-903.579) (-905.385) (-904.286) * (-903.234) (-902.126) (-910.949) [-902.896] -- 0:00:09
882500 -- [-907.307] (-902.516) (-902.527) (-902.581) * (-903.124) [-902.719] (-903.298) (-902.607) -- 0:00:09
883000 -- (-903.006) [-902.829] (-902.862) (-901.451) * (-901.777) (-902.188) [-902.980] (-903.609) -- 0:00:09
883500 -- (-903.227) (-903.263) [-902.649] (-903.161) * (-902.471) (-902.125) [-904.461] (-902.712) -- 0:00:09
884000 -- (-905.433) (-902.532) [-902.337] (-905.235) * (-908.716) [-901.352] (-905.648) (-903.915) -- 0:00:09
884500 -- (-906.168) [-902.436] (-903.355) (-904.401) * (-904.746) [-901.613] (-905.055) (-904.455) -- 0:00:09
885000 -- (-901.821) (-905.335) (-903.369) [-904.988] * [-902.342] (-903.436) (-905.506) (-903.832) -- 0:00:08
Average standard deviation of split frequencies: 0.009311
885500 -- (-901.766) (-904.851) (-906.471) [-904.690] * (-904.019) (-903.201) [-905.943] (-902.073) -- 0:00:08
886000 -- [-903.571] (-907.923) (-904.110) (-905.854) * [-902.337] (-902.846) (-903.407) (-903.328) -- 0:00:08
886500 -- (-904.424) (-903.200) (-906.104) [-903.778] * (-902.631) [-903.324] (-905.334) (-903.361) -- 0:00:08
887000 -- (-903.056) (-916.451) (-902.753) [-904.069] * (-903.059) (-902.018) [-901.469] (-903.311) -- 0:00:08
887500 -- (-906.641) [-907.912] (-905.493) (-905.296) * (-907.291) (-902.814) [-906.423] (-903.224) -- 0:00:08
888000 -- (-904.605) (-909.176) (-905.090) [-908.236] * (-903.398) (-903.133) (-904.287) [-904.411] -- 0:00:08
888500 -- (-903.337) (-907.999) (-904.615) [-904.993] * (-907.228) (-911.260) (-902.734) [-902.684] -- 0:00:08
889000 -- [-903.232] (-902.608) (-902.469) (-906.933) * (-903.965) (-902.554) [-902.240] (-905.755) -- 0:00:08
889500 -- (-902.694) (-905.646) [-905.171] (-904.986) * (-903.134) [-902.599] (-901.693) (-904.756) -- 0:00:08
890000 -- (-904.482) [-902.173] (-903.922) (-903.791) * (-903.925) [-905.990] (-901.703) (-907.002) -- 0:00:08
Average standard deviation of split frequencies: 0.009196
890500 -- (-903.386) (-903.181) (-902.408) [-908.001] * (-903.510) (-904.209) [-901.948] (-903.210) -- 0:00:08
891000 -- [-904.718] (-904.111) (-902.308) (-903.612) * [-901.899] (-904.520) (-902.546) (-906.422) -- 0:00:08
891500 -- (-904.872) (-902.886) (-904.058) [-905.444] * (-902.882) [-902.198] (-906.710) (-908.097) -- 0:00:08
892000 -- (-905.235) (-903.358) [-903.221] (-902.402) * (-905.600) (-901.861) (-904.201) [-902.343] -- 0:00:08
892500 -- (-901.858) (-905.164) (-905.196) [-901.795] * (-904.621) [-902.150] (-903.303) (-901.311) -- 0:00:08
893000 -- [-907.508] (-904.007) (-903.295) (-902.329) * (-902.174) (-901.742) (-903.549) [-905.164] -- 0:00:08
893500 -- (-902.613) [-902.637] (-903.174) (-904.163) * (-901.587) (-905.184) (-903.303) [-905.377] -- 0:00:08
894000 -- (-909.579) (-904.093) [-903.476] (-902.667) * [-902.300] (-904.398) (-905.851) (-904.952) -- 0:00:08
894500 -- (-904.459) (-905.789) (-905.447) [-906.348] * (-903.149) [-902.068] (-907.007) (-905.890) -- 0:00:08
895000 -- (-902.124) (-902.221) [-908.132] (-902.775) * [-902.892] (-902.318) (-904.685) (-905.783) -- 0:00:08
Average standard deviation of split frequencies: 0.009076
895500 -- (-901.972) [-906.595] (-902.392) (-902.568) * (-903.163) (-901.861) [-904.228] (-904.687) -- 0:00:08
896000 -- (-907.585) [-902.912] (-902.607) (-905.576) * (-905.932) (-903.731) [-902.833] (-905.946) -- 0:00:08
896500 -- [-902.989] (-904.032) (-903.751) (-905.635) * (-901.877) [-902.886] (-902.256) (-904.020) -- 0:00:08
897000 -- (-902.366) (-904.974) (-901.233) [-908.049] * (-914.731) (-902.807) (-903.395) [-902.505] -- 0:00:08
897500 -- (-904.479) (-908.289) (-903.705) [-904.272] * (-902.828) [-903.268] (-902.064) (-901.716) -- 0:00:07
898000 -- (-904.521) (-909.975) [-903.128] (-905.551) * (-903.473) (-907.236) [-905.151] (-901.458) -- 0:00:07
898500 -- [-902.109] (-907.605) (-902.795) (-902.159) * (-902.032) (-904.500) [-902.333] (-906.031) -- 0:00:07
899000 -- (-907.365) (-904.975) [-903.394] (-902.486) * [-904.693] (-902.199) (-903.165) (-904.028) -- 0:00:07
899500 -- [-902.836] (-905.189) (-903.695) (-903.010) * (-902.404) (-903.638) (-904.861) [-906.032] -- 0:00:07
900000 -- [-902.999] (-907.104) (-902.324) (-902.915) * [-903.980] (-901.548) (-901.098) (-904.091) -- 0:00:07
Average standard deviation of split frequencies: 0.009552
900500 -- (-902.288) (-902.490) [-901.704] (-904.101) * (-903.224) (-901.547) [-903.315] (-905.558) -- 0:00:07
901000 -- (-903.107) (-901.810) (-903.020) [-902.495] * [-902.400] (-901.921) (-906.599) (-902.670) -- 0:00:07
901500 -- (-901.193) (-902.190) [-904.055] (-905.359) * (-903.454) [-903.105] (-904.688) (-901.868) -- 0:00:07
902000 -- [-901.442] (-902.358) (-902.255) (-903.326) * (-903.891) (-901.608) [-902.005] (-901.918) -- 0:00:07
902500 -- (-902.125) (-902.689) (-902.893) [-904.187] * (-902.985) [-903.061] (-904.242) (-902.428) -- 0:00:07
903000 -- (-904.309) [-903.781] (-904.729) (-901.167) * (-901.557) (-907.090) [-905.930] (-904.921) -- 0:00:07
903500 -- (-903.182) (-903.052) [-902.733] (-902.852) * (-901.921) (-904.555) (-903.126) [-902.873] -- 0:00:07
904000 -- (-902.628) (-908.493) [-901.290] (-904.644) * (-902.499) (-904.511) [-904.223] (-906.196) -- 0:00:07
904500 -- (-904.885) [-903.284] (-904.659) (-905.416) * (-904.191) (-904.533) (-906.968) [-901.762] -- 0:00:07
905000 -- (-905.976) [-903.503] (-904.431) (-907.135) * [-904.535] (-901.834) (-906.822) (-904.339) -- 0:00:07
Average standard deviation of split frequencies: 0.010016
905500 -- (-902.143) [-901.783] (-907.297) (-905.971) * (-904.190) (-901.492) (-902.455) [-903.941] -- 0:00:07
906000 -- (-914.665) (-905.486) (-904.699) [-904.414] * [-902.518] (-901.529) (-903.836) (-904.431) -- 0:00:07
906500 -- (-904.974) (-904.400) [-903.704] (-903.436) * [-901.472] (-903.473) (-904.089) (-903.850) -- 0:00:07
907000 -- (-905.301) (-902.423) [-903.889] (-901.889) * (-911.453) (-906.524) (-902.208) [-905.547] -- 0:00:07
907500 -- (-904.259) (-904.823) (-905.928) [-903.541] * (-905.037) [-902.645] (-906.639) (-905.933) -- 0:00:07
908000 -- [-903.359] (-904.157) (-907.911) (-908.167) * [-902.731] (-906.061) (-905.048) (-902.623) -- 0:00:07
