--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:02:40 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/9res/ML2424/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1234.76 -1238.75 2 -1234.76 -1238.09 -------------------------------------- TOTAL -1234.76 -1238.47 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.882682 0.094457 0.363963 1.513897 0.850241 1072.27 1248.02 1.000 r(A<->C){all} 0.138869 0.016407 0.000023 0.390455 0.099241 116.86 210.14 1.000 r(A<->G){all} 0.167980 0.021216 0.000040 0.456989 0.123502 133.65 228.64 1.001 r(A<->T){all} 0.165448 0.020099 0.000074 0.453862 0.129930 224.36 225.61 1.006 r(C<->G){all} 0.212972 0.024887 0.000185 0.522299 0.183738 96.65 158.45 1.001 r(C<->T){all} 0.151544 0.018320 0.000032 0.429644 0.112974 188.01 247.02 1.001 r(G<->T){all} 0.163188 0.019090 0.000039 0.438789 0.126281 278.83 339.15 1.000 pi(A){all} 0.200224 0.000173 0.173619 0.225986 0.200224 1382.75 1405.24 1.000 pi(C){all} 0.313172 0.000229 0.284773 0.343092 0.313246 941.61 1176.14 1.001 pi(G){all} 0.308164 0.000230 0.276933 0.335607 0.308236 1248.19 1350.28 1.000 pi(T){all} 0.178440 0.000165 0.155069 0.203738 0.178083 1183.83 1320.71 1.000 alpha{1,2} 0.343353 0.172830 0.000488 1.191478 0.211134 1272.13 1352.79 1.000 alpha{3} 0.403915 0.220870 0.000141 1.333924 0.236442 1133.36 1183.11 1.000 pinvar{all} 0.996404 0.000009 0.990893 0.999936 0.997188 1366.65 1414.36 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1191.696841 Model 2: PositiveSelection -1191.374602 Model 0: one-ratio -1191.448531 Model 7: beta -1191.69684 Model 8: beta&w>1 -1191.374602 Model 0 vs 1 0.4966199999998935 Model 2 vs 1 0.6444779999997081 Model 8 vs 7 0.6444759999999405
>C1 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C2 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C3 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C4 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C5 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C6 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQGKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=300 C1 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C2 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C3 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C4 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C5 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C6 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT ************************************************** C1 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C2 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C3 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C4 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C5 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C6 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQGKFQLLGK ******************************************.******* C1 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C2 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C3 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C4 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C5 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C6 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ ************************************************** C1 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C2 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C3 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C4 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C5 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C6 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ************************************************** C1 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C2 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C3 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C4 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C5 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C6 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP ************************************************** C1 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C2 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C3 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C4 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C5 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C6 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE ************************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 300 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 300 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9000] Library Relaxation: Multi_proc [96] Relaxation Summary: [9000]--->[9000] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.507 Mb, Max= 30.862 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C2 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C3 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C4 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C5 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT C6 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT ************************************************** C1 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C2 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C3 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C4 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C5 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK C6 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQGKFQLLGK ******************************************.******* C1 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C2 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C3 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C4 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C5 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ C6 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ ************************************************** C1 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C2 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C3 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C4 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C5 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD C6 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ************************************************** C1 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C2 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C3 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C4 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C5 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP C6 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP ************************************************** C1 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C2 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C3 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C4 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C5 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE C6 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE ************************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 99.67 C1 C6 99.67 TOP 5 0 99.67 C6 C1 99.67 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.67 C2 C6 99.67 TOP 5 1 99.67 C6 C2 99.67 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 99.67 C3 C6 99.67 TOP 5 2 99.67 C6 C3 99.67 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 99.67 C4 C6 99.67 TOP 5 3 99.67 C6 C4 99.67 BOT 4 5 99.67 C5 C6 99.67 TOP 5 4 99.67 C6 C5 99.67 AVG 0 C1 * 99.93 AVG 1 C2 * 99.93 AVG 2 C3 * 99.93 AVG 3 C4 * 99.93 AVG 4 C5 * 99.93 AVG 5 C6 * 99.67 TOT TOT * 99.89 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG C2 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG C3 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG C4 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG C5 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG C6 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG ************************************************** C1 TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA C2 TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA C3 TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA C4 TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA C5 TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA C6 TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA ************************************************** C1 CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC C2 CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC C3 CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC C4 CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC C5 CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC C6 CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC ************************************************** C1 GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC C2 GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC C3 GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC C4 GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC C5 GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC C6 GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC ************************************************** C1 GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG C2 GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG C3 GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG C4 GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG C5 GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG C6 GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ************************************************** C1 ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA C2 ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA C3 ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA C4 ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA C5 ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA C6 ATGTACTCGGATTCATCTACGCCCAGGGTAAATTTCAATTACTCGGAAAA *************************** ********************** C1 GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT C2 GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT C3 GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT C4 GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT C5 GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT C6 GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT ************************************************** C1 CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG C2 CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG C3 CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG C4 CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG C5 CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG C6 CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ************************************************** C1 ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG C2 ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG C3 ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG C4 ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG C5 ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG C6 ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ************************************************** C1 ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA C2 ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA C3 ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA C4 ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA C5 ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA C6 ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA ************************************************** C1 CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG C2 CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG C3 CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG C4 CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG C5 CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG C6 CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG ************************************************** C1 GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT C2 GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT C3 GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT C4 GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT C5 GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT C6 GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT ************************************************** C1 GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT C2 GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT C3 GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT C4 GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT C5 GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT C6 GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT ************************************************** C1 CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA C2 CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA C3 CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA C4 CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA C5 CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA C6 CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ************************************************** C1 ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG C2 ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG C3 ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG C4 ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG C5 ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG C6 ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG ************************************************** C1 GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA C2 GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA C3 GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA C4 GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA C5 GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA C6 GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA ************************************************** C1 CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG C2 CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG C3 CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG C4 CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG C5 CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG C6 CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG ************************************************** C1 CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA C2 CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA C3 CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA C4 CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA C5 CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA C6 CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA ************************************************** >C1 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >C2 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >C3 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >C4 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >C5 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >C6 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGGTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >C1 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C2 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C3 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C4 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C5 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >C6 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQGKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 900 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579856475 Setting output file names to "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1657971935 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5386625527 Seed = 1010503935 Swapseed = 1579856475 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 5 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2017.646011 -- -24.965149 Chain 2 -- -2017.646012 -- -24.965149 Chain 3 -- -2017.644462 -- -24.965149 Chain 4 -- -2017.646011 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2017.644462 -- -24.965149 Chain 2 -- -2017.646011 -- -24.965149 Chain 3 -- -2017.646011 -- -24.965149 Chain 4 -- -2017.645896 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2017.646] (-2017.646) (-2017.644) (-2017.646) * [-2017.644] (-2017.646) (-2017.646) (-2017.646) 500 -- (-1256.157) [-1248.914] (-1243.373) (-1275.684) * (-1255.432) (-1237.963) [-1248.596] (-1254.985) -- 0:00:00 1000 -- (-1238.841) [-1239.664] (-1246.384) (-1237.377) * (-1240.745) (-1239.212) (-1236.481) [-1238.731] -- 0:00:00 1500 -- (-1238.498) (-1248.228) [-1245.468] (-1238.822) * (-1242.961) [-1243.615] (-1247.691) (-1236.900) -- 0:00:00 2000 -- [-1244.474] (-1246.969) (-1241.713) (-1245.534) * (-1238.766) (-1244.672) [-1234.083] (-1238.401) -- 0:00:00 2500 -- [-1241.885] (-1245.735) (-1237.405) (-1236.351) * (-1239.869) [-1240.516] (-1238.343) (-1240.135) -- 0:00:00 3000 -- (-1243.221) (-1239.254) (-1241.844) [-1239.457] * (-1241.354) [-1237.798] (-1237.621) (-1238.470) -- 0:00:00 3500 -- (-1237.284) (-1240.611) (-1242.311) [-1240.986] * [-1237.666] (-1242.514) (-1248.627) (-1240.277) -- 0:00:00 4000 -- [-1242.522] (-1239.431) (-1243.123) (-1243.966) * [-1243.465] (-1238.602) (-1247.319) (-1235.724) -- 0:00:00 4500 -- [-1238.741] (-1238.184) (-1239.397) (-1240.161) * (-1245.635) (-1240.481) [-1236.733] (-1243.540) -- 0:00:00 5000 -- [-1237.061] (-1244.390) (-1242.199) (-1243.571) * [-1239.327] (-1239.270) (-1247.746) (-1244.583) -- 0:00:00 Average standard deviation of split frequencies: 0.075151 5500 -- (-1242.347) [-1241.309] (-1239.887) (-1243.381) * (-1240.017) (-1246.513) [-1237.428] (-1247.718) -- 0:00:00 6000 -- (-1240.601) (-1239.858) (-1243.382) [-1240.955] * (-1238.046) (-1239.718) (-1237.839) [-1244.171] -- 0:00:00 6500 -- (-1248.096) (-1236.584) (-1245.493) [-1240.296] * (-1240.995) [-1238.799] (-1248.375) (-1245.913) -- 0:00:00 7000 -- (-1237.594) [-1240.953] (-1243.084) (-1240.230) * (-1242.021) (-1243.293) [-1241.455] (-1239.741) -- 0:00:00 7500 -- (-1237.787) (-1241.154) (-1243.861) [-1242.828] * (-1239.249) [-1238.053] (-1243.352) (-1243.254) -- 0:00:00 8000 -- [-1241.199] (-1249.393) (-1250.472) (-1246.644) * (-1240.143) (-1237.532) (-1241.020) [-1240.323] -- 0:00:00 8500 -- (-1242.211) (-1235.643) (-1248.517) [-1239.787] * [-1236.695] (-1237.256) (-1237.966) (-1247.716) -- 0:00:00 9000 -- (-1243.642) (-1236.493) (-1248.226) [-1241.503] * (-1238.598) (-1236.393) (-1237.285) [-1236.564] -- 0:00:00 9500 -- (-1244.003) (-1238.718) (-1247.101) [-1240.204] * (-1236.337) [-1234.536] (-1247.566) (-1245.417) -- 0:00:00 10000 -- [-1240.291] (-1242.486) (-1241.790) (-1238.617) * [-1234.969] (-1233.180) (-1242.354) (-1241.295) -- 0:00:00 Average standard deviation of split frequencies: 0.059662 10500 -- (-1245.691) [-1239.598] (-1245.006) (-1250.367) * [-1235.440] (-1236.531) (-1244.883) (-1241.962) -- 0:00:00 11000 -- [-1242.977] (-1236.209) (-1236.047) (-1238.334) * [-1244.981] (-1235.778) (-1235.123) (-1243.363) -- 0:00:00 11500 -- (-1239.082) (-1242.971) (-1250.362) [-1247.695] * [-1239.429] (-1239.662) (-1239.978) (-1243.596) -- 0:01:25 12000 -- (-1240.897) (-1244.131) [-1235.973] (-1240.579) * (-1250.376) (-1239.516) (-1237.204) [-1246.166] -- 0:01:22 12500 -- [-1238.178] (-1240.812) (-1239.276) (-1248.481) * (-1237.789) [-1235.782] (-1239.502) (-1239.075) -- 0:01:19 13000 -- [-1241.656] (-1242.707) (-1243.877) (-1238.053) * [-1241.653] (-1237.462) (-1235.522) (-1240.966) -- 0:01:15 13500 -- (-1246.695) (-1242.918) [-1242.955] (-1238.511) * (-1235.386) [-1235.026] (-1234.850) (-1241.111) -- 0:01:13 14000 -- (-1248.076) (-1238.831) (-1248.048) [-1236.850] * (-1239.169) (-1236.180) [-1236.757] (-1245.111) -- 0:01:10 14500 -- [-1238.821] (-1247.873) (-1243.449) (-1242.351) * (-1243.538) (-1241.828) (-1234.783) [-1238.336] -- 0:01:07 15000 -- (-1245.365) [-1238.281] (-1242.032) (-1244.012) * (-1238.050) (-1235.068) (-1238.885) [-1236.906] -- 0:01:05 Average standard deviation of split frequencies: 0.046036 15500 -- (-1241.705) [-1243.738] (-1243.974) (-1241.679) * [-1242.300] (-1238.197) (-1235.452) (-1248.931) -- 0:01:03 16000 -- [-1237.925] (-1240.719) (-1237.258) (-1242.100) * (-1240.437) (-1236.112) (-1235.669) [-1241.888] -- 0:01:01 16500 -- (-1241.866) [-1238.118] (-1237.513) (-1238.679) * (-1237.377) [-1235.337] (-1237.041) (-1236.740) -- 0:00:59 17000 -- (-1251.223) (-1237.779) [-1245.803] (-1238.364) * [-1234.485] (-1235.148) (-1237.046) (-1243.442) -- 0:00:57 17500 -- [-1241.179] (-1241.808) (-1245.725) (-1240.510) * (-1238.009) (-1239.759) (-1235.372) [-1235.718] -- 0:00:56 18000 -- (-1239.359) [-1241.181] (-1243.845) (-1242.151) * (-1234.427) (-1235.192) (-1235.512) [-1236.409] -- 0:00:54 18500 -- (-1243.916) [-1234.982] (-1239.637) (-1237.571) * (-1243.123) [-1234.302] (-1234.975) (-1236.975) -- 0:00:53 19000 -- (-1248.991) [-1236.159] (-1241.985) (-1241.664) * (-1241.821) (-1233.809) [-1234.217] (-1237.854) -- 0:00:51 19500 -- (-1241.665) (-1239.492) [-1246.063] (-1244.324) * (-1234.578) (-1237.977) (-1234.671) [-1240.423] -- 0:00:50 20000 -- (-1240.031) (-1242.516) [-1241.168] (-1237.648) * (-1241.349) (-1241.758) (-1235.550) [-1239.809] -- 0:00:49 Average standard deviation of split frequencies: 0.035640 20500 -- [-1244.002] (-1243.684) (-1243.365) (-1242.904) * (-1237.909) (-1244.604) (-1236.029) [-1237.192] -- 0:00:47 21000 -- (-1250.330) (-1236.325) (-1236.491) [-1239.431] * [-1237.815] (-1236.249) (-1235.969) (-1245.036) -- 0:00:46 21500 -- (-1242.467) (-1241.579) (-1242.769) [-1238.716] * [-1241.903] (-1236.461) (-1237.019) (-1235.440) -- 0:00:45 22000 -- (-1243.103) [-1243.862] (-1241.954) (-1239.124) * (-1252.065) (-1233.972) [-1234.454] (-1241.409) -- 0:00:44 22500 -- (-1238.019) (-1240.022) (-1241.783) [-1239.909] * (-1239.265) [-1234.833] (-1234.365) (-1239.001) -- 0:00:43 23000 -- (-1240.826) [-1241.204] (-1241.022) (-1242.266) * (-1237.865) [-1234.104] (-1233.885) (-1238.660) -- 0:00:42 23500 -- (-1238.542) (-1239.639) (-1243.444) [-1239.607] * [-1245.862] (-1235.876) (-1234.197) (-1244.591) -- 0:00:41 24000 -- (-1242.122) (-1251.786) (-1244.806) [-1242.171] * (-1244.242) (-1236.321) [-1235.021] (-1238.451) -- 0:00:40 24500 -- (-1242.471) [-1244.957] (-1242.502) (-1240.138) * (-1246.883) [-1236.743] (-1235.338) (-1235.086) -- 0:00:39 25000 -- (-1244.094) (-1237.031) (-1245.957) [-1240.440] * (-1240.684) (-1237.459) (-1236.935) [-1237.818] -- 0:00:39 Average standard deviation of split frequencies: 0.041442 25500 -- [-1246.938] (-1237.239) (-1247.531) (-1237.344) * (-1237.577) (-1237.437) [-1233.604] (-1234.806) -- 0:00:38 26000 -- (-1247.691) [-1236.870] (-1243.827) (-1239.587) * (-1238.130) (-1239.697) (-1234.841) [-1235.463] -- 0:01:14 26500 -- [-1239.516] (-1248.382) (-1238.496) (-1250.083) * (-1236.077) (-1240.978) [-1233.841] (-1235.294) -- 0:01:13 27000 -- (-1244.362) (-1241.449) [-1240.577] (-1241.303) * [-1238.737] (-1237.800) (-1234.212) (-1235.765) -- 0:01:12 27500 -- [-1235.906] (-1237.017) (-1244.112) (-1244.502) * (-1236.514) (-1239.171) (-1235.753) [-1234.231] -- 0:01:10 28000 -- (-1242.447) (-1237.615) (-1236.356) [-1242.971] * (-1237.772) [-1235.452] (-1237.480) (-1234.711) -- 0:01:09 28500 -- [-1240.116] (-1240.277) (-1246.649) (-1245.487) * (-1237.434) (-1233.496) (-1241.521) [-1235.503] -- 0:01:08 29000 -- (-1241.788) [-1241.751] (-1242.789) (-1241.452) * (-1235.946) (-1235.684) (-1235.878) [-1234.830] -- 0:01:06 29500 -- (-1244.684) (-1244.192) [-1238.990] (-1237.208) * (-1234.871) [-1235.416] (-1234.610) (-1237.199) -- 0:01:05 30000 -- (-1239.690) [-1239.972] (-1249.973) (-1238.329) * (-1237.707) [-1235.332] (-1235.156) (-1235.375) -- 0:01:04 Average standard deviation of split frequencies: 0.042456 30500 -- (-1243.284) [-1238.175] (-1239.525) (-1235.339) * (-1236.319) [-1235.319] (-1237.892) (-1234.610) -- 0:01:03 31000 -- (-1245.332) (-1241.927) (-1240.097) [-1238.976] * [-1234.185] (-1233.211) (-1234.194) (-1239.046) -- 0:01:02 31500 -- (-1241.653) (-1245.376) (-1239.816) [-1236.977] * (-1233.420) (-1233.059) [-1233.900] (-1238.006) -- 0:01:01 32000 -- [-1239.924] (-1245.039) (-1244.922) (-1236.887) * (-1236.632) [-1234.447] (-1234.417) (-1237.868) -- 0:01:00 32500 -- [-1246.391] (-1241.770) (-1238.271) (-1236.508) * [-1237.124] (-1235.959) (-1236.235) (-1235.336) -- 0:00:59 33000 -- (-1245.637) [-1241.547] (-1243.152) (-1237.585) * (-1239.190) [-1234.953] (-1233.976) (-1240.117) -- 0:00:58 33500 -- [-1240.803] (-1242.742) (-1239.686) (-1235.010) * (-1235.513) (-1235.554) [-1233.450] (-1236.439) -- 0:00:57 34000 -- (-1239.460) (-1243.572) [-1238.933] (-1234.811) * (-1236.747) (-1236.405) (-1235.119) [-1233.570] -- 0:00:56 34500 -- (-1242.291) (-1250.614) [-1245.063] (-1234.372) * (-1235.188) [-1235.843] (-1235.967) (-1234.266) -- 0:00:55 35000 -- [-1240.474] (-1246.369) (-1243.161) (-1240.207) * [-1234.883] (-1235.285) (-1233.441) (-1238.115) -- 0:00:55 Average standard deviation of split frequencies: 0.043025 35500 -- (-1248.155) [-1238.182] (-1242.222) (-1238.490) * (-1236.689) (-1234.938) [-1236.423] (-1235.022) -- 0:00:54 36000 -- [-1239.686] (-1236.548) (-1250.743) (-1241.481) * (-1237.493) [-1233.928] (-1240.665) (-1235.098) -- 0:00:53 36500 -- [-1248.485] (-1247.741) (-1247.764) (-1235.795) * [-1234.908] (-1233.937) (-1239.833) (-1235.842) -- 0:00:52 37000 -- [-1241.178] (-1242.875) (-1239.664) (-1236.776) * [-1235.513] (-1233.390) (-1238.343) (-1237.343) -- 0:00:52 37500 -- (-1240.260) (-1252.374) (-1241.429) [-1235.752] * [-1235.546] (-1235.518) (-1237.723) (-1236.430) -- 0:00:51 38000 -- (-1240.677) (-1242.665) [-1241.549] (-1235.949) * (-1235.744) (-1233.796) [-1234.810] (-1235.693) -- 0:00:50 38500 -- (-1240.751) (-1238.640) [-1233.552] (-1236.589) * (-1237.878) (-1233.343) (-1237.066) [-1234.668] -- 0:00:49 39000 -- (-1236.314) [-1238.691] (-1269.582) (-1237.953) * (-1242.660) (-1234.242) (-1234.866) [-1235.258] -- 0:00:49 39500 -- (-1237.178) [-1239.416] (-1246.052) (-1236.813) * (-1235.847) [-1233.798] (-1234.655) (-1235.117) -- 0:00:48 40000 -- (-1245.588) [-1233.846] (-1257.223) (-1237.554) * [-1233.913] (-1235.722) (-1236.783) (-1235.503) -- 0:00:48 Average standard deviation of split frequencies: 0.039657 40500 -- (-1242.362) (-1241.639) (-1241.185) [-1235.966] * (-1234.162) (-1236.177) (-1237.224) [-1234.888] -- 0:00:47 41000 -- (-1240.419) [-1237.431] (-1236.890) (-1235.736) * (-1233.578) [-1238.974] (-1235.227) (-1234.064) -- 0:01:10 41500 -- (-1245.627) (-1238.729) [-1236.073] (-1236.042) * [-1233.829] (-1238.771) (-1234.936) (-1234.624) -- 0:01:09 42000 -- (-1245.945) [-1234.986] (-1235.097) (-1239.943) * [-1239.151] (-1237.505) (-1235.852) (-1236.419) -- 0:01:08 42500 -- (-1241.209) (-1237.969) [-1238.349] (-1235.768) * [-1236.969] (-1237.210) (-1236.522) (-1236.127) -- 0:01:07 43000 -- [-1237.001] (-1244.849) (-1242.783) (-1235.622) * [-1233.949] (-1236.478) (-1235.976) (-1233.976) -- 0:01:06 43500 -- [-1241.758] (-1238.860) (-1236.859) (-1236.752) * [-1233.738] (-1238.446) (-1239.185) (-1233.899) -- 0:01:05 44000 -- [-1235.792] (-1240.112) (-1236.925) (-1238.135) * [-1233.325] (-1237.820) (-1240.045) (-1234.617) -- 0:01:05 44500 -- (-1248.132) [-1238.952] (-1237.379) (-1238.536) * (-1235.429) (-1239.682) (-1233.959) [-1233.809] -- 0:01:04 45000 -- [-1240.265] (-1238.211) (-1237.059) (-1233.684) * (-1234.924) (-1235.711) (-1233.510) [-1236.606] -- 0:01:03 Average standard deviation of split frequencies: 0.035868 45500 -- (-1238.786) [-1241.359] (-1236.041) (-1235.567) * (-1237.046) (-1236.442) [-1234.048] (-1236.647) -- 0:01:02 46000 -- (-1240.917) [-1235.202] (-1239.234) (-1236.417) * [-1234.080] (-1233.742) (-1235.167) (-1234.489) -- 0:01:02 46500 -- (-1241.081) (-1239.518) (-1236.139) [-1236.490] * (-1235.384) (-1236.728) [-1234.135] (-1232.688) -- 0:01:01 47000 -- (-1237.845) [-1240.464] (-1236.852) (-1237.888) * (-1235.889) (-1234.390) [-1235.745] (-1236.814) -- 0:01:00 47500 -- (-1238.811) [-1242.676] (-1237.864) (-1235.516) * (-1240.041) (-1234.297) [-1231.862] (-1234.821) -- 0:01:00 48000 -- [-1239.134] (-1240.718) (-1234.885) (-1235.423) * (-1238.323) (-1234.625) [-1236.550] (-1236.312) -- 0:00:59 48500 -- [-1244.312] (-1245.826) (-1237.654) (-1235.714) * (-1244.713) (-1235.531) (-1238.409) [-1235.206] -- 0:00:58 49000 -- [-1237.464] (-1235.652) (-1237.259) (-1236.358) * [-1237.796] (-1239.661) (-1236.319) (-1235.355) -- 0:00:58 49500 -- (-1238.919) (-1242.157) [-1236.940] (-1234.714) * (-1234.550) [-1236.897] (-1236.156) (-1236.101) -- 0:00:57 50000 -- [-1242.475] (-1244.714) (-1236.888) (-1238.896) * [-1235.578] (-1234.505) (-1244.115) (-1239.062) -- 0:00:57 Average standard deviation of split frequencies: 0.035149 50500 -- [-1241.278] (-1242.554) (-1237.008) (-1235.441) * (-1235.379) (-1237.759) [-1238.062] (-1236.765) -- 0:00:56 51000 -- (-1245.671) [-1238.483] (-1244.335) (-1238.803) * (-1237.496) (-1236.550) [-1237.252] (-1234.661) -- 0:00:55 51500 -- (-1244.801) (-1238.012) (-1233.588) [-1236.457] * [-1234.696] (-1234.586) (-1234.925) (-1234.510) -- 0:00:55 52000 -- (-1234.045) [-1233.860] (-1235.886) (-1239.331) * [-1232.943] (-1237.033) (-1233.008) (-1237.665) -- 0:00:54 52500 -- (-1238.301) [-1245.708] (-1234.725) (-1234.879) * [-1236.987] (-1235.524) (-1235.245) (-1233.424) -- 0:00:54 53000 -- [-1238.827] (-1236.441) (-1235.974) (-1235.207) * (-1236.241) (-1234.324) (-1234.904) [-1235.575] -- 0:00:53 53500 -- (-1242.526) [-1236.702] (-1237.522) (-1235.014) * (-1236.943) [-1235.268] (-1237.629) (-1234.585) -- 0:00:53 54000 -- (-1242.216) [-1242.990] (-1235.789) (-1235.947) * [-1234.529] (-1234.823) (-1236.216) (-1238.458) -- 0:00:52 54500 -- (-1242.241) [-1238.046] (-1234.392) (-1237.846) * (-1234.471) (-1235.479) [-1234.485] (-1240.326) -- 0:00:52 55000 -- [-1240.537] (-1238.132) (-1235.959) (-1238.558) * (-1235.013) [-1235.429] (-1237.946) (-1236.936) -- 0:00:51 Average standard deviation of split frequencies: 0.034115 55500 -- [-1233.161] (-1256.919) (-1235.371) (-1236.086) * (-1235.805) (-1234.355) [-1235.275] (-1235.308) -- 0:00:51 56000 -- (-1238.522) (-1238.165) [-1235.608] (-1238.139) * (-1236.160) [-1236.993] (-1233.745) (-1236.893) -- 0:01:07 56500 -- [-1238.036] (-1234.496) (-1236.481) (-1236.692) * (-1235.560) (-1233.763) (-1238.063) [-1235.190] -- 0:01:06 57000 -- [-1235.862] (-1237.816) (-1236.470) (-1236.027) * (-1233.723) (-1234.503) (-1233.827) [-1234.008] -- 0:01:06 57500 -- (-1243.101) (-1234.637) [-1235.296] (-1236.688) * (-1235.344) (-1235.858) (-1238.323) [-1233.498] -- 0:01:05 58000 -- [-1250.006] (-1236.907) (-1236.758) (-1237.856) * (-1234.456) (-1238.031) [-1237.710] (-1237.935) -- 0:01:04 58500 -- (-1241.519) (-1240.177) [-1236.030] (-1237.013) * [-1234.857] (-1242.884) (-1240.358) (-1238.012) -- 0:01:04 59000 -- [-1237.330] (-1236.843) (-1236.512) (-1239.438) * (-1238.541) (-1235.921) [-1232.649] (-1234.150) -- 0:01:03 59500 -- [-1239.086] (-1236.843) (-1235.670) (-1236.455) * (-1234.939) (-1237.329) [-1235.487] (-1233.709) -- 0:01:03 60000 -- (-1243.277) [-1234.585] (-1234.544) (-1235.698) * (-1237.218) (-1241.194) [-1235.752] (-1235.251) -- 0:01:02 Average standard deviation of split frequencies: 0.031900 60500 -- [-1232.759] (-1233.815) (-1232.974) (-1239.312) * (-1238.446) [-1233.078] (-1236.355) (-1236.205) -- 0:01:02 61000 -- (-1237.585) [-1234.562] (-1234.493) (-1234.006) * (-1236.827) [-1233.289] (-1237.646) (-1243.041) -- 0:01:01 61500 -- (-1249.535) (-1235.014) [-1235.259] (-1235.039) * (-1236.752) (-1233.040) (-1238.207) [-1238.035] -- 0:01:01 62000 -- [-1239.065] (-1236.643) (-1235.184) (-1234.714) * (-1234.272) (-1236.156) [-1237.957] (-1237.046) -- 0:01:00 62500 -- (-1244.655) (-1234.872) (-1234.550) [-1234.637] * (-1236.505) (-1234.920) [-1236.345] (-1236.427) -- 0:01:00 63000 -- (-1242.199) (-1233.359) [-1237.270] (-1232.919) * (-1237.828) [-1236.612] (-1236.311) (-1235.023) -- 0:00:59 63500 -- (-1238.554) (-1233.045) [-1241.120] (-1234.802) * [-1236.941] (-1233.319) (-1237.133) (-1236.313) -- 0:00:58 64000 -- [-1239.953] (-1235.257) (-1239.536) (-1239.989) * (-1240.444) [-1233.156] (-1235.266) (-1237.861) -- 0:00:58 64500 -- (-1246.779) [-1235.461] (-1235.775) (-1236.635) * [-1238.974] (-1234.633) (-1236.912) (-1237.163) -- 0:00:58 65000 -- (-1240.404) [-1236.847] (-1236.061) (-1236.686) * (-1240.290) [-1232.905] (-1233.280) (-1237.314) -- 0:00:57 Average standard deviation of split frequencies: 0.030450 65500 -- (-1244.654) (-1237.833) (-1234.103) [-1236.729] * (-1238.546) [-1236.427] (-1234.556) (-1236.216) -- 0:00:57 66000 -- (-1236.114) (-1240.192) [-1234.375] (-1243.810) * (-1236.146) (-1236.951) (-1234.447) [-1236.227] -- 0:00:56 66500 -- (-1237.158) (-1243.011) [-1235.758] (-1236.475) * (-1240.636) (-1234.574) (-1234.931) [-1237.462] -- 0:00:56 67000 -- [-1243.812] (-1236.859) (-1235.940) (-1237.189) * (-1236.522) (-1235.283) [-1237.173] (-1236.158) -- 0:00:55 67500 -- (-1233.818) (-1237.723) [-1236.845] (-1236.354) * (-1237.378) [-1232.891] (-1237.000) (-1233.608) -- 0:00:55 68000 -- (-1235.111) (-1238.455) (-1235.362) [-1236.421] * (-1236.766) (-1235.655) (-1237.069) [-1237.541] -- 0:00:54 68500 -- (-1235.010) (-1237.481) [-1235.014] (-1236.157) * (-1237.284) (-1233.925) (-1239.574) [-1236.266] -- 0:00:54 69000 -- (-1235.958) (-1239.378) (-1234.524) [-1235.338] * (-1236.862) (-1235.467) (-1241.592) [-1238.150] -- 0:00:53 69500 -- (-1236.443) (-1237.586) (-1236.654) [-1234.557] * (-1236.346) (-1237.258) (-1237.924) [-1241.190] -- 0:00:53 70000 -- (-1233.990) (-1236.043) [-1236.140] (-1235.699) * (-1237.277) (-1234.416) (-1234.322) [-1233.706] -- 0:00:53 Average standard deviation of split frequencies: 0.030545 70500 -- (-1238.934) (-1236.632) (-1235.187) [-1234.524] * (-1242.717) [-1238.669] (-1237.054) (-1238.169) -- 0:01:05 71000 -- (-1240.831) (-1235.582) (-1236.222) [-1235.930] * (-1236.700) (-1239.218) (-1236.273) [-1235.406] -- 0:01:05 71500 -- (-1233.840) (-1238.148) [-1237.132] (-1235.358) * (-1236.267) (-1235.280) [-1236.078] (-1244.704) -- 0:01:04 72000 -- [-1233.450] (-1237.086) (-1240.189) (-1235.132) * (-1235.565) [-1234.234] (-1237.330) (-1240.069) -- 0:01:04 72500 -- (-1234.150) (-1239.117) [-1235.380] (-1235.626) * (-1238.319) (-1235.081) (-1234.554) [-1236.122] -- 0:01:03 73000 -- (-1235.046) [-1239.986] (-1237.190) (-1238.310) * (-1237.855) (-1235.260) (-1241.037) [-1237.638] -- 0:01:03 73500 -- (-1235.595) (-1236.372) (-1237.050) [-1238.169] * (-1234.824) (-1233.882) [-1240.956] (-1237.278) -- 0:01:03 74000 -- (-1236.004) (-1238.111) [-1236.238] (-1236.615) * (-1236.386) (-1234.257) [-1236.331] (-1237.297) -- 0:01:02 74500 -- [-1234.590] (-1235.739) (-1236.367) (-1238.410) * (-1235.067) (-1233.750) (-1237.411) [-1234.411] -- 0:01:02 75000 -- (-1238.523) (-1235.529) (-1236.829) [-1235.301] * (-1235.628) [-1238.740] (-1237.509) (-1234.651) -- 0:01:01 Average standard deviation of split frequencies: 0.029708 75500 -- (-1233.360) (-1235.446) [-1235.314] (-1237.021) * (-1235.109) (-1239.217) (-1235.091) [-1234.571] -- 0:01:01 76000 -- [-1236.896] (-1237.407) (-1239.088) (-1235.173) * (-1236.026) (-1235.915) (-1238.296) [-1234.140] -- 0:01:00 76500 -- (-1235.864) (-1238.752) (-1236.356) [-1239.287] * [-1240.900] (-1235.867) (-1235.026) (-1238.536) -- 0:01:00 77000 -- (-1235.408) (-1235.034) [-1234.691] (-1238.708) * (-1235.072) [-1235.524] (-1237.548) (-1240.865) -- 0:00:59 77500 -- (-1237.380) (-1235.713) (-1236.866) [-1235.108] * (-1235.673) (-1235.437) (-1236.443) [-1238.459] -- 0:00:59 78000 -- [-1236.497] (-1236.302) (-1237.520) (-1235.767) * (-1237.009) (-1233.902) (-1236.929) [-1237.769] -- 0:00:59 78500 -- (-1234.385) (-1235.697) (-1235.812) [-1235.210] * (-1236.811) (-1234.652) (-1236.457) [-1240.045] -- 0:00:58 79000 -- (-1233.129) (-1236.995) [-1235.139] (-1234.774) * (-1237.259) [-1234.851] (-1235.081) (-1236.942) -- 0:00:58 79500 -- (-1235.161) (-1239.501) [-1233.935] (-1234.714) * (-1236.975) (-1236.845) (-1236.303) [-1236.370] -- 0:00:57 80000 -- (-1237.888) (-1238.300) [-1238.318] (-1236.299) * (-1233.993) (-1235.425) [-1236.041] (-1235.865) -- 0:00:57 Average standard deviation of split frequencies: 0.031065 80500 -- (-1237.080) (-1237.778) [-1235.172] (-1235.295) * (-1232.980) (-1234.948) (-1235.880) [-1235.977] -- 0:00:57 81000 -- (-1235.331) (-1236.504) [-1235.036] (-1235.103) * (-1233.370) (-1235.878) [-1238.187] (-1236.252) -- 0:00:56 81500 -- (-1236.020) [-1234.874] (-1235.675) (-1236.184) * (-1237.477) (-1239.054) [-1237.101] (-1235.062) -- 0:00:56 82000 -- (-1235.244) [-1233.459] (-1237.049) (-1237.863) * (-1236.881) [-1233.993] (-1237.573) (-1239.079) -- 0:00:55 82500 -- (-1236.503) (-1238.417) (-1234.843) [-1236.479] * (-1234.547) (-1234.191) [-1237.943] (-1232.746) -- 0:00:55 83000 -- (-1237.991) [-1235.942] (-1235.666) (-1235.729) * (-1234.927) (-1234.725) [-1235.983] (-1235.011) -- 0:00:55 83500 -- (-1237.635) (-1236.326) (-1236.574) [-1237.012] * (-1236.663) (-1237.002) (-1237.368) [-1241.170] -- 0:00:54 84000 -- (-1233.218) (-1238.404) (-1239.621) [-1235.515] * (-1238.100) (-1235.508) [-1238.207] (-1236.618) -- 0:00:54 84500 -- [-1232.806] (-1237.256) (-1235.288) (-1236.971) * (-1237.726) [-1235.149] (-1237.411) (-1236.752) -- 0:00:54 85000 -- [-1237.507] (-1234.128) (-1232.555) (-1232.638) * (-1237.959) (-1234.771) [-1236.555] (-1236.299) -- 0:00:53 Average standard deviation of split frequencies: 0.027407 85500 -- (-1241.232) (-1237.013) (-1234.707) [-1233.870] * (-1239.952) (-1236.169) (-1236.750) [-1237.304] -- 0:01:04 86000 -- (-1235.943) [-1235.119] (-1234.386) (-1235.191) * (-1236.860) [-1235.038] (-1241.013) (-1236.183) -- 0:01:03 86500 -- (-1236.837) [-1235.131] (-1233.561) (-1236.081) * [-1234.964] (-1234.547) (-1239.130) (-1233.363) -- 0:01:03 87000 -- (-1236.657) (-1234.653) [-1238.943] (-1236.883) * (-1234.875) [-1234.927] (-1238.367) (-1234.743) -- 0:01:02 87500 -- (-1236.017) (-1237.672) (-1235.712) [-1235.498] * [-1237.965] (-1238.950) (-1237.256) (-1234.564) -- 0:01:02 88000 -- (-1236.717) [-1238.081] (-1236.582) (-1238.050) * (-1237.299) (-1237.847) (-1235.511) [-1236.280] -- 0:01:02 88500 -- (-1240.272) (-1233.983) [-1235.754] (-1235.675) * (-1236.541) (-1234.988) [-1235.421] (-1236.095) -- 0:01:01 89000 -- [-1236.767] (-1232.680) (-1233.900) (-1234.916) * [-1235.906] (-1235.625) (-1237.416) (-1235.172) -- 0:01:01 89500 -- (-1237.928) [-1234.860] (-1236.348) (-1237.539) * (-1236.740) (-1235.080) (-1237.858) [-1237.471] -- 0:01:01 90000 -- (-1237.334) (-1235.957) (-1234.912) [-1236.212] * (-1238.565) [-1236.234] (-1238.515) (-1239.663) -- 0:01:00 Average standard deviation of split frequencies: 0.025997 90500 -- (-1235.133) (-1233.825) [-1236.706] (-1236.718) * (-1235.125) (-1238.693) (-1237.399) [-1236.937] -- 0:01:00 91000 -- [-1236.237] (-1234.809) (-1235.144) (-1235.744) * (-1238.924) (-1240.170) [-1234.609] (-1240.719) -- 0:00:59 91500 -- (-1238.293) (-1236.320) [-1235.775] (-1235.579) * (-1233.453) [-1236.331] (-1235.914) (-1247.418) -- 0:00:59 92000 -- (-1237.368) [-1233.637] (-1235.159) (-1236.440) * (-1235.613) [-1235.061] (-1238.152) (-1246.712) -- 0:00:59 92500 -- (-1239.821) [-1234.092] (-1238.978) (-1234.661) * [-1234.712] (-1235.250) (-1236.565) (-1236.828) -- 0:00:58 93000 -- (-1236.919) (-1233.728) [-1240.206] (-1237.401) * (-1237.094) (-1234.658) [-1238.047] (-1235.464) -- 0:00:58 93500 -- (-1234.447) (-1241.465) [-1235.340] (-1237.042) * (-1233.792) [-1235.357] (-1237.391) (-1234.333) -- 0:00:58 94000 -- [-1234.230] (-1235.386) (-1235.846) (-1237.004) * [-1237.620] (-1235.281) (-1238.855) (-1235.951) -- 0:00:57 94500 -- [-1236.898] (-1235.899) (-1238.897) (-1235.096) * (-1234.389) (-1235.698) [-1237.384] (-1239.043) -- 0:00:57 95000 -- (-1234.558) [-1236.044] (-1236.052) (-1235.813) * (-1236.900) [-1239.418] (-1243.101) (-1235.502) -- 0:00:57 Average standard deviation of split frequencies: 0.022743 95500 -- (-1234.764) (-1234.305) (-1237.003) [-1238.115] * (-1236.764) (-1235.661) [-1235.415] (-1235.101) -- 0:00:56 96000 -- (-1235.933) (-1233.683) [-1239.045] (-1235.448) * (-1235.940) [-1234.703] (-1236.533) (-1235.966) -- 0:00:56 96500 -- (-1235.713) (-1236.239) [-1236.960] (-1240.095) * (-1240.720) (-1235.053) (-1237.200) [-1234.938] -- 0:00:56 97000 -- (-1234.201) (-1237.698) [-1232.697] (-1237.423) * (-1236.860) (-1236.998) [-1236.821] (-1235.754) -- 0:00:55 97500 -- (-1239.696) [-1236.855] (-1234.300) (-1236.930) * [-1236.888] (-1237.584) (-1238.680) (-1239.508) -- 0:00:55 98000 -- (-1236.251) (-1236.809) [-1236.076] (-1234.225) * (-1236.730) (-1236.034) (-1233.930) [-1235.212] -- 0:00:55 98500 -- (-1235.743) [-1234.685] (-1235.445) (-1236.338) * (-1236.505) (-1235.924) (-1235.577) [-1234.832] -- 0:00:54 99000 -- (-1238.587) [-1232.855] (-1243.138) (-1235.432) * (-1238.083) (-1236.363) [-1236.374] (-1235.191) -- 0:00:54 99500 -- [-1240.505] (-1234.314) (-1234.803) (-1235.706) * (-1236.131) [-1233.775] (-1240.755) (-1235.024) -- 0:00:54 100000 -- (-1242.021) [-1234.734] (-1235.114) (-1236.138) * (-1235.723) [-1234.380] (-1239.534) (-1234.838) -- 0:00:54 Average standard deviation of split frequencies: 0.023934 100500 -- (-1235.586) [-1234.532] (-1234.595) (-1240.647) * (-1235.501) (-1235.689) (-1234.848) [-1237.109] -- 0:01:02 101000 -- [-1233.866] (-1239.420) (-1236.399) (-1235.317) * (-1235.669) (-1241.843) (-1236.005) [-1235.741] -- 0:01:02 101500 -- (-1237.328) (-1235.414) [-1235.488] (-1235.101) * (-1237.041) (-1239.459) (-1234.719) [-1235.157] -- 0:01:01 102000 -- (-1237.064) (-1234.935) (-1235.661) [-1234.948] * (-1235.381) (-1234.105) (-1235.427) [-1233.082] -- 0:01:01 102500 -- [-1237.200] (-1234.601) (-1237.029) (-1235.355) * (-1234.614) [-1235.054] (-1235.087) (-1237.210) -- 0:01:01 103000 -- (-1235.902) (-1239.622) (-1239.443) [-1237.841] * (-1234.642) (-1236.620) (-1236.349) [-1235.466] -- 0:01:00 103500 -- (-1237.116) [-1235.692] (-1234.574) (-1235.751) * (-1233.206) [-1235.281] (-1236.496) (-1238.186) -- 0:01:00 104000 -- (-1234.294) [-1234.554] (-1236.260) (-1235.431) * [-1238.134] (-1235.811) (-1236.878) (-1238.292) -- 0:01:00 104500 -- (-1235.485) (-1234.248) [-1238.192] (-1236.474) * (-1234.638) [-1237.574] (-1237.976) (-1239.575) -- 0:00:59 105000 -- [-1238.087] (-1236.066) (-1235.634) (-1235.020) * [-1236.633] (-1235.002) (-1235.628) (-1239.591) -- 0:00:59 Average standard deviation of split frequencies: 0.024015 105500 -- (-1237.012) (-1234.178) (-1234.867) [-1237.037] * (-1240.326) (-1237.323) [-1236.602] (-1239.264) -- 0:00:59 106000 -- (-1236.473) (-1235.372) (-1237.107) [-1235.117] * (-1237.650) [-1234.510] (-1236.497) (-1235.868) -- 0:00:59 106500 -- (-1236.517) (-1235.204) (-1233.336) [-1233.688] * (-1237.176) [-1237.711] (-1234.511) (-1235.341) -- 0:00:58 107000 -- [-1233.898] (-1234.820) (-1236.463) (-1235.640) * [-1237.021] (-1238.024) (-1233.118) (-1237.896) -- 0:00:58 107500 -- [-1234.670] (-1236.667) (-1236.526) (-1236.415) * (-1238.900) [-1235.080] (-1235.220) (-1235.946) -- 0:00:58 108000 -- (-1233.601) [-1234.579] (-1238.682) (-1240.483) * (-1237.518) [-1235.359] (-1239.395) (-1239.182) -- 0:00:57 108500 -- [-1234.484] (-1240.424) (-1236.038) (-1237.745) * (-1237.577) (-1233.861) (-1233.312) [-1237.879] -- 0:00:57 109000 -- (-1239.852) [-1236.842] (-1237.145) (-1236.785) * (-1241.620) (-1235.039) [-1234.238] (-1235.788) -- 0:00:57 109500 -- (-1236.035) (-1238.836) (-1237.078) [-1238.654] * (-1236.523) [-1233.602] (-1235.728) (-1237.071) -- 0:00:56 110000 -- (-1234.058) (-1235.814) (-1236.899) [-1236.841] * (-1237.273) [-1235.496] (-1236.072) (-1234.755) -- 0:00:56 Average standard deviation of split frequencies: 0.023854 110500 -- [-1235.127] (-1234.705) (-1235.090) (-1238.753) * (-1234.673) (-1233.478) [-1234.107] (-1235.528) -- 0:00:56 111000 -- [-1236.865] (-1235.658) (-1235.128) (-1237.258) * (-1237.737) [-1233.936] (-1234.768) (-1238.146) -- 0:00:56 111500 -- (-1237.041) (-1235.373) [-1233.676] (-1239.440) * [-1234.438] (-1235.633) (-1235.310) (-1236.583) -- 0:00:55 112000 -- (-1234.319) [-1236.824] (-1235.979) (-1235.076) * [-1236.029] (-1237.009) (-1236.209) (-1236.785) -- 0:00:55 112500 -- [-1234.726] (-1238.377) (-1235.235) (-1235.332) * (-1235.727) (-1240.046) (-1235.716) [-1235.627] -- 0:00:55 113000 -- [-1236.098] (-1237.457) (-1236.136) (-1234.737) * (-1235.480) [-1235.008] (-1235.642) (-1237.456) -- 0:00:54 113500 -- [-1233.962] (-1236.489) (-1239.195) (-1234.350) * (-1235.807) (-1235.555) [-1235.907] (-1235.539) -- 0:00:54 114000 -- (-1237.151) [-1235.141] (-1234.695) (-1233.956) * (-1234.838) (-1237.955) (-1234.511) [-1234.190] -- 0:00:54 114500 -- (-1235.625) (-1236.226) (-1236.941) [-1234.132] * [-1235.729] (-1243.417) (-1237.614) (-1237.756) -- 0:00:54 115000 -- (-1235.910) (-1240.697) (-1240.426) [-1235.189] * [-1235.133] (-1242.176) (-1234.348) (-1237.188) -- 0:00:53 Average standard deviation of split frequencies: 0.020771 115500 -- [-1233.304] (-1234.604) (-1241.161) (-1235.346) * (-1233.856) (-1238.679) [-1239.180] (-1239.056) -- 0:01:01 116000 -- (-1235.872) [-1234.672] (-1236.509) (-1236.021) * [-1237.744] (-1235.418) (-1237.569) (-1240.912) -- 0:01:00 116500 -- [-1235.807] (-1233.285) (-1237.259) (-1236.007) * (-1238.974) [-1235.544] (-1239.161) (-1239.650) -- 0:01:00 117000 -- (-1234.972) (-1234.298) (-1237.034) [-1235.133] * (-1236.429) (-1233.277) [-1236.451] (-1235.298) -- 0:01:00 117500 -- [-1238.016] (-1240.835) (-1234.615) (-1235.230) * [-1236.867] (-1234.899) (-1238.970) (-1233.999) -- 0:01:00 118000 -- (-1236.802) (-1235.138) [-1236.960] (-1235.555) * (-1235.529) [-1235.343] (-1238.370) (-1234.336) -- 0:00:59 118500 -- [-1234.005] (-1233.745) (-1234.035) (-1234.216) * (-1244.844) (-1238.004) [-1237.274] (-1235.892) -- 0:00:59 119000 -- (-1233.375) (-1235.215) (-1234.907) [-1234.790] * (-1246.409) (-1238.662) [-1235.479] (-1235.862) -- 0:00:59 119500 -- (-1234.842) [-1235.316] (-1235.382) (-1235.127) * (-1234.409) (-1239.247) [-1237.542] (-1240.505) -- 0:00:58 120000 -- (-1237.153) [-1233.585] (-1235.297) (-1235.564) * [-1236.400] (-1236.563) (-1235.307) (-1232.400) -- 0:00:58 Average standard deviation of split frequencies: 0.022206 120500 -- (-1237.837) (-1236.254) (-1238.424) [-1236.962] * (-1234.815) (-1237.076) (-1242.033) [-1233.296] -- 0:00:58 121000 -- (-1236.014) [-1238.662] (-1235.958) (-1237.301) * (-1234.679) (-1240.239) [-1241.689] (-1236.117) -- 0:00:58 121500 -- (-1236.093) (-1233.472) (-1238.386) [-1238.164] * [-1234.993] (-1239.219) (-1236.691) (-1235.730) -- 0:00:57 122000 -- [-1234.789] (-1232.663) (-1236.020) (-1236.410) * (-1237.472) (-1241.040) [-1236.383] (-1236.385) -- 0:00:57 122500 -- [-1235.409] (-1234.061) (-1234.305) (-1238.585) * [-1234.248] (-1234.901) (-1236.363) (-1237.894) -- 0:00:57 123000 -- (-1235.233) [-1234.367] (-1234.307) (-1238.908) * (-1238.658) (-1236.256) (-1236.284) [-1236.684] -- 0:00:57 123500 -- (-1235.019) [-1235.105] (-1234.548) (-1235.166) * (-1235.342) (-1236.412) (-1234.258) [-1235.247] -- 0:00:56 124000 -- [-1235.126] (-1235.594) (-1233.836) (-1238.353) * (-1235.566) (-1237.719) (-1236.824) [-1236.058] -- 0:00:56 124500 -- (-1236.466) [-1234.348] (-1236.214) (-1238.742) * (-1234.823) [-1238.071] (-1238.470) (-1237.232) -- 0:00:56 125000 -- (-1237.013) (-1232.504) (-1235.385) [-1238.652] * (-1237.306) (-1234.881) (-1235.035) [-1234.668] -- 0:00:56 Average standard deviation of split frequencies: 0.021700 125500 -- [-1236.882] (-1234.737) (-1238.584) (-1235.518) * (-1240.038) (-1238.065) (-1233.997) [-1233.790] -- 0:00:55 126000 -- (-1238.133) [-1233.776] (-1236.247) (-1235.908) * (-1237.468) [-1237.304] (-1234.661) (-1234.030) -- 0:00:55 126500 -- (-1237.728) (-1234.375) [-1238.090] (-1235.512) * (-1237.886) (-1238.134) (-1234.893) [-1234.504] -- 0:00:55 127000 -- [-1237.512] (-1235.006) (-1238.141) (-1235.748) * [-1234.831] (-1240.076) (-1235.344) (-1238.518) -- 0:00:54 127500 -- (-1236.167) (-1237.653) (-1238.818) [-1235.747] * (-1237.311) (-1236.905) [-1235.144] (-1237.475) -- 0:00:54 128000 -- [-1238.198] (-1236.837) (-1238.282) (-1235.677) * (-1236.480) [-1236.036] (-1237.475) (-1236.504) -- 0:00:54 128500 -- (-1236.953) [-1237.353] (-1239.348) (-1234.861) * (-1235.812) (-1235.803) (-1237.778) [-1236.647] -- 0:00:54 129000 -- (-1238.786) (-1233.589) (-1234.832) [-1234.118] * (-1235.754) (-1238.391) [-1234.173] (-1238.546) -- 0:00:54 129500 -- (-1239.166) [-1233.807] (-1234.998) (-1236.102) * [-1237.103] (-1234.490) (-1235.903) (-1242.863) -- 0:00:53 130000 -- (-1235.039) (-1235.998) (-1235.329) [-1234.688] * [-1236.969] (-1234.707) (-1237.938) (-1236.857) -- 0:01:00 Average standard deviation of split frequencies: 0.021827 130500 -- (-1238.760) [-1235.918] (-1237.290) (-1238.673) * [-1233.918] (-1234.497) (-1236.562) (-1238.194) -- 0:00:59 131000 -- (-1235.683) (-1238.684) [-1239.794] (-1235.572) * (-1233.034) (-1234.277) [-1235.032] (-1238.732) -- 0:00:59 131500 -- [-1234.619] (-1237.639) (-1235.147) (-1237.214) * (-1234.953) (-1236.033) (-1241.297) [-1236.625] -- 0:00:59 132000 -- [-1235.319] (-1239.822) (-1236.126) (-1236.807) * (-1235.612) (-1234.446) [-1234.378] (-1235.592) -- 0:00:59 132500 -- (-1236.345) (-1238.343) (-1237.649) [-1234.902] * (-1236.158) [-1236.633] (-1235.858) (-1236.069) -- 0:00:58 133000 -- [-1235.318] (-1236.124) (-1233.988) (-1236.093) * [-1235.594] (-1236.335) (-1235.107) (-1234.623) -- 0:00:58 133500 -- (-1237.234) [-1233.759] (-1237.203) (-1235.780) * (-1237.320) (-1235.881) (-1236.281) [-1236.778] -- 0:00:58 134000 -- [-1236.257] (-1235.302) (-1239.022) (-1238.376) * (-1240.602) (-1236.338) (-1234.907) [-1235.464] -- 0:00:58 134500 -- (-1239.982) (-1235.792) (-1235.863) [-1235.653] * (-1235.049) (-1236.450) (-1235.647) [-1236.433] -- 0:00:57 135000 -- (-1236.423) (-1234.130) [-1235.328] (-1235.397) * (-1235.428) (-1235.852) (-1244.039) [-1237.476] -- 0:00:57 Average standard deviation of split frequencies: 0.022010 135500 -- (-1235.235) (-1239.117) (-1234.506) [-1235.764] * (-1235.299) (-1235.831) [-1244.031] (-1236.482) -- 0:00:57 136000 -- [-1236.806] (-1236.097) (-1234.334) (-1235.518) * (-1238.073) (-1238.921) [-1235.596] (-1234.967) -- 0:00:57 136500 -- (-1240.689) (-1234.832) [-1234.107] (-1238.962) * (-1238.566) (-1236.302) [-1236.712] (-1234.878) -- 0:00:56 137000 -- (-1241.930) [-1235.205] (-1235.853) (-1239.035) * [-1235.563] (-1235.617) (-1236.916) (-1234.571) -- 0:00:56 137500 -- (-1238.452) (-1235.603) [-1234.608] (-1236.821) * (-1236.274) (-1234.644) [-1234.626] (-1235.407) -- 0:00:56 138000 -- (-1234.031) (-1234.601) (-1235.140) [-1234.578] * [-1235.757] (-1236.757) (-1235.892) (-1234.538) -- 0:00:56 138500 -- (-1235.262) (-1238.885) [-1233.599] (-1234.525) * (-1236.523) [-1235.717] (-1236.669) (-1234.690) -- 0:00:55 139000 -- (-1236.579) (-1237.146) [-1234.129] (-1236.851) * [-1235.135] (-1235.134) (-1237.944) (-1235.465) -- 0:00:55 139500 -- (-1236.975) (-1235.777) (-1234.305) [-1237.676] * (-1238.843) (-1235.163) [-1236.243] (-1237.741) -- 0:00:55 140000 -- (-1234.502) (-1236.552) (-1232.835) [-1236.149] * (-1235.233) (-1235.680) (-1235.337) [-1233.265] -- 0:00:55 Average standard deviation of split frequencies: 0.019049 140500 -- (-1238.572) (-1236.345) (-1234.463) [-1235.452] * (-1235.845) (-1237.401) [-1241.408] (-1235.240) -- 0:00:55 141000 -- (-1237.638) [-1235.774] (-1236.577) (-1235.188) * [-1235.532] (-1237.466) (-1240.619) (-1236.109) -- 0:00:54 141500 -- (-1234.692) (-1234.645) (-1240.289) [-1236.834] * [-1235.483] (-1237.067) (-1239.408) (-1236.210) -- 0:00:54 142000 -- (-1233.433) (-1236.687) [-1238.769] (-1236.553) * [-1236.991] (-1236.266) (-1236.821) (-1233.711) -- 0:00:54 142500 -- (-1233.222) (-1233.253) [-1237.612] (-1236.152) * (-1236.494) (-1240.774) [-1234.668] (-1236.816) -- 0:00:54 143000 -- (-1238.736) (-1233.843) [-1236.609] (-1238.147) * [-1234.027] (-1235.968) (-1235.808) (-1236.142) -- 0:00:53 143500 -- [-1233.258] (-1236.068) (-1234.711) (-1234.782) * (-1235.729) (-1235.272) (-1234.864) [-1235.574] -- 0:00:53 144000 -- (-1234.051) [-1236.199] (-1236.727) (-1235.641) * [-1236.130] (-1235.261) (-1233.480) (-1236.897) -- 0:00:53 144500 -- [-1234.237] (-1233.890) (-1238.179) (-1235.465) * (-1233.927) [-1235.116] (-1234.427) (-1236.810) -- 0:00:53 145000 -- (-1235.721) (-1235.568) [-1235.479] (-1234.755) * (-1234.351) (-1235.484) [-1237.409] (-1233.893) -- 0:00:58 Average standard deviation of split frequencies: 0.016654 145500 -- [-1237.058] (-1239.854) (-1235.380) (-1235.146) * (-1240.493) [-1234.724] (-1235.670) (-1234.160) -- 0:00:58 146000 -- [-1236.229] (-1234.874) (-1232.903) (-1235.342) * (-1234.252) [-1235.809] (-1236.267) (-1234.073) -- 0:00:58 146500 -- (-1235.106) [-1233.603] (-1233.537) (-1236.192) * [-1236.562] (-1237.529) (-1235.405) (-1233.947) -- 0:00:58 147000 -- (-1241.047) (-1233.306) [-1237.922] (-1236.011) * (-1237.767) (-1237.516) (-1236.436) [-1233.695] -- 0:00:58 147500 -- (-1245.615) [-1235.723] (-1236.692) (-1236.869) * (-1237.271) (-1237.989) [-1236.414] (-1235.790) -- 0:00:57 148000 -- (-1241.262) (-1235.308) (-1238.917) [-1235.309] * (-1235.195) (-1237.333) (-1237.375) [-1234.667] -- 0:00:57 148500 -- (-1237.990) (-1234.828) [-1235.073] (-1237.532) * (-1234.551) [-1235.534] (-1237.126) (-1236.034) -- 0:00:57 149000 -- (-1232.537) (-1235.959) (-1236.286) [-1234.511] * (-1240.986) (-1237.936) (-1237.322) [-1236.123] -- 0:00:57 149500 -- (-1233.536) (-1236.013) [-1235.352] (-1234.986) * (-1233.619) (-1238.346) [-1235.102] (-1236.355) -- 0:00:56 150000 -- [-1236.936] (-1240.709) (-1236.400) (-1235.078) * (-1235.083) (-1238.658) (-1240.228) [-1233.811] -- 0:00:56 Average standard deviation of split frequencies: 0.017035 150500 -- [-1233.087] (-1236.662) (-1235.344) (-1235.775) * [-1236.232] (-1240.736) (-1237.276) (-1234.628) -- 0:00:56 151000 -- (-1233.535) (-1236.497) (-1235.701) [-1236.210] * (-1234.840) (-1238.862) [-1235.813] (-1233.336) -- 0:00:56 151500 -- (-1234.067) [-1239.922] (-1232.906) (-1236.748) * (-1234.314) (-1238.227) (-1234.265) [-1232.343] -- 0:00:56 152000 -- (-1238.435) (-1241.330) (-1234.099) [-1236.009] * (-1235.564) [-1235.398] (-1234.323) (-1234.752) -- 0:00:55 152500 -- (-1233.022) (-1239.093) [-1238.268] (-1236.614) * (-1234.476) (-1235.347) (-1235.557) [-1235.726] -- 0:00:55 153000 -- (-1234.729) (-1240.516) [-1239.626] (-1239.439) * (-1232.693) [-1236.092] (-1235.805) (-1235.550) -- 0:00:55 153500 -- [-1234.658] (-1241.985) (-1234.447) (-1235.600) * [-1232.967] (-1235.523) (-1233.776) (-1236.579) -- 0:00:55 154000 -- [-1238.671] (-1237.033) (-1237.336) (-1234.676) * (-1233.809) (-1236.943) [-1235.856] (-1236.786) -- 0:00:54 154500 -- (-1236.978) (-1239.804) [-1237.051] (-1235.946) * (-1233.222) [-1233.448] (-1236.776) (-1236.410) -- 0:00:54 155000 -- (-1237.056) (-1235.908) [-1235.455] (-1234.423) * (-1233.049) (-1239.444) (-1235.206) [-1236.519] -- 0:00:54 Average standard deviation of split frequencies: 0.016709 155500 -- (-1236.753) (-1240.229) (-1235.737) [-1234.286] * (-1237.649) (-1234.695) (-1234.225) [-1235.408] -- 0:00:54 156000 -- (-1234.837) (-1237.178) (-1234.769) [-1232.844] * (-1234.111) (-1234.351) (-1235.844) [-1237.914] -- 0:00:54 156500 -- (-1234.763) [-1235.362] (-1234.299) (-1235.108) * (-1237.969) (-1235.059) [-1236.968] (-1234.656) -- 0:00:53 157000 -- (-1235.795) (-1235.524) [-1235.063] (-1233.787) * (-1236.278) [-1235.775] (-1235.007) (-1238.841) -- 0:00:53 157500 -- (-1235.104) [-1235.163] (-1236.080) (-1236.552) * (-1236.130) [-1236.593] (-1237.682) (-1238.336) -- 0:00:53 158000 -- [-1236.210] (-1240.006) (-1236.732) (-1234.274) * [-1237.054] (-1235.524) (-1239.875) (-1232.343) -- 0:00:53 158500 -- (-1234.104) [-1237.110] (-1234.573) (-1234.888) * (-1235.515) (-1235.099) (-1237.999) [-1233.403] -- 0:00:53 159000 -- (-1238.472) [-1235.951] (-1235.763) (-1234.212) * (-1235.572) (-1235.092) (-1236.694) [-1236.795] -- 0:00:52 159500 -- (-1236.294) (-1234.766) [-1234.572] (-1235.253) * (-1235.340) (-1236.605) [-1235.821] (-1236.203) -- 0:00:52 160000 -- (-1242.064) (-1236.297) [-1234.267] (-1235.839) * (-1236.546) (-1239.004) [-1234.159] (-1236.176) -- 0:00:57 Average standard deviation of split frequencies: 0.016687 160500 -- (-1237.542) [-1236.847] (-1234.635) (-1239.384) * (-1236.968) (-1235.362) (-1238.527) [-1234.216] -- 0:00:57 161000 -- (-1238.388) (-1237.388) [-1237.764] (-1234.926) * (-1235.867) [-1234.871] (-1237.029) (-1238.370) -- 0:00:57 161500 -- (-1238.283) (-1237.015) [-1240.712] (-1234.960) * [-1233.793] (-1238.215) (-1237.859) (-1235.939) -- 0:00:57 162000 -- [-1235.792] (-1239.483) (-1234.949) (-1237.165) * (-1235.131) [-1236.601] (-1235.549) (-1235.428) -- 0:00:56 162500 -- (-1240.280) (-1235.865) (-1235.398) [-1235.863] * (-1234.361) [-1237.302] (-1235.261) (-1236.626) -- 0:00:56 163000 -- [-1234.034] (-1235.669) (-1234.495) (-1234.745) * [-1234.152] (-1237.184) (-1234.008) (-1235.854) -- 0:00:56 163500 -- (-1236.128) (-1236.788) (-1238.082) [-1234.972] * (-1232.863) [-1236.993] (-1238.803) (-1235.397) -- 0:00:56 164000 -- [-1235.602] (-1235.712) (-1239.991) (-1236.333) * [-1233.081] (-1237.915) (-1241.143) (-1239.141) -- 0:00:56 164500 -- (-1234.514) (-1235.523) [-1237.506] (-1233.844) * [-1233.492] (-1239.598) (-1238.505) (-1235.767) -- 0:00:55 165000 -- (-1235.915) (-1236.923) [-1237.893] (-1237.058) * (-1234.201) (-1235.340) [-1239.222] (-1236.514) -- 0:00:55 Average standard deviation of split frequencies: 0.017512 165500 -- [-1235.141] (-1235.547) (-1237.773) (-1239.928) * (-1237.121) [-1235.764] (-1237.483) (-1238.319) -- 0:00:55 166000 -- (-1235.850) (-1236.798) [-1235.107] (-1236.383) * (-1233.639) (-1235.658) [-1234.082] (-1236.380) -- 0:00:55 166500 -- (-1238.079) (-1238.387) (-1236.028) [-1235.301] * (-1235.211) (-1237.012) (-1235.308) [-1234.508] -- 0:00:55 167000 -- (-1235.781) (-1237.377) [-1234.256] (-1234.645) * (-1235.861) [-1236.634] (-1233.996) (-1238.093) -- 0:00:54 167500 -- (-1235.563) (-1237.356) [-1236.534] (-1236.131) * (-1233.644) (-1236.493) (-1236.508) [-1235.905] -- 0:00:54 168000 -- (-1234.879) (-1235.308) (-1236.004) [-1234.721] * (-1235.778) (-1233.737) [-1234.983] (-1236.247) -- 0:00:54 168500 -- (-1234.239) [-1235.912] (-1238.281) (-1237.128) * (-1237.712) (-1235.748) [-1235.784] (-1236.986) -- 0:00:54 169000 -- (-1237.924) (-1237.001) (-1237.581) [-1233.590] * (-1239.239) [-1234.183] (-1235.174) (-1237.321) -- 0:00:54 169500 -- (-1237.524) [-1235.722] (-1236.455) (-1232.281) * (-1234.905) (-1233.987) (-1233.754) [-1239.234] -- 0:00:53 170000 -- (-1236.540) [-1235.624] (-1238.180) (-1238.507) * [-1235.770] (-1244.800) (-1235.374) (-1240.604) -- 0:00:53 Average standard deviation of split frequencies: 0.017385 170500 -- [-1234.669] (-1242.949) (-1235.414) (-1235.649) * (-1238.158) (-1240.513) [-1236.130] (-1237.079) -- 0:00:53 171000 -- [-1237.419] (-1237.666) (-1235.087) (-1235.543) * [-1234.227] (-1239.622) (-1235.951) (-1238.237) -- 0:00:53 171500 -- (-1236.068) [-1236.234] (-1234.404) (-1234.141) * (-1235.201) (-1239.860) (-1234.600) [-1234.756] -- 0:00:53 172000 -- (-1235.565) (-1238.047) (-1234.652) [-1234.277] * (-1236.554) (-1234.371) [-1235.637] (-1240.976) -- 0:00:52 172500 -- (-1236.233) (-1234.623) (-1239.070) [-1232.628] * (-1239.116) (-1235.705) (-1239.380) [-1236.862] -- 0:00:52 173000 -- (-1238.153) (-1234.784) [-1235.932] (-1233.903) * (-1234.800) (-1238.615) (-1235.726) [-1236.120] -- 0:00:52 173500 -- (-1237.147) [-1235.473] (-1235.007) (-1234.329) * (-1233.267) (-1236.079) [-1236.253] (-1237.655) -- 0:00:52 174000 -- (-1236.506) (-1236.510) [-1235.987] (-1235.964) * (-1233.442) (-1236.275) (-1239.555) [-1233.496] -- 0:00:52 174500 -- (-1238.443) (-1240.249) [-1237.768] (-1235.109) * (-1236.877) (-1241.265) [-1239.799] (-1239.380) -- 0:00:52 175000 -- (-1238.315) (-1241.283) (-1236.624) [-1235.698] * (-1234.061) [-1233.725] (-1234.885) (-1238.432) -- 0:00:56 Average standard deviation of split frequencies: 0.016543 175500 -- (-1238.987) (-1234.794) (-1233.425) [-1234.832] * [-1233.307] (-1234.495) (-1235.622) (-1237.836) -- 0:00:56 176000 -- (-1239.669) [-1235.131] (-1236.388) (-1237.879) * (-1236.030) (-1239.385) [-1236.125] (-1237.536) -- 0:00:56 176500 -- (-1237.891) (-1234.811) (-1232.904) [-1236.777] * (-1236.627) (-1237.892) (-1234.144) [-1235.062] -- 0:00:55 177000 -- [-1234.948] (-1235.531) (-1234.042) (-1234.158) * (-1234.116) [-1235.552] (-1240.634) (-1235.181) -- 0:00:55 177500 -- [-1237.071] (-1239.785) (-1233.903) (-1234.875) * (-1237.280) (-1238.217) (-1238.165) [-1234.159] -- 0:00:55 178000 -- (-1235.955) (-1236.311) [-1232.403] (-1234.284) * (-1235.619) [-1237.497] (-1237.844) (-1234.608) -- 0:00:55 178500 -- (-1234.960) (-1234.517) [-1234.926] (-1237.101) * (-1238.536) (-1236.864) (-1234.688) [-1233.438] -- 0:00:55 179000 -- (-1234.903) (-1235.648) [-1234.818] (-1239.767) * (-1239.185) (-1235.502) (-1242.798) [-1234.621] -- 0:00:55 179500 -- (-1234.895) [-1235.658] (-1236.453) (-1235.966) * (-1236.923) [-1233.991] (-1236.206) (-1235.376) -- 0:00:54 180000 -- (-1237.561) (-1236.947) [-1234.198] (-1235.746) * (-1237.438) [-1235.192] (-1237.142) (-1237.909) -- 0:00:54 Average standard deviation of split frequencies: 0.017250 180500 -- (-1236.999) [-1233.414] (-1237.709) (-1239.620) * [-1234.351] (-1237.027) (-1237.935) (-1235.934) -- 0:00:54 181000 -- [-1236.345] (-1234.821) (-1232.577) (-1234.733) * (-1234.127) (-1236.616) (-1236.361) [-1235.210] -- 0:00:54 181500 -- (-1236.391) (-1239.753) (-1232.224) [-1235.725] * (-1235.527) (-1239.699) (-1235.324) [-1233.648] -- 0:00:54 182000 -- [-1234.508] (-1235.255) (-1233.098) (-1235.275) * (-1234.484) [-1232.234] (-1234.088) (-1243.336) -- 0:00:53 182500 -- (-1234.743) [-1234.322] (-1234.786) (-1240.135) * [-1234.159] (-1234.244) (-1234.451) (-1238.188) -- 0:00:53 183000 -- (-1235.818) [-1235.159] (-1234.608) (-1240.176) * [-1238.054] (-1237.830) (-1235.829) (-1238.009) -- 0:00:53 183500 -- (-1236.118) (-1237.867) [-1234.481] (-1234.999) * (-1236.411) [-1235.349] (-1235.892) (-1234.060) -- 0:00:53 184000 -- (-1236.584) [-1235.440] (-1237.637) (-1234.932) * (-1234.874) [-1233.988] (-1236.632) (-1234.757) -- 0:00:53 184500 -- [-1234.713] (-1237.272) (-1237.977) (-1234.210) * (-1234.024) (-1239.923) (-1239.967) [-1235.085] -- 0:00:53 185000 -- (-1235.339) (-1234.011) (-1236.161) [-1234.634] * (-1234.972) [-1235.975] (-1239.457) (-1235.436) -- 0:00:52 Average standard deviation of split frequencies: 0.018141 185500 -- [-1236.188] (-1234.695) (-1236.101) (-1237.174) * (-1238.173) (-1233.329) (-1233.663) [-1234.226] -- 0:00:52 186000 -- (-1239.478) (-1236.193) (-1235.286) [-1236.856] * (-1235.987) [-1232.371] (-1236.359) (-1236.856) -- 0:00:52 186500 -- (-1238.522) (-1235.923) (-1235.490) [-1235.233] * (-1237.919) [-1234.984] (-1235.740) (-1235.529) -- 0:00:52 187000 -- (-1237.519) [-1234.919] (-1235.746) (-1237.825) * (-1245.234) (-1235.603) (-1236.426) [-1235.295] -- 0:00:52 187500 -- [-1235.856] (-1237.946) (-1234.710) (-1236.894) * (-1243.966) [-1234.350] (-1237.703) (-1237.205) -- 0:00:52 188000 -- (-1235.373) [-1241.412] (-1237.107) (-1236.724) * [-1235.979] (-1235.075) (-1239.872) (-1236.186) -- 0:00:51 188500 -- (-1234.908) (-1234.663) (-1240.149) [-1235.433] * (-1236.089) [-1235.317] (-1240.422) (-1237.044) -- 0:00:51 189000 -- [-1235.275] (-1235.537) (-1236.626) (-1235.938) * [-1236.912] (-1239.320) (-1240.338) (-1238.684) -- 0:00:51 189500 -- (-1237.123) (-1234.927) (-1242.095) [-1235.211] * (-1237.757) (-1235.984) [-1238.796] (-1236.045) -- 0:00:51 190000 -- (-1234.181) (-1236.985) [-1234.538] (-1237.232) * [-1235.084] (-1240.159) (-1236.022) (-1234.019) -- 0:00:55 Average standard deviation of split frequencies: 0.019649 190500 -- [-1234.307] (-1233.427) (-1236.641) (-1237.938) * (-1236.694) [-1234.208] (-1236.750) (-1233.904) -- 0:00:55 191000 -- (-1240.508) (-1237.181) [-1238.514] (-1238.129) * (-1234.827) (-1240.046) (-1237.986) [-1235.852] -- 0:00:55 191500 -- (-1239.173) [-1236.036] (-1237.394) (-1240.946) * (-1235.430) [-1234.752] (-1235.560) (-1235.889) -- 0:00:54 192000 -- (-1240.879) (-1237.451) (-1236.066) [-1238.267] * (-1235.061) [-1235.386] (-1234.101) (-1241.507) -- 0:00:54 192500 -- (-1239.789) (-1235.719) [-1236.114] (-1236.411) * [-1235.327] (-1235.445) (-1235.751) (-1237.012) -- 0:00:54 193000 -- (-1237.945) (-1234.434) (-1235.737) [-1236.414] * (-1236.601) (-1235.994) [-1238.149] (-1240.207) -- 0:00:54 193500 -- [-1233.299] (-1236.043) (-1236.484) (-1235.517) * (-1234.952) [-1236.176] (-1237.160) (-1238.176) -- 0:00:54 194000 -- (-1239.915) (-1235.275) [-1237.094] (-1242.799) * (-1235.009) [-1233.844] (-1236.645) (-1237.370) -- 0:00:54 194500 -- (-1234.115) [-1236.685] (-1235.950) (-1237.233) * (-1234.955) [-1240.061] (-1238.808) (-1236.345) -- 0:00:53 195000 -- (-1235.899) [-1234.708] (-1237.712) (-1234.737) * (-1237.145) (-1235.735) (-1239.896) [-1237.609] -- 0:00:53 Average standard deviation of split frequencies: 0.018573 195500 -- [-1236.436] (-1235.300) (-1236.018) (-1235.722) * (-1236.092) [-1237.241] (-1236.128) (-1234.805) -- 0:00:53 196000 -- [-1236.035] (-1233.331) (-1236.967) (-1236.233) * (-1236.502) [-1237.235] (-1236.428) (-1235.038) -- 0:00:53 196500 -- (-1235.023) [-1234.225] (-1237.497) (-1234.453) * (-1236.533) (-1235.772) [-1235.332] (-1235.535) -- 0:00:53 197000 -- [-1232.786] (-1238.669) (-1234.987) (-1236.945) * (-1234.348) (-1235.570) (-1237.471) [-1235.609] -- 0:00:52 197500 -- [-1234.633] (-1236.197) (-1238.596) (-1235.620) * [-1234.535] (-1235.844) (-1236.946) (-1234.471) -- 0:00:52 198000 -- (-1237.118) (-1235.138) [-1239.473] (-1237.315) * (-1234.492) [-1236.256] (-1237.015) (-1235.037) -- 0:00:52 198500 -- (-1234.988) [-1236.634] (-1239.118) (-1236.326) * (-1235.969) (-1235.530) (-1235.956) [-1233.812] -- 0:00:52 199000 -- [-1234.398] (-1234.432) (-1235.931) (-1235.283) * (-1236.241) (-1236.931) (-1236.972) [-1236.165] -- 0:00:52 199500 -- (-1242.102) (-1235.498) (-1236.455) [-1235.829] * (-1238.027) (-1236.529) (-1241.112) [-1233.786] -- 0:00:52 200000 -- (-1235.408) (-1234.744) (-1236.033) [-1238.052] * (-1236.045) [-1234.863] (-1237.594) (-1232.759) -- 0:00:51 Average standard deviation of split frequencies: 0.019761 200500 -- (-1234.675) (-1233.503) (-1234.169) [-1239.185] * (-1235.348) [-1235.057] (-1235.728) (-1237.870) -- 0:00:51 201000 -- (-1237.380) (-1233.020) [-1234.238] (-1240.039) * (-1236.879) (-1237.392) (-1235.769) [-1237.792] -- 0:00:51 201500 -- (-1234.332) (-1236.517) [-1235.123] (-1236.215) * [-1235.477] (-1235.110) (-1237.350) (-1234.702) -- 0:00:51 202000 -- (-1233.774) [-1236.610] (-1234.065) (-1235.729) * (-1236.659) (-1234.906) (-1240.320) [-1237.957] -- 0:00:51 202500 -- (-1238.687) [-1236.561] (-1236.025) (-1236.649) * (-1236.634) (-1234.386) (-1235.582) [-1233.591] -- 0:00:51 203000 -- [-1238.607] (-1234.446) (-1236.680) (-1236.566) * [-1236.370] (-1236.343) (-1237.095) (-1236.556) -- 0:00:51 203500 -- (-1236.265) (-1237.883) [-1234.761] (-1236.445) * (-1237.176) (-1239.966) [-1237.027] (-1237.570) -- 0:00:50 204000 -- [-1236.612] (-1236.447) (-1237.520) (-1236.485) * (-1239.976) (-1238.581) (-1236.353) [-1236.302] -- 0:00:50 204500 -- (-1235.764) (-1237.406) [-1236.275] (-1236.200) * (-1236.784) [-1238.285] (-1235.792) (-1233.744) -- 0:00:50 205000 -- (-1234.705) [-1238.839] (-1235.406) (-1236.569) * (-1234.643) (-1234.719) (-1236.666) [-1235.057] -- 0:00:54 Average standard deviation of split frequencies: 0.020326 205500 -- (-1234.714) (-1237.362) (-1237.847) [-1235.688] * (-1234.480) (-1235.164) (-1234.260) [-1233.516] -- 0:00:54 206000 -- (-1236.395) [-1237.093] (-1237.233) (-1236.271) * (-1236.530) [-1236.235] (-1237.307) (-1235.099) -- 0:00:53 206500 -- [-1238.291] (-1235.760) (-1236.943) (-1237.200) * (-1236.983) (-1237.191) (-1235.457) [-1236.693] -- 0:00:53 207000 -- (-1235.494) (-1236.082) [-1238.377] (-1234.532) * (-1234.423) [-1234.990] (-1234.909) (-1235.828) -- 0:00:53 207500 -- (-1235.794) (-1234.727) (-1237.505) [-1237.679] * (-1235.851) (-1235.854) [-1235.108] (-1233.483) -- 0:00:53 208000 -- (-1235.535) (-1235.894) (-1234.688) [-1237.859] * [-1233.439] (-1234.743) (-1235.675) (-1235.638) -- 0:00:53 208500 -- (-1234.213) [-1235.456] (-1234.347) (-1236.355) * [-1234.950] (-1234.838) (-1235.812) (-1237.664) -- 0:00:53 209000 -- (-1237.082) (-1235.031) (-1235.509) [-1237.105] * (-1237.270) [-1235.717] (-1235.178) (-1240.265) -- 0:00:52 209500 -- (-1236.384) (-1235.045) (-1236.331) [-1236.007] * (-1233.267) (-1234.486) (-1235.364) [-1233.436] -- 0:00:52 210000 -- [-1240.433] (-1241.844) (-1238.100) (-1233.991) * (-1235.362) [-1238.124] (-1235.303) (-1234.096) -- 0:00:52 Average standard deviation of split frequencies: 0.021382 210500 -- [-1240.829] (-1233.519) (-1235.684) (-1234.291) * [-1234.959] (-1236.364) (-1235.137) (-1236.961) -- 0:00:52 211000 -- (-1235.681) [-1234.356] (-1235.308) (-1234.546) * (-1235.067) [-1234.397] (-1236.880) (-1235.518) -- 0:00:52 211500 -- (-1237.696) (-1241.041) (-1235.842) [-1233.318] * (-1235.761) [-1235.463] (-1237.072) (-1235.363) -- 0:00:52 212000 -- (-1234.709) (-1235.642) (-1235.648) [-1234.477] * (-1235.990) [-1235.275] (-1237.133) (-1239.240) -- 0:00:52 212500 -- (-1234.072) (-1235.284) (-1236.495) [-1233.089] * (-1237.976) (-1235.977) (-1238.815) [-1237.671] -- 0:00:51 213000 -- (-1234.669) [-1235.059] (-1236.415) (-1237.335) * (-1238.935) (-1238.143) (-1240.931) [-1235.993] -- 0:00:51 213500 -- (-1238.863) (-1235.064) [-1235.436] (-1241.409) * (-1238.145) (-1237.137) (-1240.524) [-1234.917] -- 0:00:51 214000 -- (-1241.372) (-1237.027) (-1235.058) [-1235.606] * [-1236.571] (-1236.706) (-1236.830) (-1236.298) -- 0:00:51 214500 -- (-1238.963) (-1243.628) (-1234.523) [-1234.323] * (-1236.345) (-1237.270) (-1241.035) [-1234.906] -- 0:00:51 215000 -- (-1234.504) (-1235.295) (-1234.565) [-1234.417] * (-1241.520) (-1235.332) (-1238.294) [-1232.731] -- 0:00:51 Average standard deviation of split frequencies: 0.021439 215500 -- [-1233.667] (-1235.187) (-1235.524) (-1235.531) * (-1237.604) [-1237.478] (-1237.596) (-1233.320) -- 0:00:50 216000 -- (-1243.396) [-1237.244] (-1232.433) (-1237.486) * (-1234.042) (-1240.612) [-1239.337] (-1234.812) -- 0:00:50 216500 -- (-1235.358) (-1234.637) (-1234.465) [-1236.544] * (-1235.287) (-1235.375) [-1234.626] (-1233.317) -- 0:00:50 217000 -- (-1234.912) (-1235.630) [-1236.229] (-1235.586) * (-1236.914) (-1236.810) (-1239.212) [-1237.313] -- 0:00:50 217500 -- (-1239.897) (-1236.231) (-1234.637) [-1236.267] * (-1234.775) (-1235.762) [-1236.471] (-1237.049) -- 0:00:50 218000 -- (-1242.407) (-1233.638) [-1235.967] (-1240.329) * (-1235.580) (-1236.685) (-1234.985) [-1235.767] -- 0:00:50 218500 -- (-1239.151) (-1235.619) [-1233.852] (-1236.974) * (-1235.467) (-1234.046) [-1234.511] (-1236.849) -- 0:00:50 219000 -- [-1234.905] (-1237.313) (-1235.785) (-1235.425) * (-1234.879) [-1235.271] (-1235.102) (-1235.325) -- 0:00:49 219500 -- (-1240.200) (-1233.896) [-1234.612] (-1238.518) * [-1236.053] (-1235.295) (-1236.028) (-1235.403) -- 0:00:49 220000 -- (-1235.335) (-1237.660) [-1236.244] (-1236.356) * (-1235.904) (-1235.560) [-1235.128] (-1237.293) -- 0:00:53 Average standard deviation of split frequencies: 0.021614 220500 -- [-1239.673] (-1240.004) (-1235.471) (-1234.803) * (-1236.019) [-1235.127] (-1235.823) (-1234.446) -- 0:00:53 221000 -- (-1237.347) [-1234.760] (-1237.515) (-1236.339) * (-1240.472) (-1235.100) (-1234.162) [-1235.682] -- 0:00:52 221500 -- (-1237.449) (-1235.119) (-1233.373) [-1235.464] * (-1235.284) (-1237.002) [-1236.479] (-1235.480) -- 0:00:52 222000 -- (-1237.360) [-1235.438] (-1235.217) (-1234.838) * (-1235.949) (-1239.288) [-1236.053] (-1235.590) -- 0:00:52 222500 -- [-1236.214] (-1234.231) (-1236.910) (-1235.461) * [-1236.035] (-1239.308) (-1236.483) (-1237.918) -- 0:00:52 223000 -- (-1238.231) (-1232.676) (-1236.954) [-1233.465] * (-1238.731) [-1235.583] (-1234.983) (-1237.812) -- 0:00:52 223500 -- [-1239.341] (-1234.927) (-1235.962) (-1235.268) * [-1239.397] (-1236.903) (-1235.627) (-1235.547) -- 0:00:52 224000 -- [-1236.387] (-1235.260) (-1237.268) (-1235.394) * (-1239.009) (-1234.257) [-1238.935] (-1234.257) -- 0:00:51 224500 -- [-1237.776] (-1235.301) (-1234.076) (-1237.587) * [-1235.863] (-1236.993) (-1235.385) (-1238.089) -- 0:00:51 225000 -- [-1238.990] (-1235.019) (-1235.871) (-1237.659) * (-1235.817) [-1236.666] (-1239.714) (-1237.997) -- 0:00:51 Average standard deviation of split frequencies: 0.020627 225500 -- (-1241.639) (-1233.811) (-1237.153) [-1235.869] * (-1234.220) (-1236.760) [-1236.169] (-1234.666) -- 0:00:51 226000 -- (-1235.778) (-1233.467) (-1238.916) [-1235.143] * [-1236.284] (-1233.955) (-1238.076) (-1234.638) -- 0:00:51 226500 -- (-1234.867) [-1235.265] (-1240.474) (-1237.276) * (-1234.009) (-1236.104) (-1239.063) [-1232.971] -- 0:00:51 227000 -- (-1234.489) (-1239.225) (-1241.034) [-1234.725] * (-1234.912) (-1234.972) [-1234.149] (-1237.326) -- 0:00:51 227500 -- [-1235.773] (-1239.705) (-1240.426) (-1235.532) * (-1234.135) [-1234.682] (-1235.068) (-1236.569) -- 0:00:50 228000 -- [-1235.009] (-1236.526) (-1241.668) (-1235.634) * [-1237.100] (-1233.714) (-1236.810) (-1239.178) -- 0:00:50 228500 -- (-1236.389) (-1238.156) [-1234.799] (-1235.157) * (-1238.994) [-1233.365] (-1235.309) (-1234.662) -- 0:00:50 229000 -- (-1234.740) (-1237.287) [-1234.135] (-1238.293) * (-1240.782) [-1234.778] (-1236.868) (-1236.053) -- 0:00:50 229500 -- (-1239.275) (-1236.808) [-1235.900] (-1236.527) * (-1234.758) [-1234.204] (-1237.889) (-1236.067) -- 0:00:50 230000 -- (-1237.600) [-1238.235] (-1237.451) (-1235.230) * (-1242.144) (-1235.722) [-1239.332] (-1235.246) -- 0:00:50 Average standard deviation of split frequencies: 0.020797 230500 -- (-1238.139) (-1235.110) (-1240.448) [-1237.046] * [-1236.513] (-1237.205) (-1235.834) (-1234.026) -- 0:00:50 231000 -- (-1238.049) (-1233.430) [-1236.844] (-1235.502) * (-1235.415) (-1236.630) [-1234.759] (-1235.039) -- 0:00:49 231500 -- (-1235.753) (-1234.405) [-1238.492] (-1236.114) * (-1237.328) [-1235.441] (-1235.792) (-1235.306) -- 0:00:49 232000 -- [-1237.636] (-1238.270) (-1237.212) (-1236.332) * [-1236.504] (-1237.190) (-1237.769) (-1236.469) -- 0:00:49 232500 -- [-1236.820] (-1233.359) (-1235.732) (-1234.764) * (-1237.634) (-1235.253) (-1238.597) [-1234.960] -- 0:00:49 233000 -- (-1236.818) (-1233.260) [-1235.907] (-1235.793) * (-1234.536) (-1237.215) (-1234.765) [-1237.603] -- 0:00:49 233500 -- (-1234.292) (-1242.313) [-1235.915] (-1235.370) * [-1236.493] (-1236.569) (-1237.159) (-1236.004) -- 0:00:49 234000 -- (-1234.095) (-1236.863) [-1234.666] (-1234.280) * (-1235.611) (-1239.042) (-1236.256) [-1236.192] -- 0:00:49 234500 -- (-1234.075) (-1235.057) [-1234.824] (-1236.177) * (-1235.900) (-1237.364) [-1235.335] (-1235.941) -- 0:00:48 235000 -- (-1235.914) [-1234.493] (-1236.212) (-1233.292) * (-1236.875) (-1234.493) (-1240.713) [-1235.299] -- 0:00:52 Average standard deviation of split frequencies: 0.022442 235500 -- (-1234.524) (-1231.960) (-1241.208) [-1234.441] * (-1236.374) [-1234.917] (-1235.864) (-1235.233) -- 0:00:51 236000 -- (-1235.549) [-1236.002] (-1240.254) (-1234.760) * (-1235.246) (-1235.005) [-1237.226] (-1236.190) -- 0:00:51 236500 -- (-1235.651) (-1237.398) [-1235.185] (-1234.415) * (-1234.866) (-1232.986) [-1236.767] (-1235.461) -- 0:00:51 237000 -- [-1234.489] (-1238.103) (-1234.258) (-1238.762) * [-1234.458] (-1237.616) (-1239.533) (-1239.322) -- 0:00:51 237500 -- (-1234.815) (-1235.687) (-1239.262) [-1234.037] * (-1235.414) (-1234.187) [-1236.336] (-1239.785) -- 0:00:51 238000 -- (-1236.567) (-1235.075) (-1237.860) [-1233.035] * [-1235.106] (-1236.200) (-1235.865) (-1238.260) -- 0:00:51 238500 -- (-1235.953) (-1236.699) [-1237.354] (-1234.363) * [-1234.892] (-1240.182) (-1235.121) (-1235.989) -- 0:00:51 239000 -- (-1237.666) (-1238.085) (-1238.159) [-1235.549] * [-1236.068] (-1237.899) (-1240.048) (-1237.931) -- 0:00:50 239500 -- [-1236.058] (-1234.224) (-1236.771) (-1235.303) * [-1237.554] (-1243.508) (-1236.708) (-1234.225) -- 0:00:50 240000 -- (-1238.350) (-1235.018) [-1236.387] (-1235.842) * (-1235.128) (-1238.537) [-1236.860] (-1235.181) -- 0:00:50 Average standard deviation of split frequencies: 0.022090 240500 -- (-1235.623) [-1235.538] (-1235.614) (-1238.871) * (-1235.342) [-1232.814] (-1236.414) (-1236.175) -- 0:00:50 241000 -- (-1237.631) [-1235.501] (-1236.603) (-1239.436) * (-1233.560) [-1236.477] (-1240.017) (-1241.426) -- 0:00:50 241500 -- (-1242.231) [-1233.270] (-1237.444) (-1237.238) * [-1234.280] (-1233.534) (-1236.751) (-1241.902) -- 0:00:50 242000 -- (-1235.270) [-1234.041] (-1235.714) (-1236.759) * (-1236.977) (-1233.716) [-1234.790] (-1239.242) -- 0:00:50 242500 -- (-1236.686) [-1233.916] (-1234.428) (-1236.909) * (-1233.898) [-1234.201] (-1235.146) (-1241.612) -- 0:00:49 243000 -- (-1234.099) [-1237.579] (-1238.975) (-1236.734) * [-1234.647] (-1234.902) (-1241.001) (-1236.248) -- 0:00:49 243500 -- [-1234.666] (-1238.686) (-1238.774) (-1235.914) * (-1236.288) [-1233.809] (-1236.506) (-1234.326) -- 0:00:49 244000 -- (-1236.177) [-1235.124] (-1233.149) (-1234.655) * (-1235.876) [-1234.504] (-1240.549) (-1234.346) -- 0:00:49 244500 -- [-1236.356] (-1235.087) (-1236.943) (-1235.815) * (-1236.755) (-1236.797) [-1241.937] (-1235.951) -- 0:00:49 245000 -- [-1238.602] (-1238.835) (-1232.372) (-1235.247) * (-1238.753) (-1233.090) (-1235.852) [-1237.674] -- 0:00:49 Average standard deviation of split frequencies: 0.020760 245500 -- (-1243.674) [-1234.832] (-1236.282) (-1234.717) * (-1235.974) (-1234.468) (-1236.902) [-1236.553] -- 0:00:49 246000 -- (-1236.071) (-1234.736) [-1236.407] (-1233.286) * (-1236.634) [-1239.104] (-1234.982) (-1235.432) -- 0:00:49 246500 -- (-1236.665) [-1235.373] (-1234.757) (-1234.920) * (-1235.583) [-1236.347] (-1234.672) (-1235.819) -- 0:00:48 247000 -- (-1236.006) [-1233.741] (-1236.391) (-1234.079) * [-1233.501] (-1234.920) (-1238.385) (-1233.885) -- 0:00:48 247500 -- (-1237.986) (-1234.309) (-1235.204) [-1235.809] * (-1234.252) [-1233.972] (-1235.787) (-1237.889) -- 0:00:48 248000 -- (-1237.215) (-1235.332) (-1234.789) [-1237.380] * (-1234.096) (-1234.682) (-1234.502) [-1234.716] -- 0:00:48 248500 -- (-1235.172) (-1237.017) (-1235.560) [-1236.645] * (-1234.595) [-1235.219] (-1238.598) (-1234.491) -- 0:00:48 249000 -- (-1235.260) (-1236.704) [-1234.793] (-1233.684) * (-1234.467) (-1236.523) [-1236.858] (-1235.785) -- 0:00:48 249500 -- [-1235.416] (-1234.689) (-1235.021) (-1239.479) * (-1234.050) (-1237.815) [-1236.317] (-1237.113) -- 0:00:48 250000 -- (-1237.747) [-1234.065] (-1235.718) (-1234.672) * (-1234.470) [-1235.370] (-1236.325) (-1236.047) -- 0:00:51 Average standard deviation of split frequencies: 0.019851 250500 -- (-1235.053) [-1235.464] (-1238.309) (-1238.918) * [-1236.130] (-1236.239) (-1236.580) (-1237.562) -- 0:00:50 251000 -- (-1234.718) (-1239.609) (-1236.123) [-1237.032] * [-1235.155] (-1239.072) (-1235.502) (-1236.586) -- 0:00:50 251500 -- (-1234.915) [-1234.866] (-1235.432) (-1234.640) * (-1237.445) (-1234.945) (-1235.560) [-1232.870] -- 0:00:50 252000 -- (-1239.179) (-1240.874) [-1239.327] (-1234.693) * (-1236.075) (-1232.902) (-1235.913) [-1235.264] -- 0:00:50 252500 -- (-1235.675) (-1238.276) (-1239.464) [-1237.446] * (-1236.643) (-1234.309) (-1235.101) [-1236.615] -- 0:00:50 253000 -- (-1233.914) (-1235.768) (-1238.785) [-1234.919] * (-1237.532) (-1237.557) (-1237.542) [-1233.213] -- 0:00:50 253500 -- (-1237.100) (-1235.802) [-1235.718] (-1238.512) * (-1235.425) (-1236.823) (-1240.150) [-1236.204] -- 0:00:50 254000 -- (-1236.912) (-1235.012) (-1236.420) [-1233.478] * (-1236.383) [-1233.868] (-1239.021) (-1238.553) -- 0:00:49 254500 -- (-1236.645) (-1238.477) [-1239.077] (-1236.172) * [-1237.029] (-1238.732) (-1238.113) (-1234.130) -- 0:00:49 255000 -- (-1236.677) (-1236.606) [-1234.620] (-1240.371) * [-1235.467] (-1233.038) (-1237.261) (-1237.620) -- 0:00:49 Average standard deviation of split frequencies: 0.020358 255500 -- (-1237.236) [-1235.805] (-1235.958) (-1237.374) * (-1234.224) (-1237.671) [-1235.128] (-1237.590) -- 0:00:49 256000 -- (-1236.591) (-1233.912) [-1235.167] (-1238.397) * (-1236.237) (-1236.607) [-1235.462] (-1238.909) -- 0:00:49 256500 -- (-1236.289) [-1235.236] (-1235.157) (-1237.658) * (-1238.524) (-1237.137) (-1235.005) [-1237.299] -- 0:00:49 257000 -- (-1238.561) [-1235.551] (-1236.660) (-1236.413) * (-1235.696) (-1233.885) (-1237.753) [-1235.504] -- 0:00:49 257500 -- (-1239.590) (-1236.389) [-1236.110] (-1235.891) * (-1239.915) [-1232.719] (-1238.308) (-1235.406) -- 0:00:49 258000 -- (-1237.031) [-1234.342] (-1238.141) (-1236.059) * (-1236.459) [-1234.593] (-1239.324) (-1233.928) -- 0:00:48 258500 -- (-1235.377) (-1234.845) (-1236.617) [-1234.812] * (-1234.402) [-1235.783] (-1239.918) (-1237.532) -- 0:00:48 259000 -- [-1233.956] (-1235.453) (-1239.565) (-1233.441) * (-1237.870) (-1236.782) (-1235.823) [-1236.937] -- 0:00:48 259500 -- (-1240.054) [-1234.947] (-1234.485) (-1233.387) * [-1237.512] (-1237.137) (-1236.331) (-1236.953) -- 0:00:48 260000 -- (-1239.794) [-1236.389] (-1237.938) (-1234.160) * (-1237.692) (-1236.485) [-1233.439] (-1235.970) -- 0:00:48 Average standard deviation of split frequencies: 0.020898 260500 -- (-1235.801) [-1235.235] (-1237.273) (-1235.301) * [-1234.980] (-1237.378) (-1235.598) (-1236.733) -- 0:00:48 261000 -- (-1234.683) (-1239.403) (-1236.783) [-1236.806] * (-1235.053) (-1235.637) [-1240.914] (-1235.743) -- 0:00:48 261500 -- (-1237.654) (-1238.045) [-1240.003] (-1239.272) * (-1237.298) (-1238.313) (-1239.730) [-1234.912] -- 0:00:48 262000 -- (-1235.164) (-1235.853) [-1236.452] (-1234.346) * [-1235.815] (-1239.868) (-1235.898) (-1236.875) -- 0:00:47 262500 -- (-1240.267) (-1237.578) [-1236.080] (-1237.098) * (-1235.443) (-1238.279) [-1236.398] (-1234.563) -- 0:00:47 263000 -- [-1239.397] (-1235.009) (-1236.023) (-1235.904) * (-1236.691) [-1234.939] (-1234.544) (-1237.145) -- 0:00:47 263500 -- (-1235.647) (-1236.772) (-1237.081) [-1236.659] * [-1233.898] (-1237.630) (-1236.787) (-1237.699) -- 0:00:47 264000 -- (-1234.745) (-1236.091) [-1234.797] (-1238.006) * (-1237.585) [-1237.288] (-1237.073) (-1236.367) -- 0:00:47 264500 -- (-1239.510) [-1234.488] (-1237.095) (-1234.700) * (-1235.049) [-1237.033] (-1236.044) (-1235.772) -- 0:00:47 265000 -- [-1234.244] (-1235.297) (-1237.192) (-1234.852) * (-1240.638) [-1238.309] (-1238.462) (-1240.077) -- 0:00:49 Average standard deviation of split frequencies: 0.019691 265500 -- (-1235.740) [-1238.748] (-1234.789) (-1237.564) * [-1237.706] (-1241.191) (-1236.640) (-1235.166) -- 0:00:49 266000 -- (-1235.791) [-1234.092] (-1238.132) (-1235.564) * [-1235.169] (-1235.771) (-1237.018) (-1234.211) -- 0:00:49 266500 -- [-1236.796] (-1235.028) (-1237.443) (-1233.452) * (-1235.893) (-1236.648) [-1235.351] (-1235.487) -- 0:00:49 267000 -- (-1233.577) (-1236.132) (-1236.211) [-1232.546] * (-1234.563) [-1237.216] (-1236.017) (-1235.828) -- 0:00:49 267500 -- (-1233.680) [-1235.251] (-1234.745) (-1234.897) * (-1235.112) (-1237.829) [-1235.414] (-1238.530) -- 0:00:49 268000 -- (-1237.275) (-1233.698) [-1236.061] (-1235.779) * (-1234.782) (-1237.205) (-1235.644) [-1236.532] -- 0:00:49 268500 -- (-1234.175) (-1234.534) [-1235.322] (-1235.435) * [-1234.384] (-1234.764) (-1235.524) (-1235.387) -- 0:00:49 269000 -- (-1235.870) (-1234.583) [-1235.189] (-1236.424) * (-1234.280) (-1236.362) [-1238.146] (-1235.651) -- 0:00:48 269500 -- (-1236.370) [-1234.908] (-1237.295) (-1237.132) * (-1237.526) (-1236.327) [-1234.553] (-1236.817) -- 0:00:48 270000 -- (-1238.765) [-1234.257] (-1235.690) (-1233.985) * (-1236.191) (-1235.209) (-1241.141) [-1236.457] -- 0:00:48 Average standard deviation of split frequencies: 0.019835 270500 -- [-1233.900] (-1233.031) (-1237.496) (-1236.950) * (-1235.265) [-1234.245] (-1238.656) (-1236.369) -- 0:00:48 271000 -- (-1234.785) [-1236.369] (-1235.673) (-1234.483) * (-1234.863) [-1236.158] (-1242.155) (-1235.206) -- 0:00:48 271500 -- (-1233.652) [-1235.800] (-1235.656) (-1237.101) * (-1234.790) (-1240.562) (-1237.335) [-1236.082] -- 0:00:48 272000 -- (-1235.515) [-1237.189] (-1236.703) (-1235.538) * (-1237.737) (-1236.097) (-1236.643) [-1234.217] -- 0:00:48 272500 -- (-1235.464) (-1236.272) (-1236.996) [-1237.039] * (-1238.714) (-1236.956) (-1235.070) [-1232.687] -- 0:00:48 273000 -- [-1235.643] (-1236.936) (-1235.575) (-1235.231) * (-1236.574) [-1235.689] (-1236.663) (-1236.185) -- 0:00:47 273500 -- (-1239.297) [-1237.517] (-1236.022) (-1240.956) * [-1237.890] (-1236.490) (-1238.828) (-1234.035) -- 0:00:47 274000 -- (-1236.223) (-1234.891) [-1234.875] (-1237.969) * (-1240.742) [-1236.595] (-1235.053) (-1236.851) -- 0:00:47 274500 -- (-1235.890) [-1234.614] (-1236.257) (-1236.406) * (-1235.532) (-1236.708) [-1238.174] (-1235.668) -- 0:00:47 275000 -- (-1234.011) (-1234.626) (-1239.413) [-1236.309] * (-1234.922) (-1235.704) (-1238.928) [-1235.360] -- 0:00:47 Average standard deviation of split frequencies: 0.018029 275500 -- (-1235.242) [-1235.262] (-1241.040) (-1237.359) * (-1235.846) [-1236.391] (-1236.133) (-1235.056) -- 0:00:47 276000 -- (-1235.748) (-1236.666) (-1237.091) [-1233.718] * (-1235.076) (-1237.176) (-1235.187) [-1235.508] -- 0:00:47 276500 -- [-1234.388] (-1232.900) (-1235.204) (-1237.385) * (-1234.911) (-1237.839) [-1238.199] (-1240.456) -- 0:00:47 277000 -- [-1236.866] (-1234.568) (-1234.835) (-1235.227) * [-1235.383] (-1238.121) (-1237.117) (-1238.475) -- 0:00:46 277500 -- (-1234.015) (-1236.608) (-1238.940) [-1233.447] * (-1235.436) (-1236.627) (-1236.953) [-1234.170] -- 0:00:46 278000 -- [-1235.915] (-1239.683) (-1235.058) (-1235.014) * (-1235.161) (-1237.243) (-1234.261) [-1235.718] -- 0:00:46 278500 -- (-1234.839) [-1237.417] (-1235.071) (-1236.442) * (-1238.205) [-1236.973] (-1232.287) (-1235.681) -- 0:00:46 279000 -- [-1235.998] (-1235.958) (-1236.915) (-1236.791) * (-1236.300) [-1238.428] (-1233.126) (-1234.670) -- 0:00:46 279500 -- (-1239.638) [-1235.211] (-1236.268) (-1235.828) * [-1236.535] (-1235.664) (-1234.670) (-1235.338) -- 0:00:46 280000 -- [-1236.197] (-1238.123) (-1237.062) (-1239.522) * (-1238.513) (-1234.659) [-1239.760] (-1236.143) -- 0:00:48 Average standard deviation of split frequencies: 0.017945 280500 -- (-1236.241) (-1241.181) (-1235.301) [-1237.232] * (-1235.637) (-1235.803) (-1235.149) [-1234.917] -- 0:00:48 281000 -- [-1233.722] (-1237.470) (-1234.555) (-1235.326) * [-1237.600] (-1234.583) (-1234.232) (-1233.332) -- 0:00:48 281500 -- (-1236.952) (-1239.536) [-1237.241] (-1242.262) * (-1237.713) (-1239.394) [-1234.916] (-1234.195) -- 0:00:48 282000 -- (-1236.461) (-1235.947) [-1237.561] (-1237.686) * (-1237.269) (-1239.750) [-1234.897] (-1237.185) -- 0:00:48 282500 -- (-1239.875) (-1233.049) [-1236.691] (-1236.383) * (-1236.510) (-1236.820) [-1234.897] (-1236.108) -- 0:00:48 283000 -- (-1235.882) (-1233.351) (-1238.581) [-1234.646] * [-1236.660] (-1236.220) (-1235.797) (-1236.500) -- 0:00:48 283500 -- [-1235.378] (-1236.204) (-1235.697) (-1234.390) * (-1237.595) (-1235.385) [-1234.266] (-1237.281) -- 0:00:48 284000 -- [-1236.971] (-1235.499) (-1235.555) (-1234.864) * [-1236.116] (-1236.471) (-1233.878) (-1236.087) -- 0:00:47 284500 -- (-1236.819) (-1233.832) [-1238.383] (-1235.933) * [-1238.735] (-1236.360) (-1235.140) (-1237.712) -- 0:00:47 285000 -- (-1233.747) (-1238.988) [-1235.784] (-1233.934) * (-1236.056) (-1234.450) [-1237.504] (-1233.570) -- 0:00:47 Average standard deviation of split frequencies: 0.018218 285500 -- (-1235.602) (-1234.899) [-1235.071] (-1237.228) * (-1234.733) (-1235.926) (-1235.648) [-1236.159] -- 0:00:47 286000 -- (-1236.850) (-1233.954) [-1234.080] (-1238.719) * (-1236.797) (-1236.253) (-1236.915) [-1235.741] -- 0:00:47 286500 -- (-1236.875) (-1236.141) [-1236.478] (-1234.199) * (-1237.698) (-1238.244) (-1235.854) [-1236.391] -- 0:00:47 287000 -- (-1237.338) (-1236.441) [-1238.002] (-1235.654) * (-1240.466) [-1237.433] (-1236.561) (-1234.413) -- 0:00:47 287500 -- (-1234.133) (-1236.997) (-1237.765) [-1234.379] * (-1239.521) (-1238.694) (-1233.421) [-1233.868] -- 0:00:47 288000 -- [-1235.032] (-1234.530) (-1237.582) (-1234.709) * [-1238.208] (-1235.780) (-1234.705) (-1236.122) -- 0:00:46 288500 -- (-1235.564) (-1242.636) (-1236.572) [-1235.528] * (-1235.475) [-1235.029] (-1233.756) (-1235.808) -- 0:00:46 289000 -- (-1236.383) (-1234.896) (-1237.309) [-1235.699] * (-1235.722) (-1234.531) [-1234.750] (-1237.007) -- 0:00:46 289500 -- (-1238.997) (-1234.836) [-1237.243] (-1235.394) * (-1235.695) (-1236.095) [-1234.103] (-1234.213) -- 0:00:46 290000 -- (-1236.720) (-1234.966) [-1234.675] (-1235.036) * (-1239.237) (-1235.153) (-1235.119) [-1238.559] -- 0:00:46 Average standard deviation of split frequencies: 0.018200 290500 -- (-1234.956) [-1233.613] (-1236.546) (-1236.828) * [-1234.945] (-1234.170) (-1235.725) (-1236.991) -- 0:00:46 291000 -- (-1234.548) (-1237.322) [-1237.225] (-1235.859) * (-1235.597) (-1235.168) [-1236.567] (-1235.731) -- 0:00:46 291500 -- (-1238.083) (-1237.101) (-1238.252) [-1234.258] * [-1235.886] (-1234.094) (-1237.060) (-1234.599) -- 0:00:46 292000 -- (-1237.907) (-1233.038) [-1237.129] (-1234.297) * (-1236.484) (-1233.570) (-1237.181) [-1234.387] -- 0:00:46 292500 -- (-1237.383) (-1233.635) [-1233.989] (-1232.857) * (-1237.444) (-1235.067) (-1237.039) [-1235.893] -- 0:00:45 293000 -- (-1236.857) (-1234.698) [-1236.678] (-1235.440) * [-1233.683] (-1236.279) (-1236.759) (-1234.997) -- 0:00:45 293500 -- (-1236.807) (-1234.934) (-1235.681) [-1236.002] * [-1235.471] (-1235.548) (-1237.385) (-1232.770) -- 0:00:45 294000 -- (-1237.321) [-1233.879] (-1235.105) (-1237.755) * [-1235.893] (-1239.166) (-1234.663) (-1236.313) -- 0:00:45 294500 -- (-1235.488) (-1237.215) (-1235.041) [-1236.403] * [-1234.603] (-1233.849) (-1234.872) (-1235.754) -- 0:00:45 295000 -- (-1236.339) (-1234.392) (-1234.979) [-1237.234] * (-1236.262) (-1236.333) (-1234.662) [-1235.542] -- 0:00:45 Average standard deviation of split frequencies: 0.018080 295500 -- (-1235.654) (-1235.990) (-1237.936) [-1240.658] * (-1234.441) (-1235.361) (-1236.043) [-1233.680] -- 0:00:47 296000 -- (-1237.083) (-1235.346) [-1234.656] (-1236.008) * (-1239.152) [-1234.721] (-1236.235) (-1234.913) -- 0:00:47 296500 -- (-1237.236) (-1238.221) [-1239.673] (-1237.471) * (-1233.399) (-1234.725) (-1236.034) [-1238.577] -- 0:00:47 297000 -- (-1235.518) [-1235.586] (-1238.789) (-1237.829) * (-1234.851) (-1239.389) [-1234.623] (-1234.777) -- 0:00:47 297500 -- (-1236.086) (-1234.954) (-1238.666) [-1235.565] * (-1236.771) [-1234.698] (-1236.947) (-1236.444) -- 0:00:47 298000 -- (-1236.538) (-1233.947) [-1239.687] (-1236.113) * (-1234.731) (-1235.384) [-1234.247] (-1233.465) -- 0:00:47 298500 -- (-1241.354) [-1236.430] (-1239.163) (-1233.572) * [-1235.102] (-1234.512) (-1237.567) (-1234.138) -- 0:00:47 299000 -- (-1233.867) [-1233.749] (-1247.366) (-1233.077) * [-1235.546] (-1235.880) (-1235.022) (-1233.094) -- 0:00:46 299500 -- (-1243.386) (-1234.099) [-1236.794] (-1235.143) * [-1234.803] (-1238.845) (-1236.159) (-1235.999) -- 0:00:46 300000 -- [-1236.422] (-1237.927) (-1238.610) (-1236.070) * [-1234.244] (-1234.963) (-1237.715) (-1238.678) -- 0:00:46 Average standard deviation of split frequencies: 0.018640 300500 -- (-1236.022) [-1234.331] (-1238.031) (-1236.633) * [-1233.930] (-1233.776) (-1236.737) (-1233.164) -- 0:00:46 301000 -- (-1237.097) [-1234.666] (-1235.286) (-1237.276) * [-1234.024] (-1235.764) (-1236.926) (-1235.739) -- 0:00:46 301500 -- [-1236.160] (-1236.198) (-1238.696) (-1234.889) * [-1237.536] (-1232.933) (-1235.600) (-1234.532) -- 0:00:46 302000 -- [-1234.995] (-1236.502) (-1238.041) (-1235.358) * (-1233.550) (-1234.365) (-1242.161) [-1232.849] -- 0:00:46 302500 -- [-1234.776] (-1234.498) (-1234.878) (-1236.600) * (-1234.711) (-1235.035) (-1236.395) [-1234.743] -- 0:00:46 303000 -- (-1235.278) (-1237.657) [-1234.722] (-1249.725) * [-1234.798] (-1240.315) (-1233.637) (-1235.892) -- 0:00:46 303500 -- (-1234.114) [-1234.419] (-1233.977) (-1243.164) * [-1236.094] (-1242.611) (-1235.604) (-1235.373) -- 0:00:45 304000 -- [-1233.102] (-1236.406) (-1236.598) (-1239.780) * (-1233.983) [-1237.160] (-1236.801) (-1238.362) -- 0:00:45 304500 -- (-1234.599) [-1241.213] (-1234.502) (-1238.270) * (-1236.733) (-1236.692) (-1235.297) [-1235.270] -- 0:00:45 305000 -- [-1234.586] (-1240.299) (-1235.214) (-1239.056) * (-1235.206) (-1235.928) (-1239.147) [-1234.308] -- 0:00:45 Average standard deviation of split frequencies: 0.017545 305500 -- (-1237.149) (-1236.514) [-1240.523] (-1239.652) * [-1234.771] (-1235.621) (-1235.397) (-1235.589) -- 0:00:45 306000 -- (-1237.258) [-1236.235] (-1234.644) (-1238.529) * (-1236.925) [-1236.148] (-1235.286) (-1237.976) -- 0:00:45 306500 -- (-1241.325) [-1234.735] (-1237.325) (-1234.896) * (-1236.611) (-1234.578) [-1234.366] (-1234.552) -- 0:00:45 307000 -- [-1235.846] (-1236.164) (-1237.426) (-1237.579) * [-1234.612] (-1234.378) (-1235.943) (-1241.438) -- 0:00:45 307500 -- (-1238.016) (-1235.508) (-1235.937) [-1237.319] * (-1235.477) (-1234.085) [-1234.668] (-1238.105) -- 0:00:45 308000 -- (-1235.285) [-1237.259] (-1235.992) (-1234.896) * [-1237.750] (-1232.339) (-1238.157) (-1238.499) -- 0:00:44 308500 -- [-1235.880] (-1236.480) (-1236.512) (-1237.986) * (-1238.179) [-1234.926] (-1235.060) (-1238.022) -- 0:00:44 309000 -- [-1237.291] (-1234.488) (-1238.331) (-1239.511) * (-1235.562) (-1233.678) (-1235.981) [-1237.559] -- 0:00:44 309500 -- [-1235.244] (-1235.929) (-1238.253) (-1238.198) * (-1235.415) [-1235.527] (-1233.109) (-1234.089) -- 0:00:44 310000 -- (-1241.653) (-1234.983) (-1237.969) [-1236.569] * (-1236.095) (-1235.590) [-1233.428] (-1234.444) -- 0:00:46 Average standard deviation of split frequencies: 0.017956 310500 -- (-1237.204) (-1236.031) (-1235.508) [-1235.254] * (-1236.040) (-1237.186) [-1236.219] (-1236.345) -- 0:00:46 311000 -- [-1237.320] (-1237.002) (-1235.592) (-1237.710) * (-1237.276) [-1235.492] (-1238.546) (-1234.289) -- 0:00:46 311500 -- (-1238.145) (-1238.236) [-1236.047] (-1238.766) * (-1237.830) [-1235.539] (-1237.005) (-1238.181) -- 0:00:46 312000 -- (-1235.436) (-1240.160) [-1233.947] (-1235.988) * (-1241.317) [-1235.147] (-1238.142) (-1237.022) -- 0:00:46 312500 -- (-1235.164) (-1240.034) [-1236.617] (-1236.107) * (-1235.707) [-1233.778] (-1234.869) (-1233.794) -- 0:00:46 313000 -- [-1235.083] (-1234.943) (-1234.169) (-1236.331) * (-1235.119) (-1237.624) (-1235.750) [-1240.218] -- 0:00:46 313500 -- (-1237.442) (-1236.148) [-1234.693] (-1238.311) * (-1240.065) (-1236.278) [-1234.864] (-1239.803) -- 0:00:45 314000 -- (-1236.275) (-1235.011) (-1233.051) [-1234.195] * (-1241.900) (-1240.334) (-1233.996) [-1236.967] -- 0:00:45 314500 -- (-1235.571) (-1234.453) [-1232.788] (-1233.638) * (-1235.476) [-1235.896] (-1233.964) (-1236.185) -- 0:00:45 315000 -- (-1235.357) (-1235.187) [-1234.943] (-1237.212) * (-1235.728) (-1234.244) [-1238.447] (-1234.789) -- 0:00:45 Average standard deviation of split frequencies: 0.016493 315500 -- (-1235.247) (-1233.784) (-1235.093) [-1237.242] * (-1235.917) (-1240.091) [-1235.048] (-1238.012) -- 0:00:45 316000 -- (-1240.037) (-1233.387) (-1235.239) [-1235.967] * (-1234.728) [-1235.505] (-1240.169) (-1238.218) -- 0:00:45 316500 -- (-1237.552) [-1234.507] (-1235.422) (-1233.579) * (-1236.421) (-1235.914) (-1239.577) [-1238.898] -- 0:00:45 317000 -- (-1236.600) (-1239.062) (-1236.116) [-1237.564] * [-1235.595] (-1235.805) (-1237.434) (-1236.201) -- 0:00:45 317500 -- (-1235.425) (-1238.314) (-1233.439) [-1234.473] * (-1237.152) (-1236.862) [-1234.254] (-1238.509) -- 0:00:45 318000 -- (-1236.059) (-1235.157) [-1235.958] (-1235.277) * [-1236.097] (-1235.202) (-1234.756) (-1241.167) -- 0:00:45 318500 -- (-1236.540) (-1238.140) [-1234.833] (-1237.681) * (-1235.750) [-1235.035] (-1233.427) (-1236.940) -- 0:00:44 319000 -- (-1236.380) (-1236.186) (-1235.500) [-1236.497] * (-1235.948) (-1236.448) [-1235.884] (-1237.656) -- 0:00:44 319500 -- (-1236.140) (-1236.683) (-1234.153) [-1235.837] * (-1235.168) [-1237.247] (-1238.355) (-1235.332) -- 0:00:44 320000 -- (-1236.405) [-1236.892] (-1237.303) (-1235.975) * (-1236.663) [-1236.779] (-1235.361) (-1236.068) -- 0:00:44 Average standard deviation of split frequencies: 0.015998 320500 -- (-1237.404) (-1238.741) (-1236.666) [-1236.067] * (-1236.832) (-1238.158) [-1236.909] (-1236.714) -- 0:00:44 321000 -- (-1239.515) (-1236.080) (-1232.290) [-1236.391] * [-1236.980] (-1237.393) (-1235.036) (-1235.056) -- 0:00:44 321500 -- (-1239.084) (-1237.637) (-1235.588) [-1236.309] * (-1238.821) (-1238.651) [-1232.641] (-1236.487) -- 0:00:44 322000 -- (-1235.107) (-1237.135) [-1234.734] (-1235.504) * (-1237.896) [-1235.803] (-1236.165) (-1236.153) -- 0:00:44 322500 -- (-1234.580) [-1236.595] (-1237.043) (-1234.799) * [-1235.823] (-1237.442) (-1236.922) (-1237.134) -- 0:00:44 323000 -- (-1237.257) (-1234.632) (-1235.628) [-1232.695] * (-1236.357) [-1236.139] (-1239.299) (-1234.697) -- 0:00:44 323500 -- (-1235.567) [-1233.780] (-1237.912) (-1234.591) * [-1234.132] (-1235.415) (-1236.724) (-1234.630) -- 0:00:46 324000 -- (-1234.359) (-1235.375) (-1234.796) [-1235.480] * (-1235.843) [-1236.423] (-1235.657) (-1237.627) -- 0:00:45 324500 -- (-1235.017) [-1235.237] (-1240.829) (-1240.595) * (-1235.641) [-1235.694] (-1235.279) (-1236.078) -- 0:00:45 325000 -- (-1235.966) [-1239.830] (-1233.930) (-1235.089) * (-1236.330) (-1238.814) [-1236.331] (-1235.658) -- 0:00:45 Average standard deviation of split frequencies: 0.014545 325500 -- [-1235.445] (-1237.985) (-1235.770) (-1234.830) * (-1236.087) (-1237.249) [-1234.384] (-1235.297) -- 0:00:45 326000 -- (-1236.329) (-1235.473) (-1234.775) [-1234.532] * (-1236.050) (-1240.158) [-1235.950] (-1236.186) -- 0:00:45 326500 -- (-1237.527) (-1235.347) [-1234.976] (-1234.571) * (-1236.256) (-1237.969) [-1235.266] (-1235.420) -- 0:00:45 327000 -- (-1240.921) [-1234.240] (-1232.807) (-1235.639) * (-1235.345) (-1237.211) (-1236.405) [-1234.843] -- 0:00:45 327500 -- (-1235.353) (-1238.468) (-1234.974) [-1236.036] * (-1235.027) (-1236.437) [-1234.803] (-1235.217) -- 0:00:45 328000 -- (-1235.830) [-1237.826] (-1236.517) (-1236.562) * (-1235.578) (-1235.771) [-1237.433] (-1236.442) -- 0:00:45 328500 -- [-1236.269] (-1234.948) (-1239.418) (-1235.084) * (-1234.826) (-1234.544) (-1239.537) [-1236.466] -- 0:00:44 329000 -- (-1235.598) (-1237.987) (-1238.220) [-1237.977] * [-1236.428] (-1234.494) (-1236.554) (-1234.603) -- 0:00:44 329500 -- (-1235.985) [-1236.829] (-1237.696) (-1235.154) * [-1236.656] (-1235.716) (-1236.339) (-1237.225) -- 0:00:44 330000 -- (-1235.249) (-1236.252) [-1237.601] (-1235.226) * [-1236.181] (-1236.534) (-1236.123) (-1234.752) -- 0:00:44 Average standard deviation of split frequencies: 0.014005 330500 -- (-1235.409) [-1237.898] (-1235.697) (-1235.603) * [-1235.581] (-1235.129) (-1236.367) (-1235.587) -- 0:00:44 331000 -- [-1235.465] (-1236.325) (-1236.684) (-1237.769) * (-1237.704) [-1235.344] (-1235.259) (-1236.827) -- 0:00:44 331500 -- [-1237.160] (-1237.663) (-1238.314) (-1236.897) * (-1235.102) (-1236.141) [-1238.787] (-1234.998) -- 0:00:44 332000 -- (-1236.467) [-1237.616] (-1235.371) (-1236.977) * (-1238.045) (-1237.127) (-1241.836) [-1233.992] -- 0:00:44 332500 -- (-1239.297) (-1235.088) [-1234.732] (-1242.168) * (-1238.556) (-1235.684) (-1240.023) [-1239.415] -- 0:00:44 333000 -- (-1235.778) [-1235.079] (-1234.319) (-1242.947) * (-1236.678) (-1236.511) (-1235.032) [-1236.303] -- 0:00:44 333500 -- (-1235.825) (-1234.538) [-1233.185] (-1236.585) * (-1236.172) (-1232.828) (-1236.538) [-1236.720] -- 0:00:43 334000 -- (-1235.124) (-1238.978) (-1234.683) [-1234.102] * [-1233.972] (-1239.284) (-1237.325) (-1236.681) -- 0:00:43 334500 -- (-1235.583) [-1236.042] (-1236.968) (-1234.395) * [-1235.403] (-1238.416) (-1235.237) (-1234.163) -- 0:00:43 335000 -- (-1235.871) (-1234.504) (-1234.409) [-1234.180] * (-1237.172) (-1235.932) (-1236.498) [-1233.858] -- 0:00:43 Average standard deviation of split frequencies: 0.013205 335500 -- (-1236.918) (-1239.233) (-1234.935) [-1234.508] * (-1241.564) (-1233.702) (-1234.649) [-1235.959] -- 0:00:43 336000 -- (-1235.884) (-1237.417) (-1235.913) [-1234.140] * (-1239.085) (-1236.949) [-1235.427] (-1237.579) -- 0:00:43 336500 -- (-1235.676) (-1235.489) (-1235.080) [-1234.166] * (-1237.468) [-1234.654] (-1234.463) (-1234.307) -- 0:00:43 337000 -- (-1234.612) (-1239.310) [-1233.818] (-1237.274) * (-1235.590) (-1234.007) (-1234.242) [-1238.098] -- 0:00:43 337500 -- [-1238.313] (-1235.804) (-1237.923) (-1236.271) * (-1234.514) (-1239.722) (-1236.819) [-1234.745] -- 0:00:43 338000 -- (-1234.553) [-1235.885] (-1234.368) (-1235.284) * (-1235.211) [-1236.019] (-1237.151) (-1234.786) -- 0:00:45 338500 -- (-1235.885) (-1238.008) [-1235.550] (-1237.144) * (-1235.793) (-1235.031) (-1236.202) [-1235.423] -- 0:00:44 339000 -- [-1238.163] (-1238.328) (-1236.255) (-1233.436) * (-1236.295) [-1233.517] (-1235.524) (-1234.424) -- 0:00:44 339500 -- (-1236.826) (-1237.829) (-1234.984) [-1235.552] * [-1235.532] (-1234.823) (-1235.639) (-1234.987) -- 0:00:44 340000 -- (-1238.047) (-1237.756) [-1235.439] (-1235.997) * (-1237.082) (-1236.714) [-1235.252] (-1236.804) -- 0:00:44 Average standard deviation of split frequencies: 0.013512 340500 -- (-1235.961) (-1237.118) (-1233.352) [-1235.917] * (-1235.993) (-1237.212) [-1234.905] (-1237.723) -- 0:00:44 341000 -- (-1235.805) [-1234.542] (-1237.593) (-1234.470) * (-1235.631) (-1237.025) (-1235.589) [-1235.689] -- 0:00:44 341500 -- (-1237.082) [-1236.167] (-1234.273) (-1240.588) * (-1237.711) (-1235.489) (-1235.319) [-1237.048] -- 0:00:44 342000 -- (-1242.438) (-1239.983) (-1233.305) [-1234.484] * (-1240.066) (-1237.905) [-1235.382] (-1235.477) -- 0:00:44 342500 -- (-1239.376) [-1233.260] (-1236.427) (-1234.801) * (-1239.505) [-1233.541] (-1235.112) (-1235.401) -- 0:00:44 343000 -- (-1239.212) [-1234.552] (-1236.977) (-1237.357) * (-1237.421) (-1236.027) (-1235.076) [-1235.853] -- 0:00:44 343500 -- (-1234.978) [-1233.946] (-1233.801) (-1235.149) * [-1233.791] (-1236.042) (-1235.131) (-1239.351) -- 0:00:43 344000 -- (-1234.701) [-1234.541] (-1236.112) (-1233.402) * [-1234.297] (-1236.494) (-1236.765) (-1236.271) -- 0:00:43 344500 -- [-1234.900] (-1235.951) (-1239.418) (-1234.456) * (-1235.798) (-1235.932) (-1238.574) [-1236.929] -- 0:00:43 345000 -- (-1237.397) [-1237.347] (-1241.665) (-1235.794) * [-1235.137] (-1236.568) (-1236.064) (-1235.743) -- 0:00:43 Average standard deviation of split frequencies: 0.013624 345500 -- (-1233.730) (-1236.666) (-1236.074) [-1234.815] * (-1235.366) (-1237.217) (-1236.444) [-1234.739] -- 0:00:43 346000 -- (-1236.115) [-1235.331] (-1236.117) (-1235.030) * (-1238.800) (-1236.965) (-1237.620) [-1233.416] -- 0:00:43 346500 -- (-1237.597) (-1234.941) [-1236.747] (-1239.116) * (-1233.978) [-1234.315] (-1236.740) (-1234.723) -- 0:00:43 347000 -- (-1233.041) (-1236.906) (-1235.542) [-1235.191] * (-1234.780) (-1235.638) (-1239.483) [-1234.146] -- 0:00:43 347500 -- [-1235.367] (-1236.364) (-1234.693) (-1235.597) * [-1234.974] (-1234.446) (-1235.650) (-1233.156) -- 0:00:43 348000 -- (-1234.554) [-1234.962] (-1235.865) (-1236.269) * (-1234.950) (-1234.090) (-1235.937) [-1235.279] -- 0:00:43 348500 -- [-1235.223] (-1236.252) (-1235.946) (-1235.029) * (-1234.872) [-1237.319] (-1235.628) (-1234.494) -- 0:00:42 349000 -- [-1235.342] (-1234.220) (-1233.893) (-1235.925) * (-1236.588) [-1236.483] (-1235.581) (-1234.740) -- 0:00:42 349500 -- [-1235.874] (-1235.555) (-1233.934) (-1236.768) * (-1236.010) (-1236.914) [-1235.634] (-1236.345) -- 0:00:42 350000 -- (-1239.147) [-1234.908] (-1234.550) (-1236.002) * [-1235.971] (-1234.762) (-1236.176) (-1238.924) -- 0:00:42 Average standard deviation of split frequencies: 0.012415 350500 -- (-1235.111) (-1237.174) (-1235.304) [-1235.401] * (-1237.496) (-1238.736) (-1235.146) [-1235.260] -- 0:00:42 351000 -- (-1234.346) (-1238.463) (-1232.787) [-1235.206] * (-1239.127) (-1237.767) (-1236.568) [-1232.872] -- 0:00:42 351500 -- (-1239.767) (-1238.617) [-1233.109] (-1238.486) * (-1236.623) (-1236.297) (-1237.352) [-1234.492] -- 0:00:42 352000 -- (-1235.858) [-1234.919] (-1233.654) (-1233.172) * (-1237.310) (-1234.656) (-1234.927) [-1234.012] -- 0:00:44 352500 -- (-1238.579) (-1234.261) [-1235.467] (-1234.172) * (-1235.486) [-1236.271] (-1238.300) (-1234.835) -- 0:00:44 353000 -- (-1237.243) (-1237.000) [-1236.015] (-1237.547) * (-1235.287) (-1234.396) (-1234.767) [-1236.353] -- 0:00:43 353500 -- (-1237.030) (-1235.273) [-1236.166] (-1236.551) * (-1234.793) (-1235.182) [-1236.109] (-1234.774) -- 0:00:43 354000 -- (-1243.607) (-1237.304) (-1233.617) [-1234.468] * (-1236.071) (-1238.489) (-1234.920) [-1236.389] -- 0:00:43 354500 -- (-1241.786) (-1237.047) [-1234.574] (-1237.463) * (-1236.231) (-1236.621) (-1235.029) [-1235.717] -- 0:00:43 355000 -- (-1233.813) (-1239.902) (-1236.386) [-1240.824] * (-1238.643) [-1233.670] (-1240.894) (-1234.057) -- 0:00:43 Average standard deviation of split frequencies: 0.011918 355500 -- [-1236.515] (-1237.275) (-1238.828) (-1237.884) * (-1238.685) [-1233.302] (-1236.858) (-1236.214) -- 0:00:43 356000 -- (-1237.992) (-1238.154) [-1236.209] (-1234.560) * (-1237.879) (-1235.483) [-1233.597] (-1235.011) -- 0:00:43 356500 -- (-1235.799) (-1236.675) (-1236.519) [-1235.127] * (-1236.684) (-1238.174) [-1235.303] (-1236.083) -- 0:00:43 357000 -- (-1236.379) (-1240.100) (-1235.469) [-1234.052] * (-1235.824) [-1236.077] (-1235.628) (-1235.104) -- 0:00:43 357500 -- (-1237.516) (-1237.307) (-1236.332) [-1233.697] * (-1236.143) (-1234.837) [-1236.947] (-1234.542) -- 0:00:43 358000 -- (-1235.593) (-1235.564) (-1236.846) [-1236.120] * (-1236.761) (-1241.618) (-1237.692) [-1234.861] -- 0:00:43 358500 -- (-1235.002) [-1235.366] (-1237.008) (-1241.522) * [-1235.344] (-1241.005) (-1238.281) (-1233.496) -- 0:00:42 359000 -- [-1233.743] (-1234.761) (-1237.045) (-1235.211) * (-1237.142) [-1236.777] (-1235.895) (-1238.146) -- 0:00:42 359500 -- (-1234.448) (-1234.834) [-1235.697] (-1235.263) * [-1235.171] (-1240.721) (-1235.256) (-1236.788) -- 0:00:42 360000 -- (-1232.830) [-1234.962] (-1241.759) (-1234.827) * [-1234.280] (-1239.143) (-1235.316) (-1236.678) -- 0:00:42 Average standard deviation of split frequencies: 0.011994 360500 -- (-1237.693) (-1237.062) [-1234.978] (-1236.290) * (-1236.496) (-1239.822) [-1234.668] (-1237.190) -- 0:00:42 361000 -- (-1233.058) [-1236.069] (-1237.030) (-1234.438) * (-1237.115) [-1236.641] (-1237.111) (-1234.438) -- 0:00:42 361500 -- (-1234.337) (-1236.900) (-1239.397) [-1234.571] * (-1236.874) [-1234.319] (-1238.020) (-1235.644) -- 0:00:42 362000 -- (-1235.334) [-1234.414] (-1234.018) (-1234.885) * (-1238.705) (-1233.120) (-1237.464) [-1237.241] -- 0:00:42 362500 -- (-1234.620) (-1237.522) [-1233.376] (-1233.070) * (-1236.081) (-1234.917) [-1234.664] (-1235.267) -- 0:00:42 363000 -- [-1236.317] (-1237.645) (-1235.643) (-1236.097) * [-1236.764] (-1236.248) (-1237.166) (-1234.820) -- 0:00:42 363500 -- (-1235.845) [-1236.340] (-1235.765) (-1235.401) * (-1234.598) (-1235.360) (-1234.702) [-1233.707] -- 0:00:42 364000 -- (-1235.280) [-1235.270] (-1235.940) (-1235.194) * (-1234.802) [-1238.723] (-1236.763) (-1236.568) -- 0:00:41 364500 -- (-1237.532) (-1235.469) (-1235.525) [-1234.586] * (-1236.653) (-1242.921) (-1233.861) [-1234.979] -- 0:00:41 365000 -- [-1235.615] (-1240.050) (-1234.243) (-1238.793) * [-1235.484] (-1235.027) (-1240.049) (-1236.263) -- 0:00:41 Average standard deviation of split frequencies: 0.012350 365500 -- [-1235.119] (-1238.705) (-1237.511) (-1238.746) * [-1236.797] (-1240.333) (-1236.015) (-1235.384) -- 0:00:41 366000 -- (-1235.422) (-1240.791) (-1235.226) [-1236.821] * (-1234.570) (-1241.175) (-1234.268) [-1232.614] -- 0:00:43 366500 -- (-1234.860) (-1237.004) [-1235.890] (-1232.896) * (-1233.974) (-1237.066) (-1235.327) [-1234.192] -- 0:00:43 367000 -- [-1234.726] (-1238.280) (-1240.055) (-1234.385) * (-1235.308) (-1238.454) (-1235.577) [-1240.113] -- 0:00:43 367500 -- (-1235.402) (-1239.780) (-1236.636) [-1233.231] * [-1235.683] (-1236.211) (-1235.318) (-1237.076) -- 0:00:43 368000 -- [-1238.119] (-1234.135) (-1238.316) (-1235.128) * [-1238.810] (-1235.557) (-1235.275) (-1237.537) -- 0:00:42 368500 -- [-1233.707] (-1234.268) (-1236.615) (-1237.618) * (-1236.942) [-1234.600] (-1234.101) (-1236.361) -- 0:00:42 369000 -- (-1233.101) (-1234.899) [-1233.819] (-1238.752) * [-1234.778] (-1237.779) (-1236.397) (-1236.398) -- 0:00:42 369500 -- (-1234.769) [-1236.251] (-1234.875) (-1235.648) * [-1237.199] (-1235.376) (-1241.083) (-1235.517) -- 0:00:42 370000 -- (-1233.882) [-1235.785] (-1236.533) (-1243.968) * [-1234.853] (-1236.208) (-1235.256) (-1237.138) -- 0:00:42 Average standard deviation of split frequencies: 0.012119 370500 -- (-1237.056) (-1235.273) [-1235.001] (-1234.683) * (-1236.865) [-1239.056] (-1235.325) (-1237.005) -- 0:00:42 371000 -- [-1234.261] (-1234.087) (-1236.374) (-1238.156) * [-1242.402] (-1240.398) (-1236.105) (-1234.932) -- 0:00:42 371500 -- (-1237.118) (-1235.454) [-1235.348] (-1235.260) * [-1235.435] (-1236.319) (-1234.458) (-1233.672) -- 0:00:42 372000 -- (-1234.665) (-1239.542) (-1233.629) [-1238.580] * (-1236.402) (-1236.586) [-1236.229] (-1234.813) -- 0:00:42 372500 -- [-1233.929] (-1240.460) (-1236.185) (-1235.885) * (-1234.515) (-1237.220) (-1235.261) [-1238.862] -- 0:00:42 373000 -- (-1235.312) (-1237.513) [-1236.456] (-1238.750) * (-1234.543) (-1236.653) [-1237.600] (-1234.664) -- 0:00:42 373500 -- [-1234.556] (-1235.980) (-1237.303) (-1235.334) * [-1235.003] (-1235.270) (-1237.985) (-1234.707) -- 0:00:41 374000 -- (-1234.525) (-1235.902) [-1234.155] (-1234.399) * (-1237.843) (-1236.275) (-1238.868) [-1236.468] -- 0:00:41 374500 -- [-1234.559] (-1234.958) (-1236.624) (-1235.181) * [-1234.404] (-1237.387) (-1233.653) (-1235.917) -- 0:00:41 375000 -- (-1233.779) (-1233.570) [-1234.461] (-1236.347) * [-1234.750] (-1236.618) (-1235.271) (-1235.090) -- 0:00:41 Average standard deviation of split frequencies: 0.013422 375500 -- [-1236.612] (-1233.995) (-1235.108) (-1237.914) * (-1234.679) [-1236.141] (-1235.378) (-1235.809) -- 0:00:41 376000 -- (-1234.655) [-1234.485] (-1234.091) (-1234.124) * (-1238.987) (-1234.999) (-1235.764) [-1237.067] -- 0:00:41 376500 -- (-1235.015) (-1234.585) [-1236.072] (-1234.350) * (-1237.641) (-1235.369) (-1237.434) [-1236.861] -- 0:00:41 377000 -- (-1235.142) (-1238.938) (-1237.039) [-1239.361] * [-1236.785] (-1236.298) (-1240.733) (-1238.108) -- 0:00:41 377500 -- (-1233.691) (-1236.922) (-1236.092) [-1234.945] * [-1236.109] (-1238.007) (-1241.946) (-1236.543) -- 0:00:41 378000 -- (-1237.781) (-1236.680) (-1237.184) [-1239.146] * [-1233.948] (-1235.027) (-1236.522) (-1237.947) -- 0:00:41 378500 -- (-1237.025) (-1235.902) [-1236.819] (-1235.369) * (-1236.198) (-1236.872) (-1237.128) [-1235.303] -- 0:00:41 379000 -- [-1235.772] (-1234.072) (-1236.882) (-1235.938) * (-1239.031) [-1235.138] (-1236.864) (-1235.990) -- 0:00:40 379500 -- (-1236.539) [-1236.880] (-1239.272) (-1238.574) * (-1233.907) (-1233.257) (-1235.192) [-1236.068] -- 0:00:40 380000 -- (-1237.141) (-1235.789) [-1237.612] (-1238.277) * (-1232.190) (-1235.087) (-1235.532) [-1235.524] -- 0:00:42 Average standard deviation of split frequencies: 0.013913 380500 -- (-1239.791) [-1238.064] (-1236.643) (-1238.349) * (-1233.070) [-1235.259] (-1236.152) (-1236.290) -- 0:00:42 381000 -- (-1233.570) [-1237.719] (-1236.687) (-1238.295) * [-1235.563] (-1235.138) (-1239.060) (-1237.060) -- 0:00:42 381500 -- (-1235.625) [-1236.522] (-1237.164) (-1236.547) * (-1236.023) (-1235.488) (-1237.005) [-1237.469] -- 0:00:42 382000 -- (-1236.380) [-1234.405] (-1233.816) (-1238.163) * (-1240.664) [-1236.874] (-1235.424) (-1235.042) -- 0:00:42 382500 -- [-1234.533] (-1235.688) (-1236.741) (-1238.034) * (-1235.378) (-1237.118) [-1234.017] (-1239.916) -- 0:00:41 383000 -- [-1237.205] (-1235.295) (-1236.774) (-1235.273) * (-1234.379) (-1236.478) [-1233.196] (-1235.080) -- 0:00:41 383500 -- (-1236.518) [-1234.862] (-1236.088) (-1234.551) * (-1236.058) [-1234.872] (-1240.818) (-1234.703) -- 0:00:41 384000 -- (-1236.224) (-1234.701) [-1236.762] (-1239.331) * (-1235.301) (-1236.440) [-1234.776] (-1234.801) -- 0:00:41 384500 -- (-1238.975) (-1235.093) [-1236.375] (-1234.927) * [-1236.022] (-1240.864) (-1236.106) (-1235.942) -- 0:00:41 385000 -- (-1235.200) [-1233.580] (-1240.330) (-1239.896) * [-1236.326] (-1238.445) (-1235.497) (-1235.364) -- 0:00:41 Average standard deviation of split frequencies: 0.013865 385500 -- [-1233.870] (-1233.155) (-1234.004) (-1236.428) * (-1235.640) (-1233.887) (-1238.898) [-1236.518] -- 0:00:41 386000 -- (-1236.625) [-1233.813] (-1234.103) (-1236.726) * (-1241.016) [-1234.468] (-1239.787) (-1236.055) -- 0:00:41 386500 -- (-1235.620) [-1235.279] (-1234.428) (-1236.564) * (-1239.345) (-1234.265) (-1236.011) [-1236.059] -- 0:00:41 387000 -- [-1238.168] (-1235.312) (-1235.820) (-1235.399) * [-1240.786] (-1234.295) (-1236.849) (-1236.419) -- 0:00:41 387500 -- (-1236.760) [-1234.877] (-1234.609) (-1237.112) * (-1237.698) [-1233.163] (-1236.820) (-1235.358) -- 0:00:41 388000 -- (-1237.181) [-1232.940] (-1235.004) (-1236.185) * (-1240.916) [-1236.726] (-1238.818) (-1236.294) -- 0:00:41 388500 -- [-1233.045] (-1233.666) (-1237.481) (-1232.879) * (-1236.795) (-1236.700) (-1238.096) [-1235.884] -- 0:00:40 389000 -- [-1235.140] (-1234.415) (-1242.244) (-1241.096) * (-1238.328) (-1237.227) (-1236.726) [-1233.645] -- 0:00:40 389500 -- (-1236.991) [-1235.445] (-1235.609) (-1236.084) * (-1233.324) [-1238.876] (-1234.053) (-1234.393) -- 0:00:40 390000 -- (-1232.572) (-1236.215) [-1239.527] (-1236.639) * (-1234.695) (-1239.662) [-1235.235] (-1236.310) -- 0:00:40 Average standard deviation of split frequencies: 0.014028 390500 -- (-1235.898) (-1233.327) (-1232.949) [-1237.769] * [-1234.817] (-1240.072) (-1233.321) (-1236.747) -- 0:00:40 391000 -- (-1235.701) (-1232.716) [-1235.396] (-1237.822) * (-1236.626) [-1236.557] (-1235.795) (-1239.003) -- 0:00:40 391500 -- [-1235.450] (-1235.672) (-1238.193) (-1234.753) * (-1235.088) (-1237.454) [-1236.106] (-1238.307) -- 0:00:40 392000 -- (-1238.888) [-1232.847] (-1233.289) (-1235.169) * [-1235.392] (-1236.518) (-1235.368) (-1239.394) -- 0:00:40 392500 -- [-1234.539] (-1233.337) (-1234.085) (-1235.155) * [-1236.043] (-1233.902) (-1235.839) (-1239.054) -- 0:00:40 393000 -- (-1237.130) (-1233.260) (-1234.873) [-1237.522] * [-1233.011] (-1234.898) (-1234.867) (-1235.663) -- 0:00:40 393500 -- (-1236.838) [-1233.174] (-1232.885) (-1234.499) * [-1237.978] (-1235.644) (-1235.231) (-1239.118) -- 0:00:40 394000 -- (-1236.212) (-1235.870) [-1236.241] (-1233.759) * (-1236.648) (-1235.627) (-1236.176) [-1235.651] -- 0:00:41 394500 -- (-1235.545) [-1232.547] (-1234.252) (-1237.202) * (-1236.557) [-1234.658] (-1235.405) (-1236.322) -- 0:00:41 395000 -- (-1236.230) (-1234.201) (-1234.736) [-1236.223] * (-1236.487) (-1235.860) [-1236.042] (-1235.592) -- 0:00:41 Average standard deviation of split frequencies: 0.013615 395500 -- (-1237.588) [-1236.714] (-1236.837) (-1235.092) * (-1236.645) (-1233.783) (-1234.297) [-1235.784] -- 0:00:41 396000 -- (-1241.614) [-1236.173] (-1237.271) (-1233.839) * (-1233.473) (-1236.204) [-1234.488] (-1233.620) -- 0:00:41 396500 -- [-1238.870] (-1239.021) (-1234.068) (-1231.810) * [-1233.250] (-1234.242) (-1237.821) (-1235.634) -- 0:00:41 397000 -- (-1238.457) (-1235.840) (-1236.533) [-1235.295] * [-1236.020] (-1233.931) (-1235.998) (-1237.721) -- 0:00:41 397500 -- (-1237.774) [-1234.831] (-1236.869) (-1234.019) * (-1233.098) [-1236.089] (-1235.090) (-1234.802) -- 0:00:40 398000 -- (-1235.731) (-1234.480) [-1237.039] (-1235.257) * (-1237.229) (-1236.395) [-1237.692] (-1232.445) -- 0:00:40 398500 -- (-1235.334) (-1233.104) (-1234.752) [-1233.329] * (-1235.345) (-1234.433) [-1238.552] (-1234.869) -- 0:00:40 399000 -- (-1235.032) (-1237.470) (-1234.728) [-1235.924] * (-1235.360) (-1233.889) (-1237.158) [-1235.371] -- 0:00:40 399500 -- (-1236.032) (-1236.175) (-1238.455) [-1237.278] * (-1236.969) (-1240.119) (-1237.442) [-1233.513] -- 0:00:40 400000 -- (-1234.964) [-1234.164] (-1235.176) (-1239.117) * [-1234.037] (-1238.864) (-1236.638) (-1241.283) -- 0:00:40 Average standard deviation of split frequencies: 0.013236 400500 -- (-1235.552) [-1234.028] (-1237.748) (-1239.170) * (-1233.923) (-1235.402) (-1235.188) [-1235.698] -- 0:00:40 401000 -- (-1239.434) [-1235.262] (-1236.759) (-1236.128) * (-1236.392) (-1236.589) [-1233.950] (-1234.338) -- 0:00:40 401500 -- (-1236.233) (-1234.275) (-1242.367) [-1235.118] * (-1233.713) (-1238.829) [-1234.494] (-1233.847) -- 0:00:40 402000 -- (-1235.708) [-1236.327] (-1237.303) (-1239.300) * (-1236.952) [-1235.648] (-1232.983) (-1236.571) -- 0:00:40 402500 -- (-1238.113) [-1237.300] (-1239.435) (-1234.932) * [-1236.587] (-1234.944) (-1235.213) (-1235.335) -- 0:00:40 403000 -- (-1237.511) (-1235.085) (-1235.238) [-1235.827] * [-1236.323] (-1235.989) (-1236.100) (-1236.760) -- 0:00:39 403500 -- [-1234.441] (-1236.967) (-1234.267) (-1236.855) * (-1236.895) (-1236.110) [-1238.146] (-1238.174) -- 0:00:39 404000 -- (-1235.846) [-1235.538] (-1235.224) (-1236.394) * (-1236.484) [-1233.913] (-1233.466) (-1234.333) -- 0:00:39 404500 -- (-1236.656) (-1235.986) [-1237.268] (-1235.249) * (-1235.972) (-1233.980) (-1235.488) [-1235.352] -- 0:00:39 405000 -- (-1235.394) [-1236.669] (-1234.016) (-1238.798) * (-1234.517) (-1235.083) (-1234.963) [-1232.528] -- 0:00:39 Average standard deviation of split frequencies: 0.012089 405500 -- (-1235.607) (-1234.408) [-1237.449] (-1240.715) * (-1238.479) (-1240.425) [-1235.073] (-1233.979) -- 0:00:39 406000 -- (-1237.107) (-1239.175) [-1236.435] (-1237.500) * (-1237.110) [-1234.539] (-1237.717) (-1235.037) -- 0:00:39 406500 -- [-1235.189] (-1234.935) (-1236.765) (-1237.511) * [-1235.163] (-1236.523) (-1239.315) (-1234.413) -- 0:00:39 407000 -- [-1233.494] (-1236.192) (-1240.217) (-1235.260) * (-1233.437) (-1234.622) (-1236.931) [-1235.777] -- 0:00:39 407500 -- (-1235.848) (-1237.728) [-1234.750] (-1237.145) * (-1235.278) (-1236.193) (-1234.940) [-1235.115] -- 0:00:39 408000 -- [-1235.865] (-1234.917) (-1232.719) (-1244.847) * (-1237.363) [-1235.914] (-1234.849) (-1235.145) -- 0:00:39 408500 -- (-1235.846) (-1236.763) (-1235.164) [-1236.014] * (-1237.287) [-1236.518] (-1235.272) (-1232.613) -- 0:00:40 409000 -- (-1237.343) (-1235.668) [-1233.660] (-1236.744) * (-1236.021) [-1235.196] (-1235.513) (-1238.055) -- 0:00:40 409500 -- (-1235.277) (-1235.840) (-1233.032) [-1233.980] * (-1236.799) (-1234.548) (-1235.533) [-1234.701] -- 0:00:40 410000 -- (-1237.017) (-1238.409) (-1233.075) [-1236.260] * (-1239.110) [-1235.031] (-1235.901) (-1233.560) -- 0:00:40 Average standard deviation of split frequencies: 0.011817 410500 -- [-1237.002] (-1236.303) (-1237.459) (-1234.516) * (-1236.455) (-1235.145) (-1235.216) [-1233.856] -- 0:00:40 411000 -- (-1232.863) (-1235.433) [-1237.270] (-1235.709) * (-1239.465) (-1235.220) (-1239.077) [-1239.449] -- 0:00:40 411500 -- (-1235.343) (-1235.368) [-1235.539] (-1237.169) * (-1240.199) [-1236.500] (-1239.243) (-1232.916) -- 0:00:40 412000 -- (-1237.258) (-1235.034) [-1239.602] (-1237.346) * (-1237.904) [-1237.977] (-1236.502) (-1235.154) -- 0:00:39 412500 -- [-1237.011] (-1237.323) (-1242.349) (-1234.340) * (-1236.664) (-1243.461) (-1234.564) [-1237.320] -- 0:00:39 413000 -- (-1234.981) (-1237.184) (-1236.400) [-1237.039] * (-1238.286) (-1234.109) (-1236.522) [-1236.803] -- 0:00:39 413500 -- (-1233.986) (-1236.485) (-1237.270) [-1233.666] * (-1236.020) (-1234.872) [-1235.432] (-1235.012) -- 0:00:39 414000 -- (-1238.713) [-1236.473] (-1234.913) (-1235.286) * (-1234.217) (-1233.686) (-1234.531) [-1235.153] -- 0:00:39 414500 -- (-1237.500) [-1235.081] (-1237.216) (-1236.244) * (-1234.650) [-1234.675] (-1234.466) (-1239.000) -- 0:00:39 415000 -- (-1237.067) [-1234.591] (-1236.384) (-1235.712) * (-1237.071) (-1236.394) [-1234.625] (-1234.989) -- 0:00:39 Average standard deviation of split frequencies: 0.012198 415500 -- [-1235.082] (-1236.885) (-1234.731) (-1235.705) * [-1234.706] (-1236.037) (-1237.099) (-1235.405) -- 0:00:39 416000 -- (-1235.363) (-1238.769) (-1236.641) [-1233.903] * (-1234.092) [-1232.674] (-1237.327) (-1237.446) -- 0:00:39 416500 -- [-1234.979] (-1236.661) (-1233.475) (-1234.781) * [-1236.110] (-1234.792) (-1233.011) (-1235.792) -- 0:00:39 417000 -- (-1234.888) (-1236.304) (-1235.151) [-1234.941] * (-1235.973) (-1233.150) (-1233.294) [-1235.614] -- 0:00:39 417500 -- (-1234.919) (-1235.677) (-1234.357) [-1233.221] * (-1236.399) (-1237.393) [-1233.304] (-1235.907) -- 0:00:39 418000 -- (-1236.436) (-1236.644) [-1234.215] (-1238.071) * (-1237.918) (-1235.908) (-1236.191) [-1236.218] -- 0:00:38 418500 -- (-1234.687) [-1240.337] (-1233.116) (-1236.714) * [-1234.189] (-1238.484) (-1237.049) (-1235.246) -- 0:00:38 419000 -- (-1238.234) [-1233.402] (-1239.302) (-1234.420) * (-1232.581) (-1236.032) (-1238.536) [-1235.224] -- 0:00:38 419500 -- [-1236.082] (-1235.666) (-1236.832) (-1236.696) * (-1235.122) [-1236.914] (-1235.860) (-1235.403) -- 0:00:38 420000 -- (-1236.845) [-1235.554] (-1236.126) (-1234.989) * [-1237.511] (-1237.212) (-1233.813) (-1235.086) -- 0:00:38 Average standard deviation of split frequencies: 0.012397 420500 -- (-1235.561) (-1236.203) [-1235.985] (-1237.904) * (-1236.020) (-1235.960) [-1234.605] (-1235.185) -- 0:00:38 421000 -- (-1239.669) (-1236.163) [-1238.030] (-1237.826) * (-1238.140) (-1236.382) (-1235.671) [-1236.792] -- 0:00:38 421500 -- (-1236.763) (-1241.135) [-1239.094] (-1235.341) * (-1233.368) (-1234.149) [-1236.244] (-1233.817) -- 0:00:38 422000 -- [-1234.956] (-1238.612) (-1235.837) (-1235.368) * (-1234.616) [-1234.959] (-1239.050) (-1237.119) -- 0:00:38 422500 -- (-1235.505) (-1236.814) [-1233.794] (-1238.440) * (-1236.705) (-1237.551) [-1235.829] (-1237.701) -- 0:00:39 423000 -- (-1235.102) (-1234.279) (-1235.626) [-1235.170] * [-1236.435] (-1235.718) (-1237.237) (-1237.057) -- 0:00:39 423500 -- (-1238.321) (-1237.803) [-1234.577] (-1237.158) * [-1235.317] (-1235.854) (-1241.543) (-1237.276) -- 0:00:39 424000 -- [-1234.988] (-1239.820) (-1240.487) (-1237.104) * (-1241.690) (-1236.877) (-1238.856) [-1236.148] -- 0:00:39 424500 -- [-1237.670] (-1237.835) (-1234.277) (-1234.060) * [-1236.229] (-1234.685) (-1234.881) (-1236.725) -- 0:00:39 425000 -- (-1238.375) [-1235.708] (-1233.631) (-1234.093) * (-1236.191) (-1234.119) [-1234.639] (-1235.303) -- 0:00:39 Average standard deviation of split frequencies: 0.010740 425500 -- [-1235.480] (-1234.638) (-1233.383) (-1236.868) * (-1235.448) (-1235.998) (-1235.448) [-1236.238] -- 0:00:39 426000 -- (-1232.882) [-1234.979] (-1233.541) (-1238.278) * (-1236.819) [-1233.800] (-1235.928) (-1235.409) -- 0:00:39 426500 -- [-1234.800] (-1234.937) (-1235.209) (-1235.167) * (-1239.668) [-1233.151] (-1236.893) (-1238.243) -- 0:00:38 427000 -- (-1234.284) [-1234.535] (-1238.968) (-1235.092) * (-1234.863) (-1234.669) (-1238.252) [-1241.938] -- 0:00:38 427500 -- (-1234.565) [-1236.817] (-1234.342) (-1235.582) * (-1234.775) (-1235.261) [-1234.442] (-1239.192) -- 0:00:38 428000 -- (-1236.699) (-1237.809) (-1235.900) [-1233.969] * (-1233.450) (-1237.220) (-1235.706) [-1237.022] -- 0:00:38 428500 -- [-1234.880] (-1236.059) (-1235.442) (-1234.820) * (-1236.067) (-1238.374) (-1234.829) [-1238.295] -- 0:00:38 429000 -- (-1236.126) (-1237.013) [-1234.505] (-1238.002) * (-1235.692) (-1233.185) (-1237.254) [-1236.453] -- 0:00:38 429500 -- (-1236.103) [-1234.798] (-1237.035) (-1234.052) * [-1236.132] (-1237.219) (-1235.346) (-1237.444) -- 0:00:38 430000 -- [-1236.358] (-1238.336) (-1236.917) (-1235.709) * [-1237.060] (-1242.162) (-1234.981) (-1233.386) -- 0:00:38 Average standard deviation of split frequencies: 0.011288 430500 -- (-1233.567) (-1237.191) [-1233.986] (-1236.224) * [-1235.362] (-1238.823) (-1235.046) (-1237.062) -- 0:00:38 431000 -- (-1236.438) (-1236.682) [-1235.664] (-1236.540) * (-1234.479) [-1234.310] (-1237.716) (-1239.790) -- 0:00:38 431500 -- (-1233.940) (-1237.655) [-1235.728] (-1238.212) * [-1235.038] (-1238.158) (-1248.724) (-1239.677) -- 0:00:38 432000 -- (-1233.435) (-1237.356) [-1233.160] (-1234.872) * (-1235.825) (-1236.252) [-1238.700] (-1236.351) -- 0:00:38 432500 -- [-1232.870] (-1236.667) (-1233.826) (-1235.930) * [-1238.377] (-1236.379) (-1235.650) (-1239.099) -- 0:00:38 433000 -- (-1232.884) [-1234.808] (-1233.251) (-1235.610) * (-1239.395) (-1238.345) (-1235.611) [-1236.625] -- 0:00:37 433500 -- (-1233.820) (-1236.391) [-1240.309] (-1239.375) * [-1237.553] (-1237.250) (-1237.987) (-1234.854) -- 0:00:37 434000 -- (-1235.814) [-1236.392] (-1235.554) (-1239.229) * (-1234.785) [-1240.331] (-1240.509) (-1239.063) -- 0:00:37 434500 -- (-1238.672) (-1237.003) (-1234.565) [-1235.689] * (-1234.518) [-1237.493] (-1235.659) (-1238.378) -- 0:00:37 435000 -- (-1234.595) [-1236.983] (-1232.615) (-1234.434) * (-1238.251) (-1237.964) (-1235.385) [-1234.360] -- 0:00:37 Average standard deviation of split frequencies: 0.010677 435500 -- (-1236.404) [-1234.788] (-1236.088) (-1236.317) * (-1238.455) [-1236.660] (-1238.271) (-1234.898) -- 0:00:37 436000 -- (-1237.962) [-1236.139] (-1234.781) (-1236.185) * [-1233.748] (-1233.985) (-1238.890) (-1237.691) -- 0:00:37 436500 -- (-1237.977) (-1234.376) (-1235.136) [-1233.787] * (-1235.419) (-1236.995) [-1235.435] (-1235.751) -- 0:00:37 437000 -- (-1240.465) [-1236.090] (-1238.888) (-1236.209) * (-1236.366) [-1237.603] (-1239.114) (-1239.063) -- 0:00:38 437500 -- (-1234.177) (-1242.029) (-1234.571) [-1235.445] * (-1237.337) [-1234.894] (-1238.464) (-1235.122) -- 0:00:38 438000 -- [-1235.589] (-1243.513) (-1233.281) (-1233.978) * (-1234.223) (-1234.161) (-1237.196) [-1235.371] -- 0:00:38 438500 -- (-1235.823) [-1237.647] (-1240.856) (-1234.460) * (-1239.780) (-1234.232) (-1237.977) [-1234.611] -- 0:00:38 439000 -- (-1237.364) (-1236.385) [-1234.473] (-1234.947) * [-1235.984] (-1233.109) (-1237.296) (-1233.446) -- 0:00:38 439500 -- [-1234.627] (-1236.892) (-1234.620) (-1237.349) * (-1236.493) [-1238.314] (-1238.086) (-1232.572) -- 0:00:38 440000 -- (-1235.546) [-1235.761] (-1236.251) (-1244.588) * (-1236.849) (-1238.939) [-1234.749] (-1234.692) -- 0:00:38 Average standard deviation of split frequencies: 0.010564 440500 -- [-1235.157] (-1234.452) (-1235.510) (-1239.721) * (-1236.933) (-1235.226) (-1233.824) [-1238.199] -- 0:00:38 441000 -- [-1236.407] (-1233.544) (-1237.110) (-1235.278) * (-1233.074) [-1237.385] (-1235.739) (-1234.018) -- 0:00:38 441500 -- (-1235.162) [-1234.420] (-1234.931) (-1235.216) * (-1233.695) [-1234.522] (-1235.659) (-1234.757) -- 0:00:37 442000 -- [-1235.078] (-1235.295) (-1235.290) (-1235.111) * [-1238.483] (-1236.173) (-1235.022) (-1237.335) -- 0:00:37 442500 -- (-1237.584) (-1238.166) [-1234.559] (-1234.948) * (-1237.828) [-1235.919] (-1235.460) (-1237.533) -- 0:00:37 443000 -- (-1237.200) (-1235.108) [-1234.306] (-1237.376) * [-1241.749] (-1236.341) (-1236.413) (-1237.716) -- 0:00:37 443500 -- (-1236.940) (-1234.659) [-1234.065] (-1235.998) * (-1237.206) [-1236.276] (-1238.511) (-1235.896) -- 0:00:37 444000 -- (-1233.282) (-1235.234) [-1236.941] (-1238.242) * (-1236.786) (-1239.027) (-1238.014) [-1240.512] -- 0:00:37 444500 -- (-1236.301) (-1238.541) (-1235.770) [-1235.311] * [-1236.905] (-1236.257) (-1237.169) (-1236.388) -- 0:00:37 445000 -- (-1239.299) [-1237.183] (-1236.693) (-1235.765) * (-1237.662) (-1235.478) (-1237.376) [-1235.031] -- 0:00:37 Average standard deviation of split frequencies: 0.010570 445500 -- [-1234.978] (-1238.100) (-1235.814) (-1237.015) * [-1236.634] (-1238.238) (-1235.238) (-1237.420) -- 0:00:37 446000 -- (-1236.931) (-1237.810) [-1235.089] (-1236.472) * [-1234.207] (-1236.005) (-1235.621) (-1237.154) -- 0:00:37 446500 -- (-1238.711) (-1235.697) [-1239.666] (-1236.231) * (-1234.802) (-1237.086) [-1236.996] (-1235.368) -- 0:00:37 447000 -- (-1238.574) [-1234.187] (-1240.157) (-1236.969) * (-1235.369) [-1235.581] (-1236.773) (-1237.198) -- 0:00:37 447500 -- (-1237.297) (-1232.562) [-1238.028] (-1236.196) * (-1235.103) [-1235.617] (-1236.633) (-1233.207) -- 0:00:37 448000 -- (-1234.427) (-1233.504) (-1238.907) [-1235.587] * (-1237.074) (-1235.493) (-1235.805) [-1234.383] -- 0:00:36 448500 -- (-1234.610) [-1233.418] (-1234.083) (-1237.328) * (-1234.043) [-1235.448] (-1236.320) (-1236.194) -- 0:00:36 449000 -- [-1235.222] (-1233.790) (-1234.367) (-1236.440) * (-1234.764) [-1236.481] (-1234.439) (-1238.606) -- 0:00:36 449500 -- (-1234.838) (-1236.391) [-1234.953] (-1238.756) * (-1232.753) (-1235.438) (-1236.098) [-1236.789] -- 0:00:36 450000 -- (-1235.240) (-1236.496) [-1236.621] (-1238.560) * [-1234.937] (-1236.376) (-1235.053) (-1234.728) -- 0:00:36 Average standard deviation of split frequencies: 0.010460 450500 -- (-1237.659) [-1233.434] (-1237.534) (-1239.570) * [-1236.894] (-1240.508) (-1234.467) (-1234.037) -- 0:00:37 451000 -- (-1233.381) [-1234.592] (-1239.116) (-1244.414) * (-1235.856) (-1234.346) (-1235.475) [-1236.132] -- 0:00:37 451500 -- (-1234.551) (-1235.014) (-1233.326) [-1237.865] * [-1236.030] (-1235.818) (-1234.099) (-1234.976) -- 0:00:37 452000 -- (-1235.229) [-1232.899] (-1233.991) (-1244.071) * [-1234.791] (-1235.039) (-1236.508) (-1234.516) -- 0:00:37 452500 -- (-1234.461) (-1234.465) [-1234.538] (-1241.000) * (-1235.474) [-1233.701] (-1236.672) (-1236.990) -- 0:00:37 453000 -- (-1234.942) [-1233.372] (-1234.988) (-1234.920) * (-1236.400) (-1235.215) [-1235.608] (-1234.629) -- 0:00:37 453500 -- (-1237.283) (-1233.239) [-1234.954] (-1236.456) * (-1237.239) (-1234.351) (-1243.042) [-1236.110] -- 0:00:37 454000 -- (-1234.827) [-1237.711] (-1237.208) (-1235.060) * (-1237.702) (-1234.604) (-1236.542) [-1235.795] -- 0:00:37 454500 -- (-1238.938) [-1233.821] (-1237.504) (-1241.676) * (-1234.777) [-1235.724] (-1236.708) (-1235.711) -- 0:00:37 455000 -- [-1234.192] (-1234.519) (-1235.566) (-1237.224) * [-1232.808] (-1235.693) (-1235.235) (-1236.688) -- 0:00:37 Average standard deviation of split frequencies: 0.010984 455500 -- [-1236.017] (-1234.621) (-1238.927) (-1234.133) * [-1235.272] (-1237.570) (-1235.729) (-1236.582) -- 0:00:37 456000 -- (-1233.094) (-1237.063) [-1235.406] (-1235.981) * [-1235.876] (-1236.174) (-1236.068) (-1236.208) -- 0:00:36 456500 -- (-1234.381) [-1234.658] (-1236.688) (-1241.655) * (-1236.535) [-1237.689] (-1236.581) (-1234.946) -- 0:00:36 457000 -- (-1235.172) (-1234.284) [-1237.759] (-1234.630) * (-1236.735) [-1234.902] (-1237.013) (-1233.620) -- 0:00:36 457500 -- (-1235.423) (-1236.114) [-1234.626] (-1238.781) * (-1236.547) [-1234.875] (-1237.519) (-1236.292) -- 0:00:36 458000 -- (-1233.944) [-1235.758] (-1239.134) (-1234.700) * (-1236.504) (-1235.039) [-1236.718] (-1235.520) -- 0:00:36 458500 -- (-1233.385) (-1236.399) (-1233.465) [-1237.586] * (-1235.172) (-1236.239) [-1236.326] (-1236.568) -- 0:00:36 459000 -- (-1233.678) (-1235.768) [-1235.941] (-1236.071) * [-1234.928] (-1236.153) (-1237.238) (-1234.890) -- 0:00:36 459500 -- [-1235.225] (-1235.750) (-1236.767) (-1235.070) * (-1235.441) (-1236.806) (-1237.083) [-1239.847] -- 0:00:36 460000 -- (-1236.429) [-1236.141] (-1235.124) (-1235.424) * [-1234.176] (-1234.145) (-1235.033) (-1241.351) -- 0:00:36 Average standard deviation of split frequencies: 0.010489 460500 -- [-1234.419] (-1235.365) (-1235.513) (-1235.246) * (-1234.462) [-1234.990] (-1236.649) (-1235.147) -- 0:00:36 461000 -- (-1234.431) (-1236.241) [-1234.195] (-1237.449) * [-1235.137] (-1234.557) (-1236.344) (-1236.006) -- 0:00:36 461500 -- (-1236.306) (-1233.762) [-1235.060] (-1234.913) * (-1238.932) (-1239.142) (-1237.642) [-1237.537] -- 0:00:36 462000 -- [-1237.797] (-1234.493) (-1234.523) (-1237.691) * (-1241.885) (-1234.650) [-1234.545] (-1237.513) -- 0:00:36 462500 -- [-1234.469] (-1233.653) (-1236.915) (-1236.293) * (-1235.283) (-1234.591) [-1235.490] (-1235.115) -- 0:00:36 463000 -- (-1233.939) (-1236.782) (-1234.980) [-1238.931] * [-1234.751] (-1234.731) (-1236.233) (-1236.985) -- 0:00:35 463500 -- (-1238.089) [-1236.298] (-1236.804) (-1235.375) * (-1238.582) (-1237.921) [-1236.800] (-1236.389) -- 0:00:35 464000 -- (-1233.672) (-1236.778) (-1235.816) [-1235.491] * (-1236.401) (-1236.567) [-1237.759] (-1235.971) -- 0:00:35 464500 -- [-1235.753] (-1238.114) (-1235.147) (-1235.740) * (-1234.879) (-1234.718) (-1239.065) [-1236.274] -- 0:00:35 465000 -- [-1235.423] (-1237.120) (-1237.873) (-1234.933) * [-1239.474] (-1235.008) (-1233.803) (-1235.752) -- 0:00:36 Average standard deviation of split frequencies: 0.009863 465500 -- (-1234.002) [-1234.513] (-1237.331) (-1240.189) * (-1237.147) (-1236.417) [-1234.069] (-1235.653) -- 0:00:36 466000 -- (-1236.966) [-1235.810] (-1235.571) (-1234.573) * (-1233.814) (-1235.021) (-1234.608) [-1234.656] -- 0:00:36 466500 -- (-1241.519) (-1238.142) [-1236.987] (-1235.877) * [-1234.608] (-1233.829) (-1237.246) (-1235.340) -- 0:00:36 467000 -- (-1236.836) [-1235.721] (-1240.108) (-1235.173) * (-1237.205) (-1234.770) [-1235.025] (-1236.825) -- 0:00:36 467500 -- (-1236.856) [-1235.670] (-1240.835) (-1240.872) * (-1235.337) (-1238.105) [-1236.698] (-1237.537) -- 0:00:36 468000 -- (-1235.936) (-1235.715) [-1233.456] (-1235.034) * (-1234.752) [-1235.872] (-1236.915) (-1234.801) -- 0:00:36 468500 -- (-1236.805) (-1235.647) [-1234.887] (-1236.746) * (-1236.183) (-1234.775) [-1238.102] (-1235.304) -- 0:00:36 469000 -- (-1234.108) [-1235.041] (-1235.159) (-1232.794) * (-1235.513) [-1236.015] (-1235.200) (-1236.039) -- 0:00:36 469500 -- (-1236.044) (-1234.599) [-1234.699] (-1242.399) * [-1238.953] (-1234.377) (-1235.224) (-1235.737) -- 0:00:36 470000 -- [-1234.991] (-1236.580) (-1236.079) (-1232.934) * (-1240.208) (-1234.298) [-1234.318] (-1235.426) -- 0:00:36 Average standard deviation of split frequencies: 0.009828 470500 -- (-1238.255) (-1237.167) [-1232.834] (-1234.761) * (-1234.512) [-1235.012] (-1239.962) (-1235.416) -- 0:00:36 471000 -- (-1234.322) (-1237.623) (-1236.271) [-1233.880] * (-1234.780) [-1236.933] (-1237.552) (-1235.806) -- 0:00:35 471500 -- (-1235.339) [-1237.185] (-1238.012) (-1234.474) * (-1235.299) (-1236.269) [-1236.088] (-1234.997) -- 0:00:35 472000 -- [-1235.998] (-1235.199) (-1235.297) (-1232.694) * (-1235.817) (-1238.702) [-1236.048] (-1236.003) -- 0:00:35 472500 -- [-1233.731] (-1240.426) (-1243.015) (-1236.038) * [-1234.144] (-1233.320) (-1237.948) (-1234.666) -- 0:00:35 473000 -- (-1238.824) (-1240.772) (-1237.352) [-1235.237] * (-1235.569) (-1235.453) [-1234.873] (-1233.730) -- 0:00:35 473500 -- (-1234.932) (-1242.294) (-1239.203) [-1236.006] * (-1234.352) (-1234.425) (-1235.399) [-1235.527] -- 0:00:35 474000 -- [-1236.013] (-1239.727) (-1234.433) (-1241.468) * (-1235.737) [-1236.861] (-1235.776) (-1239.745) -- 0:00:35 474500 -- [-1234.933] (-1234.800) (-1234.681) (-1241.169) * (-1240.103) (-1235.736) (-1236.570) [-1237.426] -- 0:00:35 475000 -- (-1238.318) (-1235.767) [-1236.593] (-1235.482) * (-1234.653) (-1237.077) (-1236.196) [-1244.554] -- 0:00:35 Average standard deviation of split frequencies: 0.008913 475500 -- (-1237.308) (-1239.287) [-1236.490] (-1235.739) * (-1233.562) (-1238.170) [-1234.457] (-1237.564) -- 0:00:35 476000 -- [-1234.434] (-1236.955) (-1236.902) (-1235.108) * (-1235.205) [-1237.187] (-1236.705) (-1235.683) -- 0:00:35 476500 -- (-1237.109) (-1234.305) [-1235.885] (-1241.093) * (-1236.571) (-1235.981) (-1234.465) [-1235.037] -- 0:00:35 477000 -- (-1239.508) [-1236.546] (-1235.346) (-1238.649) * (-1236.402) (-1236.141) [-1233.638] (-1236.019) -- 0:00:35 477500 -- [-1235.363] (-1234.608) (-1234.901) (-1235.850) * (-1238.934) [-1235.038] (-1233.612) (-1233.966) -- 0:00:35 478000 -- (-1234.969) (-1234.967) [-1234.681] (-1235.795) * (-1238.142) (-1236.279) [-1235.313] (-1234.466) -- 0:00:34 478500 -- (-1234.026) (-1234.873) [-1236.001] (-1243.280) * [-1234.319] (-1235.305) (-1233.922) (-1233.891) -- 0:00:34 479000 -- (-1236.570) [-1236.183] (-1239.333) (-1234.946) * (-1235.779) (-1235.616) (-1236.629) [-1235.114] -- 0:00:35 479500 -- (-1235.903) (-1234.346) [-1237.215] (-1239.290) * [-1235.594] (-1236.032) (-1237.059) (-1234.854) -- 0:00:35 480000 -- (-1237.700) (-1235.620) (-1238.444) [-1234.386] * (-1234.607) [-1233.906] (-1238.914) (-1234.753) -- 0:00:35 Average standard deviation of split frequencies: 0.009317 480500 -- (-1234.576) [-1238.280] (-1236.128) (-1233.716) * (-1237.734) (-1234.544) (-1235.748) [-1234.602] -- 0:00:35 481000 -- (-1233.050) [-1236.526] (-1235.645) (-1238.942) * (-1237.299) (-1235.736) (-1234.473) [-1235.030] -- 0:00:35 481500 -- (-1236.462) (-1238.062) (-1237.129) [-1239.110] * (-1237.427) [-1236.981] (-1239.091) (-1236.732) -- 0:00:35 482000 -- (-1235.221) (-1237.275) [-1234.644] (-1237.255) * (-1238.318) (-1242.180) (-1238.984) [-1239.696] -- 0:00:35 482500 -- (-1236.294) (-1238.221) [-1236.369] (-1237.666) * (-1239.463) (-1236.782) (-1238.648) [-1233.728] -- 0:00:35 483000 -- (-1236.995) (-1237.570) (-1237.158) [-1234.387] * [-1237.169] (-1238.596) (-1235.234) (-1236.446) -- 0:00:35 483500 -- (-1237.269) (-1238.118) (-1235.825) [-1234.315] * (-1233.321) (-1240.113) (-1238.719) [-1236.451] -- 0:00:35 484000 -- (-1239.069) (-1246.713) (-1236.043) [-1237.334] * (-1234.952) (-1239.109) [-1235.652] (-1235.715) -- 0:00:35 484500 -- (-1235.456) (-1236.613) (-1235.411) [-1234.652] * (-1235.005) [-1237.787] (-1235.817) (-1235.463) -- 0:00:35 485000 -- (-1238.551) (-1236.459) (-1238.033) [-1237.004] * [-1234.815] (-1234.250) (-1234.723) (-1235.199) -- 0:00:35 Average standard deviation of split frequencies: 0.009093 485500 -- [-1236.370] (-1237.344) (-1233.123) (-1232.944) * (-1235.768) [-1236.184] (-1236.213) (-1235.623) -- 0:00:34 486000 -- (-1234.586) (-1235.220) [-1236.463] (-1236.401) * (-1236.298) [-1235.789] (-1238.085) (-1237.343) -- 0:00:34 486500 -- (-1236.454) (-1236.719) (-1235.869) [-1236.428] * (-1235.288) (-1236.730) (-1237.790) [-1239.224] -- 0:00:34 487000 -- [-1233.552] (-1237.383) (-1236.585) (-1238.181) * (-1236.687) [-1235.450] (-1241.831) (-1235.714) -- 0:00:34 487500 -- (-1238.574) (-1238.139) (-1236.008) [-1234.626] * (-1236.509) (-1237.700) [-1235.770] (-1234.291) -- 0:00:34 488000 -- [-1233.841] (-1234.997) (-1239.794) (-1234.064) * [-1233.290] (-1236.091) (-1240.241) (-1232.896) -- 0:00:34 488500 -- (-1235.667) (-1234.714) (-1235.103) [-1235.221] * (-1235.688) [-1233.994] (-1238.147) (-1238.042) -- 0:00:34 489000 -- [-1233.178] (-1237.198) (-1234.944) (-1235.043) * [-1234.506] (-1235.600) (-1237.225) (-1235.847) -- 0:00:34 489500 -- (-1232.808) (-1236.509) [-1234.504] (-1234.760) * [-1232.458] (-1237.886) (-1235.939) (-1235.025) -- 0:00:34 490000 -- (-1236.371) (-1237.402) (-1236.930) [-1236.309] * [-1235.129] (-1236.836) (-1236.722) (-1237.901) -- 0:00:34 Average standard deviation of split frequencies: 0.008947 490500 -- [-1236.719] (-1236.377) (-1237.484) (-1233.607) * (-1235.945) (-1236.504) [-1236.204] (-1236.120) -- 0:00:34 491000 -- (-1235.858) [-1239.827] (-1235.774) (-1236.650) * [-1235.950] (-1237.760) (-1237.608) (-1234.607) -- 0:00:34 491500 -- (-1235.094) (-1242.645) (-1237.515) [-1235.714] * (-1238.115) [-1237.393] (-1235.103) (-1239.912) -- 0:00:34 492000 -- (-1235.289) [-1236.598] (-1234.569) (-1234.496) * [-1234.821] (-1235.676) (-1235.640) (-1236.270) -- 0:00:34 492500 -- (-1239.953) (-1236.651) [-1235.267] (-1234.455) * [-1234.426] (-1235.995) (-1234.587) (-1237.220) -- 0:00:34 493000 -- (-1237.401) [-1234.867] (-1233.793) (-1237.972) * (-1238.280) (-1236.436) (-1240.184) [-1238.591] -- 0:00:33 493500 -- (-1235.302) (-1236.894) [-1237.639] (-1237.966) * (-1236.992) (-1237.032) [-1238.366] (-1236.843) -- 0:00:34 494000 -- [-1233.520] (-1236.383) (-1237.632) (-1233.663) * (-1237.677) [-1235.795] (-1236.818) (-1234.699) -- 0:00:34 494500 -- (-1233.175) [-1233.108] (-1235.196) (-1236.019) * (-1236.611) (-1235.042) [-1235.743] (-1234.422) -- 0:00:34 495000 -- [-1233.159] (-1238.105) (-1234.837) (-1236.143) * (-1236.496) [-1234.994] (-1236.863) (-1234.317) -- 0:00:34 Average standard deviation of split frequencies: 0.009029 495500 -- [-1233.857] (-1235.879) (-1237.703) (-1233.458) * (-1236.611) (-1235.224) (-1235.433) [-1234.089] -- 0:00:34 496000 -- (-1235.489) (-1234.382) (-1234.796) [-1236.421] * (-1236.692) [-1233.657] (-1237.732) (-1235.706) -- 0:00:34 496500 -- (-1238.731) [-1236.392] (-1238.013) (-1237.627) * [-1236.476] (-1235.743) (-1234.361) (-1234.757) -- 0:00:34 497000 -- [-1235.545] (-1237.078) (-1235.271) (-1234.680) * (-1238.998) (-1238.525) [-1237.191] (-1235.477) -- 0:00:34 497500 -- (-1238.535) [-1237.414] (-1233.506) (-1236.562) * (-1239.391) (-1237.583) [-1234.292] (-1234.993) -- 0:00:34 498000 -- [-1233.896] (-1235.195) (-1237.541) (-1235.278) * (-1237.261) (-1236.316) [-1233.904] (-1234.236) -- 0:00:34 498500 -- [-1235.814] (-1236.966) (-1234.704) (-1234.219) * (-1237.776) (-1235.422) [-1234.458] (-1235.349) -- 0:00:34 499000 -- (-1234.318) (-1235.463) [-1236.607] (-1240.995) * (-1236.279) [-1236.062] (-1234.201) (-1235.274) -- 0:00:34 499500 -- [-1235.511] (-1238.916) (-1233.420) (-1236.057) * (-1234.715) (-1235.603) (-1234.931) [-1235.051] -- 