908500 -- (-902.934) [-902.095] (-904.147) (-903.644) * [-908.674] (-904.559) (-902.451) (-903.627) -- 0:00:07
909000 -- (-902.484) (-902.144) [-902.987] (-906.637) * (-904.168) (-903.035) [-902.361] (-902.219) -- 0:00:07
909500 -- [-902.501] (-903.428) (-906.486) (-907.760) * (-903.410) (-905.180) (-904.935) [-902.761] -- 0:00:07
910000 -- (-903.630) [-903.888] (-902.194) (-904.073) * (-905.733) (-903.723) (-903.743) [-901.279] -- 0:00:07
Average standard deviation of split frequencies: 0.009932
910500 -- [-903.174] (-902.978) (-902.138) (-902.856) * (-907.006) (-901.125) [-901.816] (-901.117) -- 0:00:06
911000 -- [-906.028] (-902.950) (-902.162) (-903.995) * (-903.195) (-905.009) [-905.735] (-901.705) -- 0:00:07
911500 -- (-907.320) [-902.454] (-903.214) (-905.381) * (-902.822) (-902.438) (-902.664) [-902.015] -- 0:00:06
912000 -- (-903.036) [-902.484] (-902.299) (-905.602) * (-902.127) (-902.727) (-904.476) [-902.889] -- 0:00:06
912500 -- (-904.782) (-908.082) (-905.465) [-903.325] * (-903.726) [-901.037] (-909.448) (-902.274) -- 0:00:06
913000 -- [-903.754] (-904.540) (-904.731) (-903.635) * (-904.026) (-901.228) (-904.637) [-903.937] -- 0:00:06
913500 -- (-909.220) [-902.250] (-901.990) (-908.741) * [-903.171] (-901.708) (-903.645) (-901.365) -- 0:00:06
914000 -- (-905.798) [-902.789] (-903.505) (-906.831) * (-909.116) [-904.253] (-908.587) (-902.318) -- 0:00:06
914500 -- [-903.653] (-903.708) (-902.904) (-901.676) * [-906.667] (-902.936) (-906.172) (-903.611) -- 0:00:06
915000 -- (-905.911) [-907.133] (-903.382) (-901.714) * (-901.537) (-903.528) (-902.914) [-901.709] -- 0:00:06
Average standard deviation of split frequencies: 0.010003
915500 -- (-910.975) (-902.773) (-902.994) [-903.205] * (-904.363) [-905.859] (-901.516) (-902.154) -- 0:00:06
916000 -- (-903.757) [-903.032] (-902.670) (-901.801) * (-904.619) (-903.115) (-902.630) [-909.394] -- 0:00:06
916500 -- (-904.227) (-905.764) (-903.740) [-902.007] * (-905.454) (-902.530) (-905.109) [-907.113] -- 0:00:06
917000 -- (-902.979) (-904.125) [-905.189] (-904.508) * [-905.905] (-902.978) (-904.292) (-905.242) -- 0:00:06
917500 -- (-906.677) (-903.469) (-907.910) [-904.344] * (-907.646) [-906.417] (-903.697) (-902.740) -- 0:00:06
918000 -- (-902.737) (-901.665) (-903.488) [-905.015] * [-912.694] (-905.007) (-903.233) (-903.912) -- 0:00:06
918500 -- (-903.326) (-902.188) (-903.136) [-902.995] * (-905.148) [-901.747] (-902.239) (-903.952) -- 0:00:06
919000 -- (-902.759) (-902.171) (-902.747) [-902.216] * (-904.742) (-901.918) (-902.689) [-902.378] -- 0:00:06
919500 -- (-902.307) (-902.571) [-903.552] (-904.200) * [-901.584] (-904.060) (-902.870) (-902.656) -- 0:00:06
920000 -- (-902.361) (-903.258) [-902.698] (-906.533) * [-903.052] (-904.447) (-903.171) (-903.396) -- 0:00:06
Average standard deviation of split frequencies: 0.010112
920500 -- (-907.262) (-903.408) (-905.543) [-905.395] * (-904.116) (-904.021) [-904.216] (-901.603) -- 0:00:06
921000 -- (-907.680) [-902.949] (-905.720) (-904.499) * [-902.394] (-903.234) (-903.237) (-904.636) -- 0:00:06
921500 -- [-903.623] (-904.025) (-904.356) (-904.157) * (-904.047) (-902.469) [-901.619] (-901.508) -- 0:00:06
922000 -- [-901.618] (-903.836) (-904.271) (-906.329) * (-903.278) (-901.960) [-901.316] (-903.261) -- 0:00:06
922500 -- [-903.372] (-903.049) (-904.253) (-908.046) * (-906.710) [-905.377] (-905.804) (-902.645) -- 0:00:06
923000 -- (-903.168) [-902.446] (-906.011) (-905.784) * (-906.918) (-912.691) (-901.983) [-901.716] -- 0:00:06
923500 -- [-902.677] (-903.148) (-903.344) (-906.502) * (-903.557) (-906.813) [-903.502] (-905.530) -- 0:00:06
924000 -- (-903.162) (-904.365) [-901.792] (-901.696) * [-903.605] (-905.869) (-906.565) (-903.487) -- 0:00:06
924500 -- (-904.200) [-903.101] (-901.595) (-905.972) * (-901.265) [-905.809] (-909.663) (-903.905) -- 0:00:05
925000 -- (-904.672) (-903.322) [-901.809] (-901.517) * (-910.994) [-903.432] (-906.873) (-906.627) -- 0:00:05
Average standard deviation of split frequencies: 0.009895
925500 -- (-903.484) (-903.482) [-902.640] (-904.676) * (-902.994) (-902.458) [-903.199] (-905.477) -- 0:00:05
926000 -- (-901.988) (-902.825) (-906.483) [-902.686] * (-902.356) [-905.201] (-903.322) (-904.092) -- 0:00:05
926500 -- (-902.301) (-904.449) [-903.679] (-904.875) * (-901.742) [-908.673] (-902.114) (-905.784) -- 0:00:05
927000 -- [-901.022] (-904.797) (-912.742) (-903.226) * [-905.677] (-908.249) (-903.132) (-904.839) -- 0:00:05
927500 -- (-904.692) (-902.759) (-905.140) [-903.158] * (-905.189) (-902.607) (-902.738) [-902.540] -- 0:00:05
928000 -- (-904.018) [-904.448] (-902.540) (-906.228) * (-903.835) (-902.426) [-905.062] (-908.621) -- 0:00:05
928500 -- (-904.195) (-901.533) [-902.976] (-903.848) * (-905.658) [-901.623] (-906.722) (-903.910) -- 0:00:05
929000 -- (-902.327) (-901.718) (-902.455) [-903.247] * (-907.503) (-904.573) [-903.442] (-903.522) -- 0:00:05
929500 -- (-902.211) [-903.554] (-901.869) (-903.060) * (-901.387) [-905.498] (-904.107) (-903.636) -- 0:00:05
930000 -- (-906.158) [-905.211] (-902.855) (-903.200) * (-906.307) (-905.763) (-906.334) [-903.567] -- 0:00:05
Average standard deviation of split frequencies: 0.009751
930500 -- (-903.742) (-903.696) (-903.120) [-905.499] * [-906.516] (-906.821) (-906.602) (-903.990) -- 0:00:05
931000 -- (-903.461) [-902.811] (-902.647) (-902.270) * [-903.381] (-904.311) (-903.409) (-903.363) -- 0:00:05
931500 -- [-901.643] (-901.577) (-901.637) (-903.703) * [-902.494] (-909.117) (-904.650) (-904.099) -- 0:00:05
932000 -- (-902.757) [-903.482] (-901.668) (-902.388) * (-907.612) [-904.985] (-901.675) (-904.028) -- 0:00:05
932500 -- (-909.213) (-902.716) (-907.514) [-902.929] * (-902.378) [-901.981] (-905.067) (-903.057) -- 0:00:05
933000 -- (-901.790) (-903.198) (-902.678) [-901.318] * [-902.552] (-903.251) (-907.267) (-905.002) -- 0:00:05
933500 -- (-904.200) (-903.654) [-906.073] (-903.874) * [-902.718] (-905.509) (-906.331) (-907.157) -- 0:00:05
934000 -- (-902.207) (-903.930) (-904.431) [-902.163] * (-905.823) (-902.890) [-904.667] (-903.926) -- 0:00:05