0:00:34 500000 -- (-1236.728) [-1238.867] (-1239.431) (-1234.755) * (-1239.199) (-1235.945) (-1235.412) [-1235.265] -- 0:00:34 Average standard deviation of split frequencies: 0.008062 500500 -- (-1235.238) (-1237.251) [-1233.767] (-1235.016) * (-1240.731) (-1233.868) (-1237.187) [-1235.365] -- 0:00:33 501000 -- (-1236.996) [-1241.929] (-1234.584) (-1236.225) * (-1238.595) [-1235.272] (-1235.818) (-1236.232) -- 0:00:33 501500 -- (-1237.063) (-1241.354) (-1237.276) [-1235.925] * (-1235.925) [-1236.221] (-1233.745) (-1236.437) -- 0:00:33 502000 -- (-1235.574) (-1239.970) (-1239.065) [-1234.762] * (-1238.220) (-1236.918) (-1235.080) [-1235.770] -- 0:00:33 502500 -- [-1235.321] (-1237.622) (-1236.960) (-1234.786) * (-1236.195) [-1234.696] (-1236.388) (-1234.863) -- 0:00:33 503000 -- [-1235.437] (-1235.872) (-1234.923) (-1234.004) * (-1236.326) (-1234.831) [-1233.577] (-1235.359) -- 0:00:33 503500 -- (-1235.316) (-1237.324) [-1235.280] (-1236.047) * [-1235.055] (-1235.272) (-1237.255) (-1236.550) -- 0:00:33 504000 -- [-1231.965] (-1236.082) (-1233.848) (-1234.197) * (-1234.343) (-1233.640) [-1236.905] (-1235.658) -- 0:00:33 504500 -- [-1233.494] (-1242.214) (-1233.957) (-1234.114) * [-1234.823] (-1239.837) (-1238.081) (-1236.506) -- 0:00:33 505000 -- [-1235.132] (-1235.909) (-1237.308) (-1236.041) * (-1234.366) (-1232.489) (-1238.665) [-1236.734] -- 0:00:33 Average standard deviation of split frequencies: 0.008035 505500 -- [-1232.435] (-1233.587) (-1238.850) (-1235.879) * (-1237.155) [-1233.693] (-1238.652) (-1239.093) -- 0:00:33 506000 -- [-1235.283] (-1234.825) (-1234.825) (-1239.880) * (-1236.861) (-1237.451) (-1236.202) [-1236.017] -- 0:00:33 506500 -- (-1236.362) (-1233.912) (-1235.345) [-1240.036] * (-1234.163) (-1235.079) (-1238.043) [-1236.125] -- 0:00:33 507000 -- [-1233.894] (-1235.512) (-1236.724) (-1233.890) * (-1239.579) [-1235.617] (-1233.533) (-1236.158) -- 0:00:33 507500 -- (-1235.191) (-1237.157) (-1236.661) [-1234.971] * (-1233.602) (-1235.517) [-1235.468] (-1238.878) -- 0:00:32 508000 -- (-1235.169) [-1237.174] (-1235.334) (-1242.059) * (-1234.073) [-1235.026] (-1235.343) (-1236.735) -- 0:00:32 508500 -- [-1235.720] (-1239.678) (-1235.154) (-1236.906) * (-1234.316) (-1234.535) [-1236.441] (-1236.576) -- 0:00:33 509000 -- (-1238.354) [-1234.842] (-1235.779) (-1235.198) * (-1232.965) (-1235.535) (-1234.252) [-1237.321] -- 0:00:33 509500 -- [-1236.963] (-1234.784) (-1239.437) (-1234.376) * (-1232.310) [-1234.925] (-1234.408) (-1235.996) -- 0:00:33 510000 -- (-1242.047) (-1236.083) [-1238.009] (-1235.493) * (-1234.010) (-1234.567) (-1236.116) [-1233.878] -- 0:00:33 Average standard deviation of split frequencies: 0.009231 510500 -- [-1236.638] (-1236.464) (-1234.766) (-1237.138) * (-1236.122) (-1234.144) (-1241.291) [-1234.536] -- 0:00:33 511000 -- (-1236.168) [-1234.817] (-1237.365) (-1232.794) * (-1236.651) [-1235.681] (-1234.948) (-1238.463) -- 0:00:33 511500 -- (-1235.655) (-1237.684) [-1234.930] (-1235.184) * (-1238.994) [-1238.211] (-1238.427) (-1235.501) -- 0:00:33 512000 -- (-1235.537) (-1234.422) (-1236.789) [-1235.327] * (-1241.969) (-1240.732) [-1234.383] (-1236.004) -- 0:00:33 512500 -- (-1235.598) [-1235.627] (-1237.781) (-1234.181) * (-1235.824) (-1241.332) (-1234.773) [-1235.694] -- 0:00:33 513000 -- (-1237.996) [-1236.421] (-1237.039) (-1236.701) * (-1236.315) [-1238.412] (-1235.184) (-1234.983) -- 0:00:33 513500 -- (-1236.621) [-1236.493] (-1237.650) (-1234.364) * (-1234.549) (-1236.081) [-1235.380] (-1236.080) -- 0:00:33 514000 -- [-1237.284] (-1235.330) (-1234.073) (-1234.389) * (-1235.277) (-1237.341) [-1234.562] (-1237.749) -- 0:00:33 514500 -- (-1236.078) (-1236.285) (-1236.299) [-1234.092] * (-1238.886) (-1236.539) (-1237.154) [-1235.022] -- 0:00:33 515000 -- [-1236.600] (-1237.751) (-1233.206) (-1238.550) * (-1237.508) [-1235.508] (-1237.935) (-1235.231) -- 0:00:32 Average standard deviation of split frequencies: 0.008964 515500 -- (-1236.823) (-1235.837) [-1238.256] (-1237.879) * [-1237.128] (-1234.939) (-1235.772) (-1235.858) -- 0:00:32 516000 -- (-1239.796) [-1237.083] (-1234.546) (-1236.912) * [-1238.243] (-1236.227) (-1234.948) (-1237.929) -- 0:00:32 516500 -- (-1246.111) (-1236.867) [-1234.804] (-1237.296) * (-1239.345) (-1238.920) [-1236.573] (-1234.263) -- 0:00:32 517000 -- [-1244.207] (-1236.241) (-1236.425) (-1235.813) * (-1235.783) [-1235.433] (-1237.790) (-1238.956) -- 0:00:32 517500 -- (-1236.925) (-1237.967) [-1236.386] (-1235.057) * (-1235.932) (-1234.076) (-1236.602) [-1235.605] -- 0:00:32 518000 -- (-1236.252) [-1235.135] (-1235.127) (-1236.914) * [-1235.145] (-1235.146) (-1236.986) (-1235.272) -- 0:00:32 518500 -- (-1236.152) [-1238.563] (-1235.867) (-1238.125) * (-1240.235) (-1236.231) (-1236.486) [-1235.074] -- 0:00:32 519000 -- (-1234.213) (-1238.329) (-1234.508) [-1236.751] * [-1233.789] (-1236.614) (-1233.165) (-1240.869) -- 0:00:32 519500 -- [-1235.250] (-1237.264) (-1233.797) (-1234.961) * (-1235.761) (-1235.681) (-1234.964) [-1236.836] -- 0:00:32 520000 -- [-1236.783] (-1237.589) (-1239.133) (-1237.648) * [-1237.663] (-1234.115) (-1232.901) (-1234.906) -- 0:00:32 Average standard deviation of split frequencies: 0.008884 520500 -- (-1236.436) (-1237.741) [-1234.731] (-1237.141) * (-1238.905) [-1233.029] (-1237.664) (-1237.086) -- 0:00:32 521000 -- (-1234.394) (-1236.030) [-1235.889] (-1236.074) * (-1235.861) (-1235.935) [-1238.207] (-1236.379) -- 0:00:32 521500 -- (-1238.090) (-1234.848) [-1235.695] (-1240.847) * [-1234.808] (-1238.017) (-1240.525) (-1235.043) -- 0:00:32 522000 -- (-1239.702) [-1235.669] (-1237.126) (-1236.884) * (-1234.726) (-1235.822) (-1235.126) [-1235.648] -- 0:00:32 522500 -- (-1238.030) [-1234.633] (-1238.204) (-1236.329) * (-1234.633) (-1233.894) [-1234.414] (-1238.162) -- 0:00:31 523000 -- (-1236.716) [-1234.523] (-1236.336) (-1235.723) * [-1233.178] (-1234.401) (-1234.424) (-1236.013) -- 0:00:32 523500 -- (-1235.829) [-1233.323] (-1235.888) (-1237.553) * [-1232.577] (-1235.969) (-1235.876) (-1233.097) -- 0:00:32 524000 -- (-1235.695) [-1234.866] (-1234.896) (-1235.694) * (-1234.399) [-1235.238] (-1235.811) (-1238.752) -- 0:00:32 524500 -- (-1234.630) [-1235.623] (-1233.203) (-1235.682) * (-1236.182) (-1237.323) (-1235.428) [-1234.961] -- 0:00:32 525000 -- (-1234.368) (-1236.958) (-1236.745) [-1235.320] * (-1236.446) [-1238.612] (-1236.450) (-1235.873) -- 0:00:32 Average standard deviation of split frequencies: 0.008682 525500 -- (-1237.694) (-1238.491) (-1235.694) [-1235.595] * (-1235.116) [-1234.680] (-1233.311) (-1238.448) -- 0:00:32 526000 -- (-1235.334) (-1236.856) (-1236.200) [-1234.253] * (-1235.921) (-1235.822) (-1236.171) [-1236.745] -- 0:00:32 526500 -- (-1236.282) (-1237.171) [-1236.568] (-1237.942) * (-1238.435) (-1236.302) (-1234.307) [-1235.402] -- 0:00:32 527000 -- (-1236.529) (-1235.063) [-1234.785] (-1235.744) * (-1236.675) (-1233.164) (-1235.412) [-1235.132] -- 0:00:32 527500 -- (-1237.413) (-1235.358) (-1233.408) [-1234.627] * (-1233.669) (-1234.519) [-1235.330] (-1234.358) -- 0:00:32 528000 -- [-1239.776] (-1236.210) (-1238.430) (-1233.570) * [-1235.415] (-1235.307) (-1244.720) (-1234.275) -- 0:00:32 528500 -- [-1238.872] (-1234.493) (-1235.112) (-1235.676) * [-1238.109] (-1235.678) (-1238.399) (-1237.306) -- 0:00:32 529000 -- (-1237.195) (-1239.189) (-1233.321) [-1235.492] * (-1237.148) (-1237.582) (-1233.981) [-1234.618] -- 0:00:32 529500 -- (-1239.339) (-1238.055) (-1239.122) [-1234.498] * (-1234.979) [-1237.060] (-1238.348) (-1236.577) -- 0:00:31 530000 -- (-1236.536) [-1236.745] (-1240.896) (-1236.207) * (-1236.558) [-1233.324] (-1236.909) (-1236.398) -- 0:00:31 Average standard deviation of split frequencies: 0.008828 530500 -- (-1235.041) [-1239.839] (-1238.307) (-1237.756) * (-1235.200) (-1235.967) [-1234.700] (-1234.113) -- 0:00:31 531000 -- [-1235.238] (-1233.840) (-1236.915) (-1236.252) * (-1237.657) (-1237.158) (-1235.276) [-1233.400] -- 0:00:31 531500 -- (-1233.542) [-1234.021] (-1236.354) (-1235.957) * [-1235.454] (-1235.912) (-1235.865) (-1235.206) -- 0:00:31 532000 -- (-1234.669) (-1236.549) [-1236.981] (-1237.631) * (-1235.667) (-1236.575) (-1235.394) [-1235.049] -- 0:00:31 532500 -- (-1238.617) (-1233.472) (-1236.608) [-1234.994] * (-1234.097) (-1235.437) (-1234.915) [-1233.516] -- 0:00:31 533000 -- (-1236.878) [-1236.005] (-1233.430) (-1238.934) * [-1235.492] (-1235.796) (-1235.060) (-1233.188) -- 0:00:31 533500 -- (-1235.511) [-1234.217] (-1232.696) (-1239.626) * [-1234.999] (-1235.466) (-1233.994) (-1235.126) -- 0:00:31 534000 -- (-1235.442) (-1235.831) [-1234.089] (-1237.152) * [-1234.796] (-1236.382) (-1235.752) (-1234.227) -- 0:00:31 534500 -- [-1234.945] (-1235.720) (-1235.232) (-1237.907) * [-1235.572] (-1236.708) (-1236.913) (-1241.056) -- 0:00:31 535000 -- (-1235.305) (-1236.833) (-1235.333) [-1239.292] * (-1235.505) (-1236.793) [-1236.645] (-1236.936) -- 0:00:31 Average standard deviation of split frequencies: 0.008743 535500 -- [-1238.465] (-1234.917) (-1236.191) (-1235.592) * (-1236.231) (-1236.019) (-1234.613) [-1234.032] -- 0:00:31 536000 -- (-1238.792) (-1236.547) (-1234.014) [-1233.928] * (-1235.432) (-1235.545) (-1235.726) [-1234.652] -- 0:00:31 536500 -- [-1234.728] (-1235.697) (-1237.037) (-1233.954) * (-1234.061) (-1238.117) (-1235.786) [-1234.268] -- 0:00:31 537000 -- (-1237.096) (-1234.316) (-1235.484) [-1233.467] * [-1234.616] (-1235.362) (-1235.078) (-1235.498) -- 0:00:31 537500 -- (-1237.803) [-1235.132] (-1236.353) (-1236.695) * (-1234.112) (-1235.863) (-1235.764) [-1234.048] -- 0:00:30 538000 -- (-1237.603) (-1232.735) [-1234.748] (-1234.620) * (-1236.313) [-1235.818] (-1236.041) (-1234.958) -- 0:00:31 538500 -- (-1236.744) [-1236.560] (-1234.126) (-1235.359) * (-1236.188) (-1242.992) (-1238.769) [-1235.432] -- 0:00:31 539000 -- (-1236.341) (-1235.519) (-1239.023) [-1233.107] * (-1237.826) (-1237.939) (-1237.692) [-1241.528] -- 0:00:31 539500 -- (-1235.104) (-1236.555) (-1237.843) [-1237.639] * (-1236.213) (-1235.847) [-1236.039] (-1239.918) -- 0:00:31 540000 -- (-1235.601) [-1234.629] (-1237.417) (-1236.889) * (-1233.623) [-1235.149] (-1233.540) (-1235.167) -- 0:00:31 Average standard deviation of split frequencies: 0.008975 540500 -- (-1236.671) (-1237.447) [-1236.795] (-1239.262) * (-1235.408) (-1234.762) (-1238.789) [-1237.866] -- 0:00:31 541000 -- (-1234.760) (-1235.441) (-1236.640) [-1237.830] * (-1234.356) (-1238.049) [-1235.689] (-1237.965) -- 0:00:31 541500 -- [-1235.825] (-1233.418) (-1241.041) (-1237.789) * (-1235.420) (-1240.195) (-1236.088) [-1239.639] -- 0:00:31 542000 -- [-1235.917] (-1235.704) (-1234.699) (-1234.678) * [-1237.735] (-1235.028) (-1234.993) (-1233.944) -- 0:00:31 542500 -- (-1234.951) [-1235.500] (-1234.323) (-1234.519) * (-1235.863) [-1236.553] (-1236.604) (-1233.640) -- 0:00:31 543000 -- (-1236.529) (-1233.527) [-1234.571] (-1235.252) * (-1233.591) [-1234.540] (-1235.046) (-1233.953) -- 0:00:31 543500 -- [-1236.414] (-1235.830) (-1236.818) (-1235.065) * (-1234.425) [-1235.521] (-1235.615) (-1233.928) -- 0:00:31 544000 -- [-1236.911] (-1235.972) (-1237.264) (-1236.655) * (-1234.925) (-1234.596) [-1236.677] (-1236.893) -- 0:00:31 544500 -- (-1234.373) (-1234.827) (-1236.721) [-1237.470] * [-1236.008] (-1240.613) (-1236.565) (-1237.073) -- 0:00:30 545000 -- [-1235.331] (-1233.321) (-1234.856) (-1233.833) * (-1235.646) (-1240.081) (-1235.413) [-1235.471] -- 0:00:30 Average standard deviation of split frequencies: 0.009142 545500 -- (-1235.192) (-1236.036) (-1237.921) [-1236.177] * (-1235.489) [-1234.176] (-1236.873) (-1237.276) -- 0:00:30 546000 -- (-1237.086) (-1240.875) (-1238.857) [-1236.757] * [-1234.950] (-1234.978) (-1234.957) (-1234.463) -- 0:00:30 546500 -- (-1237.366) (-1236.891) (-1235.097) [-1237.837] * (-1238.411) (-1237.280) (-1236.329) [-1234.932] -- 0:00:30 547000 -- (-1234.243) [-1234.278] (-1236.002) (-1233.948) * [-1236.064] (-1234.260) (-1234.760) (-1235.186) -- 0:00:30 547500 -- (-1237.109) [-1235.725] (-1236.063) (-1235.209) * (-1235.247) (-1236.095) (-1236.438) [-1232.817] -- 0:00:30 548000 -- (-1239.661) [-1234.790] (-1239.144) (-1237.925) * (-1236.975) [-1235.250] (-1236.934) (-1236.568) -- 0:00:30 548500 -- [-1235.254] (-1234.561) (-1238.210) (-1235.176) * [-1237.130] (-1234.679) (-1234.453) (-1236.318) -- 0:00:30 549000 -- (-1234.543) (-1237.136) [-1235.075] (-1236.872) * (-1237.395) [-1235.849] (-1234.686) (-1232.089) -- 0:00:30 549500 -- [-1235.951] (-1237.827) (-1235.742) (-1237.287) * (-1236.468) (-1233.538) [-1235.777] (-1237.321) -- 0:00:30 550000 -- (-1235.396) [-1235.478] (-1234.394) (-1235.045) * (-1236.432) (-1234.579) [-1235.699] (-1236.998) -- 0:00:30 Average standard deviation of split frequencies: 0.009971 550500 -- (-1237.876) (-1238.827) [-1235.143] (-1236.583) * (-1238.455) (-1239.156) (-1236.566) [-1235.266] -- 0:00:30 551000 -- (-1236.083) (-1237.315) (-1238.792) [-1236.016] * [-1235.363] (-1236.263) (-1236.702) (-1238.768) -- 0:00:30 551500 -- [-1234.125] (-1237.092) (-1235.303) (-1235.575) * (-1235.068) [-1236.697] (-1236.517) (-1235.028) -- 0:00:30 552000 -- (-1233.938) (-1236.063) [-1236.104] (-1235.187) * (-1235.879) [-1234.413] (-1235.571) (-1236.140) -- 0:00:30 552500 -- [-1235.011] (-1235.321) (-1236.913) (-1234.180) * (-1236.129) (-1235.948) (-1234.978) [-1234.955] -- 0:00:29 553000 -- (-1235.914) (-1236.598) [-1233.853] (-1233.808) * (-1238.370) (-1235.791) [-1233.855] (-1234.740) -- 0:00:30 553500 -- (-1243.657) [-1234.438] (-1234.789) (-1233.627) * (-1236.842) [-1237.080] (-1234.975) (-1237.256) -- 0:00:30 554000 -- (-1243.478) [-1233.971] (-1234.794) (-1234.946) * (-1236.846) (-1238.949) (-1241.020) [-1235.376] -- 0:00:30 554500 -- (-1240.866) (-1236.524) [-1235.038] (-1236.536) * [-1238.929] (-1235.875) (-1237.103) (-1235.162) -- 0:00:30 555000 -- (-1234.279) (-1233.600) (-1234.380) [-1233.250] * (-1234.896) [-1235.760] (-1234.952) (-1236.379) -- 0:00:30 Average standard deviation of split frequencies: 0.009725 555500 -- [-1234.297] (-1238.645) (-1233.370) (-1235.929) * (-1237.450) (-1237.527) (-1238.308) [-1236.901] -- 0:00:30 556000 -- [-1235.200] (-1237.630) (-1234.219) (-1235.064) * [-1238.198] (-1237.381) (-1237.557) (-1239.839) -- 0:00:30 556500 -- (-1234.955) [-1237.186] (-1235.778) (-1239.179) * (-1236.021) (-1234.943) (-1240.416) [-1236.762] -- 0:00:30 557000 -- [-1234.176] (-1238.303) (-1235.128) (-1235.700) * (-1236.490) [-1234.817] (-1237.005) (-1235.529) -- 0:00:30 557500 -- (-1233.805) (-1235.688) (-1232.922) [-1235.434] * [-1236.421] (-1235.594) (-1236.860) (-1235.743) -- 0:00:30 558000 -- (-1235.347) (-1238.199) (-1235.446) [-1235.536] * (-1237.702) (-1236.872) (-1234.750) [-1235.656] -- 0:00:30 558500 -- (-1234.931) (-1237.071) [-1235.669] (-1235.531) * (-1236.552) (-1236.986) [-1234.834] (-1237.324) -- 0:00:30 559000 -- [-1235.453] (-1235.015) (-1234.681) (-1235.172) * (-1236.044) (-1237.181) [-1236.173] (-1237.124) -- 0:00:29 559500 -- [-1233.758] (-1234.927) (-1234.284) (-1235.410) * (-1239.789) (-1233.858) [-1233.784] (-1237.724) -- 0:00:29 560000 -- (-1232.611) (-1235.192) (-1242.418) [-1238.008] * (-1236.737) (-1235.427) (-1236.458) [-1234.837] -- 0:00:29 Average standard deviation of split frequencies: 0.009199 560500 -- (-1234.173) (-1236.304) (-1236.380) [-1240.908] * [-1233.406] (-1240.470) (-1234.144) (-1235.983) -- 0:00:29 561000 -- (-1233.032) (-1238.443) [-1236.810] (-1236.935) * (-1237.769) (-1237.043) [-1237.728] (-1234.871) -- 0:00:29 561500 -- [-1235.913] (-1233.487) (-1237.954) (-1236.047) * [-1236.395] (-1237.300) (-1235.611) (-1235.521) -- 0:00:29 562000 -- (-1237.159) (-1236.140) (-1238.423) [-1235.068] * (-1233.807) (-1236.735) (-1234.418) [-1234.934] -- 0:00:29 562500 -- [-1235.463] (-1238.275) (-1235.054) (-1237.275) * (-1238.060) (-1235.510) [-1233.656] (-1239.720) -- 0:00:29 563000 -- [-1233.194] (-1238.411) (-1239.364) (-1237.623) * (-1237.709) (-1235.074) (-1237.859) [-1235.564] -- 0:00:29 563500 -- [-1236.957] (-1241.694) (-1238.698) (-1237.391) * (-1239.017) [-1234.822] (-1234.638) (-1235.974) -- 0:00:29 564000 -- [-1235.380] (-1234.477) (-1234.800) (-1238.363) * (-1238.734) (-1235.869) (-1236.798) [-1235.100] -- 0:00:29 564500 -- (-1236.783) [-1234.758] (-1233.129) (-1234.443) * (-1236.127) (-1236.648) (-1235.062) [-1234.879] -- 0:00:29 565000 -- (-1239.613) [-1235.648] (-1237.727) (-1239.221) * [-1235.803] (-1235.894) (-1234.732) (-1235.113) -- 0:00:29 Average standard deviation of split frequencies: 0.009208 565500 -- (-1240.772) (-1237.223) [-1238.487] (-1235.649) * (-1234.989) (-1235.608) (-1234.899) [-1233.577] -- 0:00:29 566000 -- (-1237.337) (-1235.374) [-1236.803] (-1237.169) * (-1233.631) [-1235.576] (-1235.890) (-1237.572) -- 0:00:29 566500 -- [-1237.952] (-1236.229) (-1235.041) (-1238.510) * [-1236.656] (-1236.574) (-1234.882) (-1234.978) -- 0:00:29 567000 -- (-1236.371) (-1235.842) (-1237.887) [-1236.218] * (-1235.726) (-1235.452) [-1233.616] (-1238.242) -- 0:00:29 567500 -- [-1234.818] (-1237.663) (-1234.369) (-1235.905) * (-1235.210) [-1235.746] (-1234.244) (-1234.451) -- 0:00:28 568000 -- (-1237.704) (-1235.045) (-1234.495) [-1235.168] * [-1236.624] (-1235.301) (-1239.776) (-1236.173) -- 0:00:29 568500 -- (-1235.945) [-1235.140] (-1235.846) (-1234.792) * (-1235.090) (-1235.364) [-1237.641] (-1237.060) -- 0:00:29 569000 -- (-1235.094) (-1234.379) [-1245.001] (-1235.473) * (-1234.101) (-1237.949) (-1233.935) [-1237.361] -- 0:00:29 569500 -- [-1236.866] (-1235.804) (-1235.462) (-1236.219) * (-1234.992) (-1234.189) (-1235.651) [-1235.871] -- 0:00:29 570000 -- (-1233.974) (-1238.168) [-1234.832] (-1235.259) * [-1234.465] (-1234.197) (-1234.857) (-1235.545) -- 0:00:29 Average standard deviation of split frequencies: 0.009224 570500 -- [-1236.199] (-1240.213) (-1234.743) (-1235.184) * (-1234.516) (-1238.109) [-1237.195] (-1237.478) -- 0:00:29 571000 -- [-1233.415] (-1236.285) (-1233.404) (-1233.846) * [-1234.808] (-1236.178) (-1235.770) (-1237.394) -- 0:00:29 571500 -- [-1234.572] (-1242.294) (-1240.626) (-1236.104) * [-1235.797] (-1234.080) (-1235.983) (-1237.582) -- 0:00:29 572000 -- (-1236.560) (-1236.006) [-1234.886] (-1233.559) * [-1235.600] (-1234.765) (-1236.519) (-1237.554) -- 0:00:29 572500 -- (-1236.703) [-1235.778] (-1235.650) (-1234.512) * (-1237.418) (-1235.276) [-1236.024] (-1234.231) -- 0:00:29 573000 -- (-1234.086) (-1233.685) [-1233.849] (-1235.093) * (-1239.985) (-1235.518) (-1234.388) [-1235.670] -- 0:00:29 573500 -- (-1235.475) [-1235.808] (-1235.434) (-1236.122) * [-1234.963] (-1240.700) (-1238.992) (-1235.474) -- 0:00:29 574000 -- [-1238.173] (-1234.810) (-1238.371) (-1236.557) * [-1234.779] (-1236.547) (-1238.938) (-1235.752) -- 0:00:28 574500 -- (-1239.729) (-1234.175) [-1236.892] (-1236.148) * (-1235.104) (-1235.549) (-1238.174) [-1238.738] -- 0:00:28 575000 -- (-1236.786) (-1236.844) [-1234.817] (-1237.075) * (-1236.870) (-1238.562) (-1240.623) [-1239.142] -- 0:00:28 Average standard deviation of split frequencies: 0.009184 575500 -- [-1233.127] (-1233.729) (-1236.543) (-1236.370) * (-1244.815) (-1238.217) (-1240.787) [-1235.721] -- 0:00:28 576000 -- (-1233.912) (-1235.543) [-1236.777] (-1237.913) * (-1238.581) [-1236.197] (-1235.838) (-1235.749) -- 0:00:28 576500 -- (-1236.358) (-1237.196) [-1236.517] (-1235.218) * [-1234.702] (-1235.330) (-1236.364) (-1234.730) -- 0:00:28 577000 -- [-1240.853] (-1241.229) (-1239.575) (-1236.512) * (-1236.074) [-1234.520] (-1235.604) (-1236.044) -- 0:00:28 577500 -- (-1241.533) (-1235.506) [-1234.237] (-1234.259) * (-1236.037) (-1239.220) [-1235.688] (-1234.736) -- 0:00:28 578000 -- (-1238.945) (-1235.851) [-1238.079] (-1237.356) * (-1235.812) (-1235.819) (-1236.476) [-1232.870] -- 0:00:28 578500 -- (-1236.741) (-1235.899) [-1239.070] (-1234.995) * [-1234.038] (-1235.547) (-1234.548) (-1236.738) -- 0:00:28 579000 -- (-1237.308) [-1235.325] (-1235.504) (-1235.020) * [-1235.314] (-1235.977) (-1236.127) (-1237.286) -- 0:00:28 579500 -- [-1235.370] (-1237.429) (-1235.243) (-1236.822) * (-1234.373) (-1235.774) (-1238.670) [-1232.729] -- 0:00:28 580000 -- [-1237.838] (-1236.153) (-1236.029) (-1235.836) * (-1235.575) (-1236.818) [-1234.592] (-1236.936) -- 0:00:28 Average standard deviation of split frequencies: 0.009065 580500 -- [-1235.744] (-1235.259) (-1237.219) (-1240.679) * (-1235.679) (-1235.860) [-1232.889] (-1234.247) -- 0:00:28 581000 -- (-1239.124) (-1236.144) [-1236.874] (-1239.404) * (-1235.995) [-1236.345] (-1236.762) (-1235.481) -- 0:00:28 581500 -- [-1235.509] (-1236.988) (-1234.370) (-1239.536) * (-1237.046) (-1235.797) (-1238.930) [-1238.216] -- 0:00:28 582000 -- (-1234.128) (-1238.198) (-1234.592) [-1235.434] * (-1235.741) (-1238.670) (-1238.233) [-1237.458] -- 0:00:28 582500 -- [-1235.364] (-1234.112) (-1233.257) (-1235.066) * (-1237.675) (-1237.169) (-1238.610) [-1235.055] -- 0:00:27 583000 -- [-1233.840] (-1237.978) (-1233.903) (-1235.084) * (-1237.431) (-1239.108) [-1234.337] (-1235.196) -- 0:00:27 583500 -- (-1240.646) (-1236.494) [-1238.128] (-1237.549) * (-1235.767) (-1237.284) (-1236.043) [-1234.996] -- 0:00:28 584000 -- [-1234.987] (-1237.479) (-1234.989) (-1238.880) * (-1238.413) (-1237.099) [-1234.848] (-1236.737) -- 0:00:28 584500 -- [-1236.106] (-1238.356) (-1236.355) (-1236.332) * (-1234.583) [-1238.745] (-1235.946) (-1236.413) -- 0:00:28 585000 -- [-1235.730] (-1235.233) (-1237.757) (-1237.207) * (-1234.099) (-1236.730) [-1236.207] (-1235.943) -- 0:00:28 Average standard deviation of split frequencies: 0.009430 585500 -- (-1240.218) (-1235.566) (-1238.906) [-1237.111] * (-1235.132) (-1233.242) [-1237.929] (-1236.587) -- 0:00:28 586000 -- (-1236.103) (-1235.071) (-1236.972) [-1238.541] * (-1236.560) (-1238.692) (-1237.609) [-1235.833] -- 0:00:28 586500 -- [-1236.402] (-1237.146) (-1236.667) (-1235.644) * (-1234.210) (-1234.462) [-1241.005] (-1235.990) -- 0:00:28 587000 -- (-1238.987) [-1234.044] (-1236.668) (-1234.592) * (-1236.373) [-1236.024] (-1236.080) (-1236.781) -- 0:00:28 587500 -- (-1237.926) [-1234.651] (-1236.405) (-1234.495) * (-1241.309) (-1236.682) (-1235.347) [-1234.521] -- 0:00:28 588000 -- [-1234.251] (-1236.451) (-1240.751) (-1234.324) * (-1234.248) (-1244.709) (-1238.403) [-1234.524] -- 0:00:28 588500 -- (-1234.948) [-1235.437] (-1238.421) (-1241.028) * [-1237.422] (-1238.283) (-1235.554) (-1234.614) -- 0:00:27 589000 -- (-1233.416) (-1237.304) (-1235.820) [-1237.837] * (-1234.694) (-1239.281) (-1235.409) [-1233.561] -- 0:00:27 589500 -- (-1237.968) (-1235.749) [-1238.425] (-1237.353) * (-1233.502) (-1234.784) [-1237.621] (-1237.256) -- 0:00:27 590000 -- (-1238.948) [-1234.894] (-1238.712) (-1235.096) * [-1234.666] (-1237.812) (-1238.781) (-1234.832) -- 0:00:27 Average standard deviation of split frequencies: 0.008823 590500 -- (-1237.292) (-1235.111) (-1237.638) [-1234.840] * (-1234.837) (-1235.070) (-1237.769) [-1235.148] -- 0:00:27 591000 -- (-1234.008) (-1236.009) (-1237.241) [-1235.406] * (-1234.669) (-1239.611) (-1235.963) [-1236.069] -- 0:00:27 591500 -- (-1237.008) [-1234.820] (-1238.817) (-1235.532) * [-1233.431] (-1236.511) (-1235.598) (-1235.995) -- 0:00:27 592000 -- (-1234.588) [-1235.910] (-1235.658) (-1236.235) * (-1234.454) (-1234.337) [-1234.608] (-1234.845) -- 0:00:27 592500 -- (-1239.688) [-1236.857] (-1235.808) (-1236.119) * (-1238.036) [-1235.964] (-1236.124) (-1235.350) -- 0:00:27 593000 -- (-1239.789) (-1235.723) (-1235.026) [-1233.102] * (-1236.866) (-1238.179) [-1234.087] (-1235.850) -- 0:00:27 593500 -- (-1242.565) (-1238.424) (-1233.290) [-1234.077] * (-1234.827) (-1237.976) [-1235.713] (-1234.136) -- 