934500 -- [-900.937] (-903.899) (-904.460) (-902.357) * [-904.594] (-904.136) (-907.552) (-903.299) -- 0:00:05
935000 -- (-904.481) (-902.032) (-904.353) [-904.123] * (-906.939) (-903.796) [-901.989] (-902.416) -- 0:00:05
Average standard deviation of split frequencies: 0.010041
935500 -- [-904.765] (-901.978) (-903.144) (-901.428) * (-905.207) (-904.646) (-902.142) [-903.233] -- 0:00:05
936000 -- (-903.617) (-902.647) [-905.147] (-901.461) * (-903.755) (-903.792) (-904.969) [-902.043] -- 0:00:05
936500 -- (-904.525) (-903.279) [-904.573] (-906.249) * (-901.636) (-905.242) (-906.875) [-902.183] -- 0:00:05
937000 -- (-905.159) (-901.418) (-903.213) [-903.974] * (-901.474) (-904.397) (-904.415) [-903.254] -- 0:00:04
937500 -- (-907.420) [-901.357] (-905.318) (-903.651) * (-902.747) (-901.805) (-902.891) [-902.695] -- 0:00:04
938000 -- (-902.108) [-901.791] (-902.149) (-903.263) * (-901.782) (-903.810) (-907.333) [-902.140] -- 0:00:04
938500 -- (-903.850) (-903.621) (-902.434) [-905.090] * [-905.165] (-903.059) (-903.484) (-902.190) -- 0:00:04
939000 -- (-902.988) [-901.854] (-902.734) (-902.379) * [-901.515] (-904.707) (-902.749) (-901.205) -- 0:00:04
939500 -- (-903.916) [-902.241] (-903.715) (-901.927) * (-903.596) [-904.007] (-902.173) (-904.467) -- 0:00:04
940000 -- (-902.678) (-902.373) (-902.324) [-902.068] * (-905.589) [-902.715] (-904.068) (-903.047) -- 0:00:04
Average standard deviation of split frequencies: 0.009772
940500 -- (-904.404) (-901.990) [-902.337] (-902.651) * (-906.209) [-901.272] (-906.109) (-904.573) -- 0:00:04
941000 -- (-903.279) [-901.779] (-902.664) (-902.272) * (-901.636) (-905.049) [-903.728] (-901.924) -- 0:00:04
941500 -- (-903.181) [-902.314] (-903.265) (-901.454) * (-902.154) (-902.495) [-902.570] (-903.806) -- 0:00:04
942000 -- (-907.837) (-902.684) (-903.131) [-902.514] * (-902.412) (-902.260) (-903.279) [-902.443] -- 0:00:04
942500 -- [-901.613] (-903.301) (-904.465) (-905.389) * (-901.862) (-902.795) (-902.497) [-905.088] -- 0:00:04
943000 -- (-901.723) (-902.475) (-901.240) [-902.606] * [-902.607] (-902.063) (-901.705) (-904.758) -- 0:00:04
943500 -- (-901.592) (-901.746) [-901.667] (-906.089) * (-905.927) [-903.009] (-901.052) (-902.575) -- 0:00:04
944000 -- (-902.416) (-902.205) (-903.489) [-904.973] * (-904.432) [-903.245] (-908.086) (-902.344) -- 0:00:04
944500 -- (-902.051) [-904.119] (-901.778) (-905.809) * [-903.017] (-902.420) (-907.111) (-904.995) -- 0:00:04
945000 -- (-901.415) (-903.006) [-901.344] (-904.855) * (-901.733) (-904.800) (-902.956) [-902.611] -- 0:00:04
Average standard deviation of split frequencies: 0.009935
945500 -- (-901.874) [-902.628] (-903.809) (-903.408) * (-902.889) (-902.733) (-913.404) [-906.304] -- 0:00:04
946000 -- (-905.822) [-902.165] (-903.613) (-902.273) * (-904.268) [-904.403] (-904.735) (-902.238) -- 0:00:04
946500 -- (-906.030) (-902.722) [-903.510] (-902.404) * (-905.635) (-902.707) (-905.102) [-903.040] -- 0:00:04
947000 -- (-901.315) (-902.885) (-904.802) [-902.375] * [-905.171] (-901.977) (-903.891) (-903.031) -- 0:00:04
947500 -- (-902.787) [-901.856] (-902.531) (-901.489) * (-903.947) (-901.324) (-902.970) [-905.248] -- 0:00:04
948000 -- (-905.682) [-906.246] (-903.478) (-901.785) * (-902.162) (-902.807) (-902.212) [-902.008] -- 0:00:04
948500 -- [-904.892] (-908.740) (-904.554) (-901.858) * (-904.355) [-909.038] (-902.550) (-904.446) -- 0:00:04
949000 -- [-906.071] (-904.521) (-908.945) (-903.829) * (-906.755) [-906.216] (-903.084) (-905.043) -- 0:00:04
949500 -- (-908.677) (-902.418) (-906.634) [-902.628] * (-904.548) (-902.608) (-906.564) [-903.820] -- 0:00:03
950000 -- (-904.049) (-908.006) [-903.452] (-903.350) * (-908.480) [-903.095] (-906.776) (-904.352) -- 0:00:03
Average standard deviation of split frequencies: 0.009483
950500 -- (-902.461) [-902.247] (-902.533) (-903.829) * (-903.827) (-904.305) (-903.326) [-902.851] -- 0:00:03
951000 -- (-906.818) [-901.722] (-906.425) (-903.069) * (-901.741) (-902.293) [-905.659] (-903.275) -- 0:00:03
951500 -- (-903.107) [-903.808] (-904.440) (-903.807) * (-902.611) (-903.007) [-904.977] (-901.445) -- 0:00:03
952000 -- (-904.100) (-905.512) [-906.353] (-904.109) * (-904.902) [-902.454] (-902.285) (-904.550) -- 0:00:03
952500 -- (-902.726) (-902.969) (-910.298) [-901.588] * (-906.319) [-902.618] (-902.696) (-903.438) -- 0:00:03
953000 -- [-901.668] (-902.734) (-905.932) (-903.544) * (-901.620) (-902.377) (-909.941) [-903.278] -- 0:00:03
953500 -- (-907.157) (-903.118) [-901.752] (-904.611) * [-904.131] (-902.615) (-905.660) (-903.690) -- 0:00:03
954000 -- (-904.435) (-903.752) [-905.963] (-904.311) * [-903.513] (-903.917) (-902.240) (-903.140) -- 0:00:03
954500 -- (-904.948) [-903.717] (-902.842) (-907.184) * (-906.628) (-904.939) (-901.269) [-904.436] -- 0:00:03
955000 -- (-902.711) (-906.721) [-903.358] (-902.596) * [-902.613] (-902.558) (-902.370) (-903.220) -- 0:00:03
Average standard deviation of split frequencies: 0.009770
955500 -- (-902.798) (-903.579) [-901.720] (-905.990) * [-901.768] (-902.012) (-901.376) (-903.809) -- 0:00:03
956000 -- (-902.129) (-905.837) [-903.553] (-904.338) * (-903.005) (-904.446) [-902.502] (-903.846) -- 0:00:03
956500 -- [-902.330] (-908.771) (-902.186) (-904.483) * (-905.176) (-906.971) (-910.037) [-903.301] -- 0:00:03
957000 -- (-907.134) (-908.697) [-901.828] (-905.703) * (-903.410) [-904.190] (-903.702) (-905.773) -- 0:00:03
957500 -- (-904.809) [-901.838] (-906.306) (-906.402) * [-901.231] (-905.060) (-908.709) (-904.881) -- 0:00:03
958000 -- (-904.044) (-902.443) (-902.872) [-902.645] * [-901.229] (-902.091) (-904.196) (-902.962) -- 0:00:03
958500 -- (-902.144) (-903.086) (-902.359) [-903.724] * (-901.806) (-903.658) (-905.054) [-903.837] -- 0:00:03
959000 -- [-902.961] (-904.124) (-902.003) (-905.917) * (-901.790) (-903.428) [-906.994] (-903.666) -- 0:00:03
959500 -- [-901.950] (-905.932) (-904.524) (-903.274) * (-904.816) [-906.395] (-903.854) (-903.520) -- 0:00:03
960000 -- (-903.345) (-902.912) (-903.161) [-902.068] * [-902.072] (-904.811) (-902.721) (-903.370) -- 0:00:03
Average standard deviation of split frequencies: 0.009538
960500 -- [-902.163] (-903.425) (-907.299) (-903.561) * (-904.290) (-903.633) [-902.750] (-902.973) -- 0:00:03
961000 -- (-903.046) (-903.102) (-902.707) [-903.026] * (-904.103) [-901.569] (-902.196) (-902.347) -- 0:00:03
961500 -- (-904.279) (-903.715) (-905.042) [-903.513] * (-901.342) [-901.723] (-903.073) (-904.176) -- 0:00:03
962000 -- (-904.785) (-901.907) [-902.089] (-904.499) * (-902.734) (-901.978) (-908.362) [-903.668] -- 0:00:03
962500 -- (-914.954) (-903.181) (-902.333) [-902.797] * (-903.590) (-902.468) [-903.172] (-906.637) -- 0:00:02
963000 -- [-905.915] (-902.539) (-902.419) (-901.445) * (-903.910) (-904.205) (-902.204) [-907.974] -- 0:00:02
963500 -- [-905.700] (-901.657) (-904.929) (-902.950) * [-904.519] (-901.983) (-903.429) (-902.385) -- 0:00:02
964000 -- (-902.474) (-903.445) (-902.942) [-903.927] * (-903.854) [-903.369] (-902.147) (-901.432) -- 0:00:02
964500 -- [-902.447] (-901.929) (-903.086) (-902.437) * (-904.141) (-904.148) (-903.094) [-905.232] -- 0:00:02
965000 -- (-903.933) [-903.546] (-902.714) (-902.819) * (-903.392) (-902.862) [-905.047] (-902.338) -- 0:00:02
Average standard deviation of split frequencies: 0.009973
965500 -- (-903.897) (-904.951) [-903.076] (-902.842) * (-901.599) [-904.808] (-901.716) (-902.993) -- 0:00:02
966000 -- (-901.397) (-905.481) [-902.243] (-902.106) * (-903.287) [-903.590] (-904.191) (-903.677) -- 0:00:02
966500 -- [-903.484] (-907.724) (-901.882) (-908.866) * [-907.070] (-903.812) (-903.696) (-902.262) -- 0:00:02
967000 -- [-905.714] (-904.202) (-903.850) (-910.758) * [-903.672] (-904.072) (-906.214) (-902.229) -- 0:00:02
967500 -- (-903.764) [-904.951] (-902.458) (-902.116) * (-903.875) (-902.782) [-905.772] (-902.231) -- 0:00:02
968000 -- (-903.963) (-901.803) (-901.886) [-901.881] * [-902.190] (-902.517) (-904.224) (-904.794) -- 0:00:02
968500 -- (-906.600) [-902.733] (-904.232) (-903.673) * (-902.247) (-901.833) [-902.554] (-904.954) -- 0:00:02
969000 -- (-903.763) (-908.746) [-902.512] (-901.419) * (-906.368) [-907.207] (-902.300) (-901.662) -- 0:00:02
969500 -- (-905.226) (-903.319) [-901.907] (-904.178) * (-902.930) (-904.074) [-903.448] (-905.351) -- 0:00:02
970000 -- [-904.875] (-904.392) (-903.040) (-906.199) * (-902.299) (-904.185) (-903.622) [-903.316] -- 0:00:02
Average standard deviation of split frequencies: 0.010017
970500 -- (-903.348) (-903.441) (-907.483) [-901.715] * (-901.965) (-906.200) (-907.044) [-904.800] -- 0:00:02
971000 -- (-908.632) (-903.042) [-902.148] (-902.711) * (-901.621) [-901.832] (-904.803) (-904.668) -- 0:00:02
971500 -- (-902.225) (-903.560) [-902.553] (-904.042) * (-902.306) [-902.536] (-902.743) (-905.322) -- 0:00:02
972000 -- (-901.477) [-901.430] (-902.109) (-902.845) * (-902.330) (-902.686) [-901.679] (-904.903) -- 0:00:02
972500 -- (-901.607) (-901.684) (-902.316) [-902.930] * (-903.421) [-902.776] (-905.569) (-903.944) -- 0:00:02
973000 -- (-903.531) [-902.783] (-902.011) (-903.336) * (-902.650) (-904.680) [-905.633] (-909.057) -- 0:00:02
973500 -- (-902.915) [-902.281] (-901.452) (-904.801) * (-905.439) [-904.428] (-902.189) (-903.249) -- 0:00:02
974000 -- (-904.485) [-902.343] (-904.845) (-902.437) * (-904.015) [-903.108] (-905.323) (-903.618) -- 0:00:02
974500 -- (-906.617) (-902.061) [-903.810] (-901.949) * (-902.739) [-905.129] (-903.428) (-908.413) -- 0:00:02
975000 -- (-902.648) (-903.152) [-905.390] (-903.650) * [-903.818] (-903.960) (-907.540) (-906.900) -- 0:00:01
Average standard deviation of split frequencies: 0.009992
975500 -- [-903.830] (-904.151) (-902.586) (-903.583) * (-902.890) (-904.760) [-903.983] (-905.729) -- 0:00:01
976000 -- [-904.463] (-902.438) (-902.968) (-903.257) * (-907.503) [-906.821] (-904.253) (-901.909) -- 0:00:01
976500 -- [-902.491] (-902.217) (-903.422) (-906.509) * [-906.619] (-904.370) (-907.047) (-904.057) -- 0:00:01
977000 -- (-901.255) (-902.937) (-908.052) [-905.489] * [-902.994] (-902.953) (-905.171) (-906.458) -- 0:00:01
977500 -- [-902.757] (-905.102) (-907.781) (-905.036) * (-904.600) (-903.312) [-902.725] (-902.723) -- 0:00:01
978000 -- (-909.171) [-906.003] (-905.406) (-904.608) * (-904.046) (-903.235) [-901.996] (-903.925) -- 0:00:01
978500 -- (-902.255) (-909.172) [-903.462] (-902.451) * (-903.772) [-901.734] (-902.268) (-903.513) -- 0:00:01
979000 -- (-904.100) (-908.470) (-903.232) [-904.306] * [-903.150] (-902.172) (-903.133) (-902.713) -- 0:00:01
979500 -- (-902.802) (-902.610) (-902.255) [-901.602] * [-901.734] (-902.105) (-902.429) (-903.582) -- 0:00:01
980000 -- [-905.576] (-903.413) (-902.295) (-902.818) * (-903.989) [-903.174] (-903.089) (-905.140) -- 0:00:01
Average standard deviation of split frequencies: 0.009974
980500 -- (-907.338) (-903.340) [-905.258] (-902.369) * (-904.574) [-904.610] (-906.050) (-902.601) -- 0:00:01
981000 -- (-902.959) (-903.297) (-901.952) [-902.570] * [-904.390] (-903.799) (-906.725) (-902.835) -- 0:00:01
981500 -- (-904.394) (-909.519) (-905.316) [-901.616] * (-903.647) (-903.463) [-902.883] (-905.114) -- 0:00:01
982000 -- (-903.998) (-909.177) (-905.518) [-903.652] * (-902.505) (-902.020) (-905.188) [-903.508] -- 0:00:01
982500 -- [-905.451] (-902.959) (-902.031) (-903.796) * (-903.067) (-902.422) [-902.002] (-901.644) -- 0:00:01
983000 -- [-904.816] (-901.865) (-904.982) (-906.731) * (-902.854) (-903.108) [-902.477] (-901.912) -- 0:00:01
983500 -- [-901.589] (-902.034) (-903.847) (-902.993) * (-905.504) [-902.275] (-911.989) (-903.253) -- 0:00:01
984000 -- (-907.068) (-902.281) [-902.764] (-902.936) * (-910.933) (-902.923) (-904.564) [-903.543] -- 0:00:01
984500 -- [-902.562] (-907.203) (-901.719) (-904.032) * [-902.122] (-902.021) (-903.563) (-902.799) -- 0:00:01
985000 -- (-903.844) (-902.655) (-902.281) [-903.779] * (-901.650) (-901.728) [-902.178] (-904.045) -- 0:00:01
Average standard deviation of split frequencies: 0.010040
985500 -- [-903.433] (-904.788) (-902.256) (-901.971) * (-902.840) (-905.146) [-901.520] (-903.075) -- 0:00:01
986000 -- [-903.503] (-908.162) (-902.053) (-904.707) * (-901.774) (-905.346) [-903.529] (-903.950) -- 0:00:01
986500 -- (-902.787) (-902.500) [-903.538] (-902.290) * (-902.658) (-907.689) (-903.778) [-904.181] -- 0:00:01
987000 -- (-904.535) (-901.875) [-903.624] (-902.375) * (-902.456) (-902.076) [-902.442] (-902.860) -- 0:00:01
987500 -- (-905.420) (-901.815) [-902.848] (-905.742) * (-901.152) (-902.652) (-903.450) [-901.939] -- 0:00:00
988000 -- [-901.337] (-902.388) (-904.966) (-902.029) * (-902.543) (-902.454) (-903.338) [-904.135] -- 0:00:00
988500 -- [-902.428] (-908.575) (-902.234) (-903.881) * (-902.871) (-906.111) [-903.423] (-904.620) -- 0:00:00
989000 -- (-901.737) (-904.189) [-902.841] (-905.600) * (-907.760) (-903.281) [-905.740] (-903.237) -- 0:00:00
989500 -- (-906.373) (-907.579) [-901.999] (-903.735) * (-902.198) (-903.062) [-902.318] (-904.927) -- 0:00:00
990000 -- (-903.951) (-905.990) (-901.468) [-903.914] * (-902.716) (-903.892) [-903.075] (-903.691) -- 0:00:00
Average standard deviation of split frequencies: 0.009695
990500 -- [-905.409] (-903.496) (-902.403) (-904.856) * [-902.341] (-903.688) (-901.126) (-904.022) -- 0:00:00
991000 -- (-909.738) (-903.782) [-903.888] (-905.695) * (-901.536) (-903.804) [-902.595] (-905.899) -- 0:00:00
991500 -- (-904.119) (-902.609) [-908.039] (-903.599) * [-902.740] (-907.058) (-903.338) (-905.745) -- 0:00:00
992000 -- (-901.241) (-902.874) (-904.396) [-901.053] * [-904.998] (-905.889) (-905.831) (-904.978) -- 0:00:00
992500 -- [-903.117] (-903.340) (-903.516) (-901.433) * (-902.367) [-901.940] (-909.400) (-904.463) -- 0:00:00
993000 -- [-904.360] (-901.912) (-902.091) (-904.785) * (-901.924) [-901.720] (-910.290) (-904.531) -- 0:00:00
993500 -- (-902.594) (-906.312) (-903.230) [-903.718] * (-902.891) (-902.824) [-905.893] (-905.638) -- 0:00:00
994000 -- (-908.466) (-904.430) (-905.524) [-903.598] * (-905.612) (-904.138) [-905.923] (-902.642) -- 0:00:00
994500 -- (-904.353) (-907.832) (-905.997) [-903.892] * (-903.925) (-909.547) [-901.659] (-902.524) -- 0:00:00
995000 -- (-903.209) (-903.201) [-903.468] (-910.932) * (-902.581) (-906.144) [-903.396] (-903.765) -- 0:00:00
Average standard deviation of split frequencies: 0.009407
995500 -- (-905.688) [-902.633] (-904.113) (-904.347) * [-905.209] (-902.863) (-903.703) (-902.206) -- 0:00:00
996000 -- (-906.816) (-901.523) (-901.724) [-903.915] * (-905.792) (-907.162) [-903.169] (-904.331) -- 0:00:00
996500 -- (-902.089) (-903.543) [-902.861] (-903.401) * [-902.206] (-902.549) (-904.573) (-904.489) -- 0:00:00
997000 -- (-905.885) (-902.958) (-906.257) [-903.093] * (-905.285) [-902.522] (-904.027) (-901.523) -- 0:00:00
997500 -- [-902.469] (-906.037) (-902.574) (-903.310) * [-902.891] (-908.708) (-906.882) (-902.356) -- 0:00:00
998000 -- [-905.816] (-904.621) (-903.655) (-902.110) * (-907.015) (-902.270) [-901.765] (-903.061) -- 0:00:00
998500 -- (-905.422) (-910.611) [-903.929] (-907.609) * [-903.153] (-902.390) (-901.606) (-909.149) -- 0:00:00
999000 -- [-905.084] (-902.179) (-902.829) (-902.807) * [-901.494] (-906.084) (-901.354) (-904.797) -- 0:00:00
999500 -- [-903.016] (-912.220) (-906.443) (-904.997) * (-901.756) (-904.428) (-908.240) [-902.857] -- 0:00:00
1000000 -- [-903.700] (-904.459) (-905.239) (-903.026) * [-902.693] (-902.700) (-905.201) (-904.650) -- 0:00:00
Average standard deviation of split frequencies: 0.009333
Analysis completed in 1 mins 19 seconds
Analysis used 77.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -900.94
Likelihood of best state for "cold" chain of run 2 was -900.94
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.2 % ( 27 %) Dirichlet(Pi{all})
30.8 % ( 24 %) Slider(Pi{all})
79.0 % ( 46 %) Multiplier(Alpha{1,2})
77.6 % ( 50 %) Multiplier(Alpha{3})
22.0 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 82 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.2 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.5 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.0 % ( 32 %) Dirichlet(Pi{all})
30.1 % ( 26 %) Slider(Pi{all})
78.7 % ( 49 %) Multiplier(Alpha{1,2})
77.5 % ( 51 %) Multiplier(Alpha{3})
21.3 % ( 17 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.2 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166214 0.82 0.67
3 | 167325 166316 0.83
4 | 166119 167014 167012
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166852 0.82 0.67
3 | 166988 165945 0.84
4 | 166507 166988 166720
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -902.57
| 1 |
| 2 2 1 1 |
| 1 2 12 1 1 21 1 |
| 22 1 * 21 2 2 1 2|
| 21 11 12 12 22 1 1 2 2 2 12 |
| 1 1 22 *12* 2 1 22 2 2 2 211 2 |
| 2* 1 22 * 1212 *2 11 2 2 1 12 1|
|2 1 21 22 2* 1 121 1 12 2 1 |
| 1 2 1 1 1 11 1 2 |
|1 1 1 |
| 2 |
| 2 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -904.77
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.66 -906.14
2 -902.64 -906.21
--------------------------------------
TOTAL -902.65 -906.17
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889579 0.087241 0.396641 1.511872 0.852410 1240.61 1370.80 1.000
r(A<->C){all} 0.155363 0.018058 0.000202 0.428644 0.121008 152.62 210.84 1.001
r(A<->G){all} 0.167922 0.019534 0.000037 0.444673 0.131415 153.98 214.84 1.001
r(A<->T){all} 0.169140 0.020263 0.000006 0.460679 0.132292 253.65 258.09 1.003
r(C<->G){all} 0.169449 0.020989 0.000014 0.461038 0.128583 228.04 264.30 1.001
r(C<->T){all} 0.171922 0.020628 0.000064 0.458504 0.138292 199.31 205.97 1.000
r(G<->T){all} 0.166205 0.018431 0.000272 0.449495 0.132479 238.97 260.16 1.001
pi(A){all} 0.176339 0.000211 0.149150 0.205242 0.176138 1012.04 1098.07 1.000
pi(C){all} 0.291586 0.000299 0.261185 0.327657 0.291360 1189.19 1192.82 1.000
pi(G){all} 0.332044 0.000327 0.298284 0.369606 0.331981 1254.55 1294.17 1.000
pi(T){all} 0.200031 0.000232 0.170693 0.228778 0.199735 1177.42 1245.16 1.000
alpha{1,2} 0.411149 0.225798 0.000102 1.374844 0.242939 1197.19 1285.79 1.000
alpha{3} 0.447421 0.222329 0.000186 1.411529 0.287371 1198.04 1266.06 1.000
pinvar{all} 0.997592 0.000009 0.991999 1.000000 0.998552 1217.19 1258.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...*.*
9 -- ..*.*.
10 -- ..****
11 -- .****.
12 -- .*...*
13 -- .**.**
14 -- ...**.
15 -- .***.*
16 -- .*.*..
17 -- ....**
18 -- ..*..*
19 -- .*.***
20 -- .*..*.
21 -- ..**..
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.005653 0.149234 0.157229 2
8 450 0.149900 0.000942 0.149234 0.150566 2
9 445 0.148235 0.024026 0.131246 0.165223 2
10 444 0.147901 0.002827 0.145903 0.149900 2
11 431 0.143571 0.003298 0.141239 0.145903 2
12 428 0.142572 0.008480 0.136576 0.148568 2
13 426 0.141905 0.007537 0.136576 0.147235 2
14 426 0.141905 0.014133 0.131912 0.151899 2
15 421 0.140240 0.005182 0.136576 0.143904 2
16 420 0.139907 0.007537 0.134577 0.145237 2
17 420 0.139907 0.020728 0.125250 0.154564 2
18 416 0.138574 0.015075 0.127915 0.149234 2
19 412 0.137242 0.001884 0.135909 0.138574 2
20 405 0.134910 0.022141 0.119254 0.150566 2
21 392 0.130580 0.000000 0.130580 0.130580 2
22 309 0.102931 0.009893 0.095936 0.109927 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097293 0.009212 0.000048 0.288555 0.069398 1.000 2
length{all}[2] 0.100323 0.010000 0.000045 0.305571 0.070496 1.000 2
length{all}[3] 0.100515 0.010476 0.000079 0.304966 0.068870 1.001 2
length{all}[4] 0.102801 0.010868 0.000002 0.308323 0.069937 1.000 2
length{all}[5] 0.099831 0.009913 0.000044 0.297709 0.069086 1.000 2
length{all}[6] 0.097209 0.009337 0.000036 0.291027 0.068756 1.000 2
length{all}[7] 0.091024 0.009507 0.000081 0.292543 0.059105 0.998 2
length{all}[8] 0.102179 0.009482 0.000155 0.293897 0.074353 0.999 2
length{all}[9] 0.096236 0.008741 0.000898 0.273733 0.067672 1.004 2
length{all}[10] 0.094148 0.009390 0.000044 0.286341 0.063254 0.998 2
length{all}[11] 0.107892 0.011566 0.000026 0.330621 0.074738 1.000 2
length{all}[12] 0.093579 0.007547 0.000088 0.247996 0.069688 0.999 2
length{all}[13] 0.094510 0.010022 0.000085 0.324361 0.064797 0.998 2
length{all}[14] 0.086570 0.008423 0.000140 0.256959 0.059949 0.998 2
length{all}[15] 0.098838 0.011330 0.000055 0.309213 0.069897 0.998 2
length{all}[16] 0.099906 0.008832 0.000063 0.288684 0.068229 0.998 2
length{all}[17] 0.100004 0.011175 0.000581 0.284398 0.063843 0.998 2
length{all}[18] 0.100057 0.008928 0.000125 0.293220 0.069761 0.998 2
length{all}[19] 0.086880 0.008721 0.000242 0.249672 0.062908 0.998 2
length{all}[20] 0.098705 0.009091 0.000499 0.285843 0.068323 1.001 2
length{all}[21] 0.092772 0.007558 0.000068 0.282070 0.065812 0.998 2
length{all}[22] 0.101102 0.011268 0.000020 0.306436 0.068974 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009333
Maximum standard deviation of split frequencies = 0.024026
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 684
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
18 ambiguity characters in seq. 1
18 ambiguity characters in seq. 2
18 ambiguity characters in seq. 3
18 ambiguity characters in seq. 4
36 ambiguity characters in seq. 5
36 ambiguity characters in seq. 6
12 sites are removed. 1 2 3 4 5 6 223 224 225 226 227 228
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 216 / 216 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 216 / 216 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058758 0.042885 0.016269 0.036547 0.017197 0.080343 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -906.657402
Iterating by ming2
Initial: fx= 906.657402
x= 0.05876 0.04288 0.01627 0.03655 0.01720 0.08034 0.30000 1.30000
1 h-m-p 0.0000 0.0001 521.8424 ++ 885.930411 m 0.0001 13 | 1/8
2 h-m-p 0.0013 0.0281 27.1407 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 477.3024 ++ 884.943088 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0431 22.4646 ---------.. | 2/8
5 h-m-p 0.0000 0.0001 426.4173 ++ 868.414930 m 0.0001 73 | 3/8
6 h-m-p 0.0018 0.0683 18.1632 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 370.1523 ++ 864.336410 m 0.0000 105 | 4/8
8 h-m-p 0.0006 0.1133 13.8122 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 302.0903 ++ 857.507292 m 0.0001 136 | 5/8
10 h-m-p 0.0017 0.1689 9.4113 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 213.7999 ++ 852.835267 m 0.0001 168 | 6/8
12 h-m-p 0.3249 8.0000 0.0000 +++ 852.835267 m 8.0000 180 | 6/8
13 h-m-p 0.0631 8.0000 0.0006 ----C 852.835267 0 0.0001 197 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 Y 852.835267 0 0.0040 210 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 852.835267 m 8.0000 226 | 6/8
16 h-m-p 0.0030 1.5099 0.2034 ------Y 852.835267 0 0.0000 245 | 6/8
17 h-m-p 0.0160 8.0000 0.0002 -----N 852.835267 0 0.0000 263 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 --Y 852.835267 0 0.0003 278
Out..
lnL = -852.835267
279 lfun, 279 eigenQcodon, 1674 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038756 0.050799 0.077587 0.050534 0.068675 0.053399 0.300192 0.500620 0.100451
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.334739
np = 9
lnL0 = -921.200896
Iterating by ming2
Initial: fx= 921.200896
x= 0.03876 0.05080 0.07759 0.05053 0.06868 0.05340 0.30019 0.50062 0.10045
1 h-m-p 0.0000 0.0002 464.0635 +++ 875.497847 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0004 190.7304 ++ 863.110750 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0000 933.3397 ++ 862.849959 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 9134202.9991 ++ 860.920071 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 6828.1642 ++ 860.421954 m 0.0000 63 | 5/9
6 h-m-p 0.0002 0.0081 26.1029 +++ 859.848560 m 0.0081 76 | 6/9
7 h-m-p 0.0003 0.0013 188.8694 ++ 858.945966 m 0.0013 88 | 6/9
8 h-m-p 0.0000 0.0000 5.6505
h-m-p: 0.00000000e+00 0.00000000e+00 5.65053788e+00 858.945966
.. | 6/9
9 h-m-p 0.0000 0.0001 204.0309 ++ 852.835137 m 0.0001 109 | 7/9
10 h-m-p 0.0081 0.0403 0.0005 ++ 852.835137 m 0.0403 121 | 8/9
11 h-m-p 0.0160 8.0000 0.0008 +++++ 852.835136 m 8.0000 138 | 8/9
12 h-m-p 0.0160 8.0000 0.9744 -----------C 852.835136 0 0.0000 162 | 8/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 852.835136 m 8.0000 178 | 8/9
14 h-m-p 0.0160 8.0000 0.9158 -----------C 852.835136 0 0.0000 202 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 -----------N 852.835136 0 0.0000 226 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 ------Y 852.835136 0 0.0000 245
Out..
lnL = -852.835136
246 lfun, 738 eigenQcodon, 2952 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036059 0.074530 0.043462 0.079165 0.069014 0.020068 0.191740 1.614199 0.570133 0.178709 1.542998
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.009865
np = 11
lnL0 = -916.923757
Iterating by ming2
Initial: fx= 916.923757
x= 0.03606 0.07453 0.04346 0.07917 0.06901 0.02007 0.19174 1.61420 0.57013 0.17871 1.54300
1 h-m-p 0.0000 0.0001 455.9156 ++ 894.182199 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0005 206.5281 ++ 877.752105 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0000 2980.7954 ++ 872.052686 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 1525.1875 ++ 866.021053 m 0.0000 58 | 4/11
5 h-m-p 0.0011 0.0065 19.3821 -----------.. | 4/11
6 h-m-p 0.0000 0.0001 349.0000 ++ 856.218331 m 0.0001 95 | 5/11
7 h-m-p 0.0030 0.0484 7.4158 ------------.. | 5/11
8 h-m-p 0.0000 0.0000 296.8002 ++ 853.843168 m 0.0000 133 | 6/11
9 h-m-p 0.0017 0.0820 3.3198 ------------.. | 6/11
10 h-m-p 0.0000 0.0000 211.9249 ++ 852.835230 m 0.0000 171 | 7/11
11 h-m-p 0.0378 8.0000 0.0000 ++++ 852.835230 m 8.0000 187 | 7/11
12 h-m-p 0.0160 8.0000 0.0049 +++++ 852.835230 m 8.0000 208 | 7/11
13 h-m-p 0.0160 8.0000 16.9274 -----------C 852.835230 0 0.0000 237 | 7/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 852.835230 m 8.0000 254 | 7/11
15 h-m-p 0.0012 0.5885 1.1012 +++++ 852.835227 m 0.5885 275 | 8/11
16 h-m-p 0.4187 8.0000 0.8728 +Y 852.835214 0 1.6747 290 | 8/11
17 h-m-p 1.6000 8.0000 0.4714 Y 852.835214 0 1.2091 307 | 8/11
18 h-m-p 1.6000 8.0000 0.0876 Y 852.835214 0 1.1213 324 | 8/11
19 h-m-p 1.6000 8.0000 0.0035 ++ 852.835214 m 8.0000 341 | 8/11
20 h-m-p 1.6000 8.0000 0.0030 ++ 852.835214 m 8.0000 358 | 8/11
21 h-m-p 0.1287 8.0000 0.1874 ++C 852.835213 0 3.0745 377 | 8/11
22 h-m-p 1.6000 8.0000 0.0454 ++ 852.835209 m 8.0000 394 | 8/11
23 h-m-p 0.0305 0.1523 2.0469 ++ 852.835202 m 0.1523 411 | 9/11
24 h-m-p 0.2387 8.0000 1.0073 +++ 852.835102 m 8.0000 426 | 9/11
25 h-m-p 1.6000 8.0000 0.0207 ++ 852.835102 m 8.0000 440 | 9/11
26 h-m-p 0.2947 8.0000 0.5622 --------Y 852.835102 0 0.0000 464 | 9/11
27 h-m-p 0.0160 8.0000 0.0001 -N 852.835102 0 0.0005 481 | 9/11
28 h-m-p 0.0160 8.0000 0.0001 Y 852.835102 0 0.0160 497 | 9/11
29 h-m-p 0.0160 8.0000 0.2815 +++++ 852.835102 m 8.0000 516 | 9/11
30 h-m-p 1.1072 8.0000 2.0338 ++ 852.835102 m 8.0000 532 | 9/11
31 h-m-p 1.6000 8.0000 0.0000 C 852.835102 0 1.6000 546 | 9/11
32 h-m-p 0.0160 8.0000 0.0000 Y 852.835102 0 0.0160 562
Out..
lnL = -852.835102
563 lfun, 2252 eigenQcodon, 10134 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -852.878001 S = -852.835968 -0.016208
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:04
did 20 / 56 patterns 0:04
did 30 / 56 patterns 0:04
did 40 / 56 patterns 0:04
did 50 / 56 patterns 0:04
did 56 / 56 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080608 0.054706 0.012187 0.064979 0.070065 0.056145 0.000100 0.923451 1.044046
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.332852
np = 9
lnL0 = -922.395425
Iterating by ming2
Initial: fx= 922.395425
x= 0.08061 0.05471 0.01219 0.06498 0.07007 0.05614 0.00011 0.92345 1.04405
1 h-m-p 0.0000 0.0000 486.1357 ++ 921.583420 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0053 63.9783 ++++ 905.103820 m 0.0053 28 | 2/9
3 h-m-p 0.0003 0.0017 108.4533 ++ 882.729108 m 0.0017 40 | 3/9
4 h-m-p 0.0006 0.0030 174.5916 ++ 859.419143 m 0.0030 52 | 4/9
5 h-m-p 0.0000 0.0000 7645.2762 ++ 857.864684 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0000 1238.7493 ++ 856.001733 m 0.0000 76 | 6/9
7 h-m-p 0.0000 0.0002 96.4691 ++ 852.835135 m 0.0002 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 852.835135 m 8.0000 100 | 7/9
9 h-m-p 0.0160 8.0000 0.0609 -----------C 852.835135 0 0.0000 125 | 7/9
10 h-m-p 0.0060 3.0019 0.0207 +++++ 852.835102 m 3.0019 142
QuantileBeta(0.15, 0.00494, 1.00625) = 4.007171e-162 2000 rounds
| 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 852.835102 0 1.6000 156 | 8/9
12 h-m-p 0.0160 8.0000 2.9944 ++
QuantileBeta(0.15, 0.00500, 4.07253) = 5.746106e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 13.27136) = 1.612938e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
+ 852.835102 m 8.0000 172
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96153) = 8.717555e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.96155) = 8.423489e-162 2000 rounds
| 8/9
13 h-m-p 0.1401 0.7006 35.6221
QuantileBeta(0.15, 0.00500, 19.97023) = 1.058220e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 23.71371) = 8.876171e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.64958) = 8.532278e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.88355) = 8.450428e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.94204) = 8.430210e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95815) = 8.424657e-162 2000 rounds
Y 852.835102 0 0.0001 188
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.719292e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95667) = 8.425167e-162 2000 rounds
| 8/9
14 h-m-p 1.4999 8.0000 0.0032
QuantileBeta(0.15, 0.00500, 24.96153) = 8.423493e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95788) = 8.424751e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95696) = 8.425066e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95674) = 8.425145e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95668) = 8.425165e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425169e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
Y 852.835102 0 0.0001 206
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.719291e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95716) = 8.425000e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95616) = 8.425342e-162 2000 rounds
| 8/9
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
Y 852.835102 0 0.1000 220
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
Out..
lnL = -852.835102
221 lfun, 2431 eigenQcodon, 13260 P(t)
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 24.95666) = 8.425171e-162 2000 rounds
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030750 0.026274 0.013673 0.107859 0.026862 0.069464 0.000100 0.900000 0.595392 1.349521 1.300015
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.656281
np = 11
lnL0 = -908.029795
Iterating by ming2
Initial: fx= 908.029795
x= 0.03075 0.02627 0.01367 0.10786 0.02686 0.06946 0.00011 0.90000 0.59539 1.34952 1.30001
1 h-m-p 0.0000 0.0000 468.9249 ++ 907.332165 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 115.8520 ++++ 891.005157 m 0.0014 32 | 2/11
3 h-m-p 0.0000 0.0002 325.1337 ++ 878.276620 m 0.0002 46 | 3/11
4 h-m-p 0.0000 0.0001 106.4321 ++ 877.808720 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0000 1213.2506 ++ 875.937328 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 53867.3644 ++ 862.281064 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 5544.6102 ++ 856.537031 m 0.0000 102 | 7/11
8 h-m-p 0.0098 0.0491 6.7248 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 207.5566 ++ 852.835231 m 0.0001 141 | 8/11
10 h-m-p 0.7275 8.0000 0.0000 ++ 852.835231 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0224 -------C 852.835231 0 0.0000 179 | 8/11
12 h-m-p 0.0160 8.0000 0.0001 ---Y 852.835231 0 0.0001 199 | 8/11
13 h-m-p 0.0160 8.0000 0.0002 --------C 852.835231 0 0.0000 224
Out..
lnL = -852.835231
225 lfun, 2700 eigenQcodon, 14850 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -852.852847 S = -852.832296 -0.009039
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:11
did 20 / 56 patterns 0:11
did 30 / 56 patterns 0:12
did 40 / 56 patterns 0:12
did 50 / 56 patterns 0:12
did 56 / 56 patterns 0:12
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=228
NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
NC_002677_1_NP_302561_1_1433_ML2412 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 ------MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 ------MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE
********************************************
NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
NC_002677_1_NP_302561_1_1433_ML2412 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV
**************************************************
NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
NC_002677_1_NP_302561_1_1433_ML2412 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ
**************************************************
NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
NC_002677_1_NP_302561_1_1433_ML2412 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD
**************************************************
NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 LQPVVARVAHETVAGQLPRGTS------
NC_002677_1_NP_302561_1_1433_ML2412 LQPVVARVAHETVAGQLPRGTS------
NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 LQPVVARVAHETVAGQLPRGTS------
NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 LQPVVARVAHETVAGQLPRGTS------
NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 LQPVVARVAHETVAGQLPRGTSoooooo
NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 LQPVVARVAHETVAGQLPRGTSoooooo
**********************
>NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT GCCGCGGGGAACGTCA------------------ >NC_002677_1_NP_302561_1_1433_ML2412 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT GCCGCGGGGAACGTCA------------------ >NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT GCCGCGGGGAACGTCA------------------ >NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 TTGATAGCGCCGGCGACGATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT GCCGCGGGGAACGTCA------------------ >NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 ------------------ATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT GCCGCGGGGAACGTCA------------------ >NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 ------------------ATGCAGAGCGAAGCGATGCGGAGGAGTGGTGC CACGATAATCTGGCGGCTGGCGAACGCCGGTGCACTGTTGGCGACCCTGC TAGCGGGCTGTTCGGGTCGCGATGCGGTAGTCCAAGGCGGCACCTTTGAA TTTGTCTCGCCCGACGGCAAGACCGACATCTTCTACGAGCCACCCGCGAG CCGTGGCCGCCCGGGGCCGCTGTCCGGGCTGGATCTGGCGGATCCTGAGC GGACGGTCGCGCTGGACGACTTCACGGGAAACGTTGTCGTTATTAATGTT TGGGGCCAGTGGTGTGGGCCTTGCCGGACCGAAGTGACCCAACTGCAGCA GGTCTATAATGCTACCCGAGATTCCGGAGTATCCTTCCTCGGTATCGATG TCCGCGATAACAACCGCCAGGCGGCCCAGGATTTCGTCAACGACCGCCAG GTCACGTTCCCGTCGATCTACGACCCGGCGATGCGGACTCTGATTGCTTT CGGCGACAAATACCCGACCACCGTGATCCCATTCACGTTGGTGCTGGACC GTCAGCATCGGGTCGCGGCGGTATTTCTGCGGGAATTGCTCGCCGGGGAT TTGCAACCTGTGGTGGCTAGGGTGGCGCACGAAACCGTGGCGGGTCAACT GCCGCGGGGAACGTCA------------------
>NC_011896_1_WP_010908881_1_2577_MLBR_RS12275 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD LQPVVARVAHETVAGQLPRGTS >NC_002677_1_NP_302561_1_1433_ML2412 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD LQPVVARVAHETVAGQLPRGTS >NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD LQPVVARVAHETVAGQLPRGTS >NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000 LIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD LQPVVARVAHETVAGQLPRGTS >NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265 ------MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD LQPVVARVAHETVAGQLPRGTS >NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590 ------MQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFE FVSPDGKTDIFYEPPASRGRPGPLSGLDLADPERTVALDDFTGNVVVINV WGQWCGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQ VTFPSIYDPAMRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGD LQPVVARVAHETVAGQLPRGTS
#NEXUS
[ID: 5043817053]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908881_1_2577_MLBR_RS12275
NC_002677_1_NP_302561_1_1433_ML2412
NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220
NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000
NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265
NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908881_1_2577_MLBR_RS12275,
2 NC_002677_1_NP_302561_1_1433_ML2412,
3 NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220,
4 NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000,
5 NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265,
6 NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06939817,2:0.07049578,3:0.06886995,4:0.06993722,5:0.06908556,6:0.06875585);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06939817,2:0.07049578,3:0.06886995,4:0.06993722,5:0.06908556,6:0.06875585);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.66 -906.14
2 -902.64 -906.21
--------------------------------------
TOTAL -902.65 -906.17
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2412/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889579 0.087241 0.396641 1.511872 0.852410 1240.61 1370.80 1.000
r(A<->C){all} 0.155363 0.018058 0.000202 0.428644 0.121008 152.62 210.84 1.001
r(A<->G){all} 0.167922 0.019534 0.000037 0.444673 0.131415 153.98 214.84 1.001
r(A<->T){all} 0.169140 0.020263 0.000006 0.460679 0.132292 253.65 258.09 1.003
r(C<->G){all} 0.169449 0.020989 0.000014 0.461038 0.128583 228.04 264.30 1.001
r(C<->T){all} 0.171922 0.020628 0.000064 0.458504 0.138292 199.31 205.97 1.000
r(G<->T){all} 0.166205 0.018431 0.000272 0.449495 0.132479 238.97 260.16 1.001
pi(A){all} 0.176339 0.000211 0.149150 0.205242 0.176138 1012.04 1098.07 1.000
pi(C){all} 0.291586 0.000299 0.261185 0.327657 0.291360 1189.19 1192.82 1.000
pi(G){all} 0.332044 0.000327 0.298284 0.369606 0.331981 1254.55 1294.17 1.000
pi(T){all} 0.200031 0.000232 0.170693 0.228778 0.199735 1177.42 1245.16 1.000
alpha{1,2} 0.411149 0.225798 0.000102 1.374844 0.242939 1197.19 1285.79 1.000
alpha{3} 0.447421 0.222329 0.000186 1.411529 0.287371 1198.04 1266.06 1.000
pinvar{all} 0.997592 0.000009 0.991999 1.000000 0.998552 1217.19 1258.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2412/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 216
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 2 2 2 2 2 2
TTC 7 7 7 7 7 7 | TCC 3 3 3 3 3 3 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 4 4 4 4 4 4 | CGA 1 1 1 1 1 1
CTG 12 12 12 12 12 12 | CCG 6 6 6 6 6 6 | CAG 8 8 8 8 8 8 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 9 9 9 9 9 9 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 6 6 6 6 6 6 | AAG 1 1 1 1 1 1 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 8 8 8 8 8 8 | Gly GGT 5 5 5 5 5 5
GTC 9 9 9 9 9 9 | GCC 4 4 4 4 4 4 | GAC 8 8 8 8 8 8 | GGC 7 7 7 7 7 7
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 7 7 7 7 7 7 | GCG 14 14 14 14 14 14 | GAG 2 2 2 2 2 2 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908881_1_2577_MLBR_RS12275
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
#2: NC_002677_1_NP_302561_1_1433_ML2412
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
#3: NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
#4: NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
#5: NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
#6: NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 12
TTC 42 | TCC 18 | TAC 18 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 6 | Arg R CGT 12
CTC 12 | CCC 12 | CAC 6 | CGC 30
CTA 6 | CCA 12 | Gln Q CAA 24 | CGA 6
CTG 72 | CCG 36 | CAG 48 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 30 | ACC 54 | AAC 30 | AGC 12
ATA 6 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 36 | AAG 6 | AGG 12
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 48 | Gly G GGT 30
GTC 54 | GCC 24 | GAC 48 | GGC 42
GTA 18 | GCA 6 | Glu E GAA 30 | GGA 18
GTG 42 | GCG 84 | GAG 12 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14352 C:0.26852 A:0.18981 G:0.39815
position 2: T:0.28704 C:0.26852 A:0.23148 G:0.21296
position 3: T:0.17130 C:0.33796 A:0.10648 G:0.38426
Average T:0.20062 C:0.29167 A:0.17593 G:0.33179
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -852.835267 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300192 1.300015
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908881_1_2577_MLBR_RS12275: 0.000004, NC_002677_1_NP_302561_1_1433_ML2412: 0.000004, NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220: 0.000004, NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000: 0.000004, NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265: 0.000004, NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30019
omega (dN/dS) = 1.30001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 494.3 153.7 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 494.3 153.7 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 494.3 153.7 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 494.3 153.7 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 494.3 153.7 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 494.3 153.7 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -852.835136 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.191740 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908881_1_2577_MLBR_RS12275: 0.000004, NC_002677_1_NP_302561_1_1433_ML2412: 0.000004, NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220: 0.000004, NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000: 0.000004, NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265: 0.000004, NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.19174
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 495.8 152.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 495.8 152.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 495.8 152.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 495.8 152.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 495.8 152.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 495.8 152.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -852.835102 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999999 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908881_1_2577_MLBR_RS12275: 0.000004, NC_002677_1_NP_302561_1_1433_ML2412: 0.000004, NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220: 0.000004, NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000: 0.000004, NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265: 0.000004, NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908881_1_2577_MLBR_RS12275)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -852.835102 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 24.956660
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908881_1_2577_MLBR_RS12275: 0.000004, NC_002677_1_NP_302561_1_1433_ML2412: 0.000004, NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220: 0.000004, NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000: 0.000004, NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265: 0.000004, NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 24.95666
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 498.6 149.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -852.835231 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.695114 0.005000 1.502303 1.655320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908881_1_2577_MLBR_RS12275: 0.000004, NC_002677_1_NP_302561_1_1433_ML2412: 0.000004, NZ_LVXE01000073_1_WP_010908881_1_2617_A3216_RS13220: 0.000004, NZ_LYPH01000074_1_WP_010908881_1_2498_A8144_RS12000: 0.000004, NZ_CP029543_1_WP_111481096_1_2604_DIJ64_RS13265: 0.000004, NZ_AP014567_1_WP_111481096_1_2669_JK2ML_RS13590: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.69511 p = 0.00500 q = 1.50230
(p1 = 0.30489) w = 1.65532
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06951 0.06951 0.06951 0.06951 0.06951 0.06951 0.06951 0.06951 0.06951 0.06951 0.30489
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.65532
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 498.6 149.4 0.5047 0.0000 0.0000 0.0 0.0
7..2 0.000 498.6 149.4 0.5047 0.0000 0.0000 0.0 0.0
7..3 0.000 498.6 149.4 0.5047 0.0000 0.0000 0.0 0.0
7..4 0.000 498.6 149.4 0.5047 0.0000 0.0000 0.0 0.0
7..5 0.000 498.6 149.4 0.5047 0.0000 0.0000 0.0 0.0
7..6 0.000 498.6 149.4 0.5047 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908881_1_2577_MLBR_RS12275)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908881_1_2577_MLBR_RS12275)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.099 0.099 0.099 0.100 0.100 0.101 0.101 0.101 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:12
Model 1: NearlyNeutral -852.835136 Model 2: PositiveSelection -852.835102 Model 0: one-ratio -852.835267 Model 7: beta -852.835102 Model 8: beta&w>1 -852.835231 Model 0 vs 1 2.620000000206346E-4 Model 2 vs 1 6.800000005569018E-5 Model 8 vs 7 2.5800000003073364E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