0:00:27 594000 -- (-1240.813) [-1234.708] (-1233.246) (-1235.212) * [-1233.334] (-1238.986) (-1239.241) (-1234.521) -- 0:00:27 594500 -- (-1235.336) (-1234.697) [-1236.016] (-1236.991) * (-1235.845) (-1236.102) (-1236.112) [-1235.192] -- 0:00:27 595000 -- (-1235.849) [-1234.211] (-1235.325) (-1236.007) * (-1235.127) (-1242.444) [-1234.817] (-1235.846) -- 0:00:27 Average standard deviation of split frequencies: 0.008920 595500 -- (-1235.212) (-1236.973) [-1236.873] (-1235.943) * (-1236.026) (-1237.274) (-1235.847) [-1235.450] -- 0:00:27 596000 -- (-1236.511) (-1236.551) (-1234.193) [-1236.282] * [-1238.151] (-1234.909) (-1234.664) (-1235.450) -- 0:00:27 596500 -- (-1237.196) (-1238.145) [-1236.667] (-1238.210) * (-1236.823) (-1234.908) (-1235.799) [-1236.010] -- 0:00:27 597000 -- (-1238.649) (-1234.088) [-1235.285] (-1237.267) * (-1234.727) [-1239.383] (-1235.613) (-1238.373) -- 0:00:27 597500 -- [-1236.308] (-1236.409) (-1234.236) (-1237.220) * (-1234.237) (-1237.032) [-1238.006] (-1236.101) -- 0:00:26 598000 -- (-1235.948) (-1236.359) (-1237.996) [-1235.627] * (-1236.152) [-1235.507] (-1236.109) (-1236.768) -- 0:00:26 598500 -- (-1238.933) (-1232.520) [-1234.356] (-1235.409) * (-1235.084) (-1236.264) [-1235.408] (-1236.867) -- 0:00:27 599000 -- (-1236.695) [-1234.946] (-1234.933) (-1236.771) * [-1236.788] (-1235.513) (-1233.482) (-1234.709) -- 0:00:27 599500 -- (-1235.935) (-1234.357) (-1234.972) [-1236.336] * (-1236.344) [-1234.864] (-1236.649) (-1236.898) -- 0:00:27 600000 -- (-1236.839) (-1234.984) [-1237.042] (-1235.228) * (-1236.536) [-1235.589] (-1236.475) (-1235.240) -- 0:00:27 Average standard deviation of split frequencies: 0.008807 600500 -- [-1235.650] (-1235.878) (-1236.084) (-1242.511) * (-1235.454) (-1238.343) (-1241.444) [-1236.019] -- 0:00:27 601000 -- (-1236.390) [-1237.388] (-1239.468) (-1240.520) * [-1235.404] (-1237.071) (-1235.634) (-1235.892) -- 0:00:27 601500 -- [-1239.063] (-1238.001) (-1236.733) (-1238.417) * (-1236.185) (-1235.066) [-1235.943] (-1234.242) -- 0:00:27 602000 -- [-1235.626] (-1235.148) (-1241.020) (-1237.408) * (-1235.680) (-1233.800) (-1234.333) [-1236.298] -- 0:00:27 602500 -- (-1234.648) [-1236.962] (-1235.120) (-1238.312) * (-1236.593) (-1235.527) (-1237.477) [-1235.773] -- 0:00:27 603000 -- (-1235.361) (-1236.345) (-1237.155) [-1235.105] * (-1234.325) (-1235.731) (-1234.235) [-1234.887] -- 0:00:26 603500 -- (-1237.632) (-1235.434) [-1236.958] (-1237.094) * [-1238.190] (-1235.933) (-1238.484) (-1233.871) -- 0:00:26 604000 -- (-1238.061) (-1234.209) [-1234.704] (-1237.079) * (-1237.817) [-1236.028] (-1233.968) (-1236.532) -- 0:00:26 604500 -- [-1237.887] (-1233.361) (-1238.776) (-1233.441) * [-1235.094] (-1238.995) (-1237.359) (-1235.831) -- 0:00:26 605000 -- (-1235.980) (-1240.588) (-1235.725) [-1235.736] * (-1236.501) (-1239.170) [-1238.294] (-1237.244) -- 0:00:26 Average standard deviation of split frequencies: 0.008328 605500 -- (-1237.867) [-1237.112] (-1235.311) (-1237.290) * [-1235.191] (-1239.817) (-1243.122) (-1237.230) -- 0:00:26 606000 -- (-1237.665) (-1235.505) (-1234.845) [-1235.707] * (-1234.273) (-1235.322) (-1238.601) [-1235.434] -- 0:00:26 606500 -- (-1238.673) (-1236.749) [-1237.325] (-1239.220) * (-1236.990) (-1238.315) (-1238.686) [-1236.325] -- 0:00:26 607000 -- (-1241.273) (-1237.599) [-1234.052] (-1235.713) * (-1238.288) (-1235.469) [-1238.101] (-1238.381) -- 0:00:26 607500 -- (-1235.458) (-1237.830) [-1235.173] (-1237.023) * (-1236.454) (-1235.225) (-1236.642) [-1237.969] -- 0:00:26 608000 -- [-1235.651] (-1240.548) (-1237.087) (-1236.559) * (-1234.873) [-1235.826] (-1244.883) (-1237.512) -- 0:00:26 608500 -- (-1235.056) [-1237.567] (-1238.235) (-1239.559) * [-1232.819] (-1236.234) (-1239.047) (-1235.821) -- 0:00:26 609000 -- (-1236.425) (-1235.968) [-1236.708] (-1235.450) * (-1233.381) [-1237.819] (-1236.359) (-1234.486) -- 0:00:26 609500 -- (-1234.986) (-1233.843) (-1234.464) [-1234.696] * (-1236.671) [-1234.545] (-1236.063) (-1237.819) -- 0:00:26 610000 -- (-1234.166) (-1236.429) (-1235.092) [-1236.206] * [-1236.507] (-1233.504) (-1236.488) (-1235.818) -- 0:00:26 Average standard deviation of split frequencies: 0.008148 610500 -- [-1234.815] (-1236.899) (-1233.742) (-1237.103) * [-1235.424] (-1238.713) (-1237.520) (-1238.278) -- 0:00:26 611000 -- [-1232.827] (-1239.319) (-1234.729) (-1235.375) * [-1233.684] (-1239.966) (-1235.709) (-1238.218) -- 0:00:26 611500 -- [-1235.640] (-1235.814) (-1233.747) (-1238.842) * (-1235.125) (-1240.823) (-1237.181) [-1237.010] -- 0:00:26 612000 -- (-1235.418) (-1235.979) (-1233.998) [-1234.418] * (-1235.112) (-1236.590) (-1237.636) [-1237.290] -- 0:00:25 612500 -- [-1236.102] (-1234.942) (-1231.769) (-1236.937) * (-1235.362) (-1234.695) [-1233.002] (-1237.453) -- 0:00:25 613000 -- (-1235.945) [-1233.137] (-1238.056) (-1239.745) * (-1235.245) (-1233.656) [-1237.067] (-1236.755) -- 0:00:25 613500 -- (-1235.344) (-1234.920) [-1236.246] (-1237.767) * (-1238.353) (-1238.095) (-1235.861) [-1234.667] -- 0:00:26 614000 -- (-1236.497) [-1233.342] (-1235.360) (-1238.307) * (-1238.493) [-1233.873] (-1241.264) (-1234.885) -- 0:00:26 614500 -- (-1236.503) (-1239.398) (-1236.061) [-1237.797] * (-1236.105) (-1235.039) (-1233.840) [-1235.235] -- 0:00:26 615000 -- (-1235.584) (-1241.302) (-1234.996) [-1234.279] * [-1234.501] (-1236.253) (-1234.544) (-1243.138) -- 0:00:26 Average standard deviation of split frequencies: 0.008078 615500 -- (-1236.218) (-1241.792) [-1234.589] (-1236.565) * [-1235.809] (-1234.512) (-1235.160) (-1234.836) -- 0:00:26 616000 -- (-1235.452) (-1234.487) [-1235.995] (-1236.463) * (-1234.102) (-1236.317) [-1237.553] (-1234.083) -- 0:00:26 616500 -- (-1236.066) (-1237.676) (-1240.017) [-1239.520] * (-1233.776) [-1233.626] (-1233.889) (-1237.137) -- 0:00:26 617000 -- (-1233.883) (-1234.696) (-1237.716) [-1240.712] * (-1235.975) [-1235.314] (-1235.933) (-1238.184) -- 0:00:26 617500 -- [-1234.342] (-1235.748) (-1235.338) (-1236.132) * (-1234.664) [-1233.430] (-1235.591) (-1240.291) -- 0:00:26 618000 -- (-1235.098) (-1235.095) [-1236.263] (-1234.623) * (-1241.604) [-1233.354] (-1236.346) (-1238.199) -- 0:00:25 618500 -- (-1235.507) [-1233.564] (-1236.803) (-1237.277) * (-1234.849) (-1235.924) (-1237.404) [-1233.433] -- 0:00:25 619000 -- (-1236.464) (-1235.213) [-1235.303] (-1236.567) * [-1235.249] (-1234.958) (-1235.892) (-1234.804) -- 0:00:25 619500 -- [-1242.446] (-1240.946) (-1234.966) (-1236.086) * [-1238.824] (-1234.253) (-1242.839) (-1235.101) -- 0:00:25 620000 -- (-1236.664) (-1237.329) (-1234.091) [-1233.564] * [-1237.161] (-1233.755) (-1233.261) (-1235.012) -- 0:00:25 Average standard deviation of split frequencies: 0.007863 620500 -- (-1235.975) (-1236.764) [-1233.652] (-1237.911) * (-1234.309) (-1234.266) (-1239.969) [-1235.022] -- 0:00:25 621000 -- (-1235.944) [-1237.400] (-1239.588) (-1237.310) * (-1233.264) [-1232.577] (-1233.564) (-1234.126) -- 0:00:25 621500 -- (-1237.222) (-1236.533) (-1234.075) [-1237.904] * (-1237.335) [-1237.478] (-1236.260) (-1235.677) -- 0:00:25 622000 -- [-1235.030] (-1235.439) (-1238.009) (-1236.051) * (-1236.494) (-1235.016) (-1235.112) [-1235.875] -- 0:00:25 622500 -- (-1234.957) (-1236.973) (-1236.337) [-1237.171] * (-1236.552) (-1235.599) [-1235.028] (-1238.492) -- 0:00:25 623000 -- [-1235.168] (-1232.829) (-1236.719) (-1236.542) * [-1235.067] (-1234.632) (-1237.642) (-1237.449) -- 0:00:25 623500 -- (-1233.397) [-1235.233] (-1236.805) (-1234.671) * (-1237.164) (-1235.467) [-1237.974] (-1233.778) -- 0:00:25 624000 -- (-1236.319) (-1235.792) (-1232.261) [-1235.052] * (-1237.603) [-1234.626] (-1236.075) (-1239.362) -- 0:00:25 624500 -- (-1240.141) (-1233.525) (-1235.892) [-1235.663] * (-1233.908) (-1238.966) [-1236.421] (-1236.212) -- 0:00:25 625000 -- [-1236.655] (-1234.670) (-1234.391) (-1235.627) * (-1237.464) (-1237.162) (-1239.310) [-1235.073] -- 0:00:25 Average standard deviation of split frequencies: 0.008158 625500 -- [-1237.242] (-1233.599) (-1235.546) (-1234.897) * (-1234.087) [-1237.241] (-1235.841) (-1235.038) -- 0:00:25 626000 -- [-1235.773] (-1236.572) (-1238.904) (-1235.301) * [-1234.769] (-1233.346) (-1238.637) (-1233.222) -- 0:00:25 626500 -- (-1236.589) (-1234.475) [-1237.408] (-1241.273) * (-1233.993) [-1235.174] (-1237.136) (-1234.181) -- 0:00:25 627000 -- (-1234.946) (-1234.103) [-1235.889] (-1237.689) * (-1234.330) (-1236.333) (-1234.957) [-1234.282] -- 0:00:24 627500 -- (-1233.551) [-1235.969] (-1233.472) (-1235.659) * (-1235.528) [-1233.234] (-1235.859) (-1234.189) -- 0:00:24 628000 -- (-1237.023) [-1234.867] (-1235.115) (-1236.523) * (-1234.752) (-1234.012) [-1234.800] (-1233.494) -- 0:00:24 628500 -- [-1233.979] (-1235.862) (-1238.818) (-1235.762) * (-1234.300) [-1234.828] (-1234.645) (-1236.546) -- 0:00:25 629000 -- [-1233.865] (-1237.241) (-1236.328) (-1239.392) * (-1234.333) (-1237.913) [-1234.994] (-1232.783) -- 0:00:25 629500 -- [-1233.597] (-1234.982) (-1235.190) (-1239.545) * (-1235.130) [-1235.033] (-1236.281) (-1237.416) -- 0:00:25 630000 -- [-1234.648] (-1234.628) (-1235.590) (-1237.670) * (-1236.109) (-1236.307) (-1233.888) [-1235.192] -- 0:00:25 Average standard deviation of split frequencies: 0.008845 630500 -- (-1236.196) (-1235.862) [-1234.683] (-1237.372) * (-1235.116) [-1235.771] (-1235.724) (-1234.859) -- 0:00:25 631000 -- (-1235.216) (-1236.027) (-1236.482) [-1235.902] * (-1235.804) (-1233.745) (-1233.961) [-1234.694] -- 0:00:25 631500 -- (-1235.034) (-1239.022) [-1234.784] (-1236.561) * [-1234.836] (-1234.744) (-1232.487) (-1235.354) -- 0:00:25 632000 -- (-1235.748) (-1235.412) (-1236.500) [-1235.555] * [-1236.289] (-1235.034) (-1236.574) (-1235.090) -- 0:00:25 632500 -- (-1239.354) [-1234.204] (-1237.001) (-1238.300) * (-1239.742) [-1235.412] (-1232.440) (-1240.190) -- 0:00:24 633000 -- (-1237.386) [-1236.864] (-1236.533) (-1235.195) * (-1232.922) [-1236.441] (-1237.601) (-1237.915) -- 0:00:24 633500 -- [-1236.278] (-1235.505) (-1233.998) (-1236.169) * (-1236.010) [-1238.115] (-1236.434) (-1237.257) -- 0:00:24 634000 -- (-1238.999) [-1234.018] (-1237.082) (-1236.878) * (-1238.541) (-1237.771) [-1234.071] (-1233.452) -- 0:00:24 634500 -- (-1236.673) [-1233.997] (-1236.291) (-1235.805) * (-1236.798) (-1238.452) [-1235.908] (-1238.131) -- 0:00:24 635000 -- (-1243.126) [-1234.731] (-1238.216) (-1237.226) * (-1235.320) (-1235.798) [-1235.337] (-1236.768) -- 0:00:24 Average standard deviation of split frequencies: 0.008771 635500 -- (-1243.994) [-1233.805] (-1237.232) (-1241.020) * (-1233.758) [-1236.174] (-1237.078) (-1236.474) -- 0:00:24 636000 -- (-1244.554) [-1233.283] (-1236.038) (-1236.847) * (-1245.944) (-1235.037) [-1235.834] (-1239.615) -- 0:00:24 636500 -- (-1235.272) [-1235.124] (-1236.452) (-1233.696) * (-1236.590) [-1236.052] (-1235.429) (-1241.966) -- 0:00:24 637000 -- (-1236.020) [-1236.932] (-1237.068) (-1235.035) * (-1237.072) (-1240.879) [-1235.745] (-1238.075) -- 0:00:24 637500 -- [-1236.197] (-1235.238) (-1237.230) (-1239.458) * [-1238.439] (-1240.381) (-1238.524) (-1235.139) -- 0:00:24 638000 -- (-1241.848) (-1234.989) [-1233.614] (-1232.034) * [-1236.915] (-1234.953) (-1235.880) (-1235.507) -- 0:00:24 638500 -- (-1234.486) (-1237.042) (-1236.509) [-1235.220] * (-1234.340) [-1237.437] (-1238.956) (-1239.362) -- 0:00:24 639000 -- (-1241.562) (-1235.368) [-1237.050] (-1236.234) * [-1235.363] (-1235.403) (-1237.047) (-1237.179) -- 0:00:24 639500 -- (-1236.922) [-1235.570] (-1236.022) (-1237.353) * (-1234.682) (-1238.078) (-1237.179) [-1237.325] -- 0:00:24 640000 -- [-1233.349] (-1235.335) (-1235.765) (-1238.738) * (-1236.086) [-1239.953] (-1235.333) (-1237.868) -- 0:00:24 Average standard deviation of split frequencies: 0.008830 640500 -- (-1232.703) [-1234.239] (-1235.204) (-1233.880) * (-1234.852) [-1237.252] (-1236.411) (-1235.595) -- 0:00:24 641000 -- [-1234.683] (-1234.440) (-1237.107) (-1235.120) * [-1237.196] (-1238.690) (-1236.630) (-1235.001) -- 0:00:24 641500 -- (-1237.435) [-1237.096] (-1235.770) (-1236.698) * (-1239.382) (-1237.671) (-1234.390) [-1235.126] -- 0:00:24 642000 -- (-1245.113) [-1235.424] (-1237.477) (-1238.209) * (-1236.142) [-1236.214] (-1235.029) (-1235.455) -- 0:00:23 642500 -- (-1238.294) [-1234.340] (-1234.695) (-1235.589) * (-1235.221) (-1236.701) (-1238.235) [-1237.022] -- 0:00:23 643000 -- [-1237.918] (-1233.666) (-1235.654) (-1237.363) * (-1234.447) [-1235.456] (-1234.024) (-1238.127) -- 0:00:24 643500 -- (-1237.554) (-1241.334) (-1232.905) [-1234.131] * [-1234.305] (-1236.189) (-1235.053) (-1235.266) -- 0:00:24 644000 -- (-1234.544) [-1235.016] (-1236.167) (-1234.209) * (-1238.151) (-1236.204) (-1233.501) [-1232.922] -- 0:00:24 644500 -- (-1235.305) (-1237.179) [-1233.762] (-1239.858) * [-1237.540] (-1232.787) (-1237.215) (-1237.679) -- 0:00:24 645000 -- (-1242.473) (-1234.213) (-1235.669) [-1232.991] * (-1234.527) (-1236.463) [-1237.424] (-1237.666) -- 0:00:24 Average standard deviation of split frequencies: 0.008595 645500 -- (-1237.177) [-1237.537] (-1233.821) (-1234.528) * (-1234.421) [-1235.163] (-1234.364) (-1236.832) -- 0:00:24 646000 -- (-1235.100) (-1238.655) [-1235.159] (-1236.415) * (-1233.638) (-1234.532) [-1235.403] (-1237.098) -- 0:00:24 646500 -- (-1235.328) (-1237.000) [-1236.504] (-1234.571) * (-1238.776) [-1235.644] (-1236.274) (-1234.819) -- 0:00:24 647000 -- (-1234.648) (-1234.680) [-1232.608] (-1236.809) * (-1234.488) (-1235.056) [-1235.316] (-1236.429) -- 0:00:24 647500 -- (-1234.019) (-1234.845) [-1233.563] (-1234.939) * (-1237.024) (-1233.099) [-1235.684] (-1238.666) -- 0:00:23 648000 -- (-1237.357) [-1234.815] (-1235.654) (-1234.948) * (-1235.646) (-1235.457) [-1234.760] (-1236.887) -- 0:00:23 648500 -- (-1239.785) [-1235.330] (-1234.242) (-1235.212) * [-1237.254] (-1237.269) (-1235.373) (-1234.801) -- 0:00:23 649000 -- (-1238.061) (-1234.907) (-1233.734) [-1235.026] * (-1234.498) (-1237.537) (-1239.422) [-1236.993] -- 0:00:23 649500 -- [-1235.438] (-1238.302) (-1233.447) (-1237.673) * [-1235.124] (-1236.445) (-1236.673) (-1234.748) -- 0:00:23 650000 -- [-1236.495] (-1236.034) (-1235.126) (-1238.594) * (-1236.340) (-1235.180) (-1236.807) [-1234.569] -- 0:00:23 Average standard deviation of split frequencies: 0.008935 650500 -- (-1236.471) (-1235.360) [-1234.410] (-1234.622) * (-1234.428) (-1235.972) [-1234.505] (-1233.782) -- 0:00:23 651000 -- [-1234.132] (-1236.654) (-1235.736) (-1235.633) * (-1235.436) [-1235.987] (-1235.009) (-1232.899) -- 0:00:23 651500 -- (-1235.609) (-1236.613) [-1236.536] (-1233.798) * (-1234.418) (-1235.881) (-1234.867) [-1237.309] -- 0:00:23 652000 -- (-1236.218) (-1238.550) (-1233.946) [-1235.682] * [-1235.811] (-1238.917) (-1237.600) (-1237.510) -- 0:00:23 652500 -- [-1235.214] (-1236.981) (-1235.943) (-1235.795) * (-1233.897) (-1235.205) [-1235.956] (-1234.565) -- 0:00:23 653000 -- (-1237.305) (-1236.773) (-1237.487) [-1234.482] * [-1233.330] (-1233.662) (-1235.500) (-1235.858) -- 0:00:23 653500 -- (-1235.126) (-1235.323) [-1235.468] (-1237.102) * [-1236.522] (-1237.627) (-1239.682) (-1236.832) -- 0:00:23 654000 -- (-1235.554) (-1235.531) [-1234.716] (-1240.438) * (-1234.345) [-1235.836] (-1233.810) (-1235.489) -- 0:00:23 654500 -- (-1236.701) (-1238.076) [-1232.605] (-1237.175) * (-1233.822) [-1234.842] (-1235.105) (-1234.723) -- 0:00:23 655000 -- [-1235.343] (-1242.252) (-1236.012) (-1235.237) * [-1240.709] (-1236.485) (-1236.173) (-1234.023) -- 0:00:23 Average standard deviation of split frequencies: 0.008543 655500 -- (-1235.791) (-1234.847) [-1235.365] (-1237.452) * (-1238.096) [-1237.845] (-1234.157) (-1235.834) -- 0:00:23 656000 -- (-1237.026) [-1237.902] (-1234.332) (-1237.850) * (-1240.010) [-1237.420] (-1238.069) (-1234.581) -- 0:00:23 656500 -- (-1237.911) [-1236.230] (-1233.850) (-1243.167) * [-1239.079] (-1235.852) (-1235.422) (-1232.576) -- 0:00:23 657000 -- [-1237.112] (-1233.498) (-1234.600) (-1240.177) * (-1234.908) (-1236.905) (-1236.401) [-1232.377] -- 0:00:22 657500 -- (-1237.337) (-1234.586) (-1243.208) [-1234.335] * [-1236.203] (-1235.835) (-1237.046) (-1234.979) -- 0:00:22 658000 -- (-1238.490) (-1237.459) (-1237.320) [-1235.760] * (-1236.495) (-1237.606) [-1235.343] (-1235.107) -- 0:00:23 658500 -- (-1237.759) (-1237.150) (-1239.797) [-1236.553] * (-1239.664) (-1235.804) [-1235.847] (-1237.357) -- 0:00:23 659000 -- (-1234.786) (-1234.320) (-1235.399) [-1234.444] * (-1234.560) (-1238.283) (-1237.412) [-1236.933] -- 0:00:23 659500 -- [-1237.433] (-1236.230) (-1235.948) (-1233.929) * (-1235.660) (-1239.080) [-1240.095] (-1235.165) -- 0:00:23 660000 -- (-1238.831) [-1234.694] (-1236.101) (-1237.423) * (-1236.100) (-1237.474) [-1238.679] (-1233.883) -- 0:00:23 Average standard deviation of split frequencies: 0.008101 660500 -- (-1238.193) [-1234.127] (-1240.380) (-1238.006) * (-1234.358) [-1234.450] (-1238.939) (-1235.204) -- 0:00:23 661000 -- (-1234.145) (-1237.295) (-1234.912) [-1234.964] * (-1234.634) [-1234.723] (-1236.972) (-1235.403) -- 0:00:23 661500 -- (-1235.305) (-1237.119) [-1236.182] (-1233.453) * (-1235.225) (-1237.501) [-1238.768] (-1232.579) -- 0:00:23 662000 -- (-1235.959) (-1236.170) (-1236.124) [-1236.995] * [-1236.344] (-1238.996) (-1237.551) (-1234.808) -- 0:00:22 662500 -- (-1237.394) (-1240.532) (-1233.813) [-1236.900] * (-1235.270) [-1234.555] (-1235.948) (-1243.544) -- 0:00:22 663000 -- (-1239.001) (-1240.850) (-1239.528) [-1237.486] * (-1234.923) [-1239.431] (-1233.411) (-1244.107) -- 0:00:22 663500 -- (-1238.274) (-1234.782) [-1235.779] (-1236.683) * (-1235.637) (-1235.769) [-1237.835] (-1244.809) -- 0:00:22 664000 -- (-1236.889) (-1236.343) (-1236.506) [-1236.569] * (-1239.178) (-1240.028) (-1238.952) [-1236.534] -- 0:00:22 664500 -- (-1236.306) [-1234.126] (-1238.037) (-1237.570) * (-1234.848) [-1238.590] (-1235.204) (-1235.599) -- 0:00:22 665000 -- (-1237.380) (-1235.117) [-1235.471] (-1234.116) * (-1241.600) [-1237.668] (-1237.147) (-1235.624) -- 0:00:22 Average standard deviation of split frequencies: 0.008077 665500 -- (-1236.146) [-1234.042] (-1237.256) (-1238.695) * (-1237.236) [-1234.589] (-1236.585) (-1234.876) -- 0:00:22 666000 -- (-1234.742) (-1240.576) [-1240.809] (-1233.503) * [-1237.732] (-1235.633) (-1235.426) (-1237.732) -- 0:00:22 666500 -- (-1235.428) (-1241.438) (-1236.584) [-1235.071] * (-1235.707) [-1234.015] (-1234.735) (-1239.076) -- 0:00:22 667000 -- (-1234.745) [-1236.266] (-1236.933) (-1234.157) * (-1235.779) [-1234.577] (-1234.842) (-1236.981) -- 0:00:22 667500 -- (-1234.769) (-1237.059) [-1237.826] (-1233.369) * (-1234.633) (-1233.414) (-1234.492) [-1237.865] -- 0:00:22 668000 -- (-1235.323) [-1236.471] (-1237.955) (-1233.923) * (-1234.443) (-1235.650) [-1234.742] (-1237.058) -- 0:00:22 668500 -- [-1237.492] (-1236.348) (-1235.879) (-1234.399) * (-1239.779) (-1238.307) [-1236.429] (-1237.930) -- 0:00:22 669000 -- (-1246.529) [-1236.739] (-1234.951) (-1236.119) * [-1235.847] (-1236.829) (-1234.414) (-1234.913) -- 0:00:22 669500 -- [-1236.252] (-1233.838) (-1237.396) (-1234.642) * (-1235.870) [-1234.489] (-1237.252) (-1233.222) -- 0:00:22 670000 -- (-1237.083) (-1236.396) [-1234.671] (-1234.171) * (-1233.402) (-1236.858) (-1237.185) [-1235.515] -- 0:00:22 Average standard deviation of split frequencies: 0.007525 670500 -- (-1237.831) [-1235.411] (-1236.282) (-1233.256) * (-1234.643) (-1237.129) [-1236.913] (-1241.281) -- 0:00:22 671000 -- (-1237.862) (-1235.103) [-1234.796] (-1237.383) * [-1235.789] (-1235.422) (-1236.754) (-1235.520) -- 0:00:22 671500 -- (-1236.634) [-1235.414] (-1236.888) (-1237.985) * (-1237.263) [-1235.798] (-1233.879) (-1232.958) -- 0:00:22 672000 -- (-1238.453) (-1238.322) (-1239.995) [-1234.333] * (-1237.342) (-1235.700) (-1238.146) [-1233.825] -- 0:00:21 672500 -- (-1236.111) (-1233.860) [-1238.107] (-1239.233) * (-1236.187) [-1235.221] (-1235.575) (-1235.285) -- 0:00:21 673000 -- (-1240.234) [-1234.620] (-1235.163) (-1235.421) * (-1236.592) (-1235.439) (-1235.214) [-1233.878] -- 0:00:21 673500 -- (-1236.469) (-1233.353) [-1236.715] (-1233.901) * (-1235.918) (-1235.231) [-1234.224] (-1235.122) -- 0:00:22 674000 -- [-1235.691] (-1238.686) (-1235.162) (-1236.377) * (-1236.990) (-1235.503) (-1233.469) [-1235.811] -- 0:00:22 674500 -- [-1234.914] (-1239.115) (-1237.224) (-1233.115) * (-1233.908) (-1236.065) [-1235.254] (-1234.817) -- 0:00:22 675000 -- (-1238.541) (-1236.858) [-1235.601] (-1234.822) * (-1234.710) (-1235.892) (-1233.379) [-1236.877] -- 0:00:22 Average standard deviation of split frequencies: 0.007425 675500 -- (-1241.021) (-1237.861) [-1237.378] (-1233.637) * (-1238.868) (-1233.875) (-1237.301) [-1237.173] -- 0:00:22 676000 -- (-1237.703) (-1239.848) (-1234.777) [-1232.525] * (-1233.248) (-1234.892) [-1233.998] (-1238.698) -- 0:00:22 676500 -- [-1235.056] (-1239.985) (-1235.497) (-1236.160) * (-1235.271) (-1235.844) [-1235.217] (-1234.705) -- 0:00:21 677000 -- (-1237.434) (-1236.972) [-1238.723] (-1234.259) * [-1237.394] (-1235.945) (-1242.912) (-1241.968) -- 0:00:21 677500 -- [-1234.612] (-1236.579) (-1236.148) (-1235.449) * (-1236.329) (-1239.454) [-1235.305] (-1236.486) -- 0:00:21 678000 -- (-1235.508) [-1233.909] (-1235.090) (-1234.437) * [-1238.909] (-1239.329) (-1235.334) (-1235.799) -- 0:00:21 678500 -- [-1235.527] (-1235.764) (-1236.154) (-1234.966) * (-1237.696) [-1241.907] (-1233.698) (-1238.551) -- 0:00:21 679000 -- (-1237.426) [-1236.632] (-1235.421) (-1234.705) * (-1234.972) (-1234.631) [-1236.184] (-1239.191) -- 0:00:21 679500 -- (-1236.484) (-1235.964) (-1234.877) [-1236.205] * (-1237.729) (-1236.254) (-1234.556) [-1236.499] -- 0:00:21 680000 -- (-1238.186) (-1238.988) (-1237.764) [-1236.024] * (-1235.562) [-1234.903] (-1235.341) (-1235.776) -- 0:00:21 Average standard deviation of split frequencies: 0.007142 680500 -- (-1233.912) [-1235.909] (-1238.841) (-1238.053) * [-1233.921] (-1234.978) (-1238.340) (-1234.446) -- 0:00:21 681000 -- (-1234.420) (-1234.540) (-1238.088) [-1235.397] * [-1234.774] (-1236.542) (-1243.168) (-1235.705) -- 0:00:21 681500 -- [-1233.446] (-1234.429) (-1235.552) (-1237.127) * [-1237.537] (-1235.410) (-1237.628) (-1234.310) -- 0:00:21 682000 -- (-1238.343) (-1237.121) [-1238.360] (-1234.899) * (-1236.540) [-1236.379] (-1235.405) (-1235.811) -- 0:00:21 682500 -- (-1235.140) (-1234.653) (-1238.297) [-1234.259] * (-1240.384) [-1236.541] (-1235.845) (-1234.775) -- 0:00:21 683000 -- (-1236.796) [-1239.655] (-1235.601) (-1233.805) * (-1237.317) (-1235.885) (-1234.980) [-1235.620] -- 0:00:21 683500 -- (-1235.306) (-1239.331) (-1236.309) [-1236.691] * (-1233.486) [-1232.847] (-1234.223) (-1235.593) -- 0:00:21 684000 -- (-1235.392) (-1237.503) [-1235.766] (-1235.424) * (-1235.423) (-1236.644) (-1234.076) [-1234.165] -- 0:00:21 684500 -- (-1235.193) [-1236.870] (-1238.172) (-1238.067) * (-1235.596) [-1234.305] (-1236.603) (-1238.509) -- 0:00:21 685000 -- (-1236.170) (-1235.419) [-1234.808] (-1235.913) * [-1233.132] (-1233.692) (-1234.779) (-1236.651) -- 0:00:21 Average standard deviation of split frequencies: 0.007155 685500 -- (-1236.716) [-1237.909] (-1235.315) (-1234.452) * [-1236.203] (-1235.903) (-1236.894) (-1235.302) -- 0:00:21 686000 -- (-1237.066) [-1235.575] (-1235.466) (-1233.123) * [-1236.854] (-1234.395) (-1233.442) (-1236.735) -- 0:00:21 686500 -- (-1238.740) (-1233.672) (-1245.089) [-1236.837] * (-1236.027) [-1234.567] (-1235.846) (-1234.829) -- 0:00:21 687000 -- (-1236.872) (-1235.696) [-1240.157] (-1234.313) * (-1236.556) [-1233.564] (-1235.542) (-1235.121) -- 0:00:20 687500 -- (-1236.012) (-1235.711) [-1236.636] (-1234.276) * [-1235.635] (-1236.319) (-1235.525) (-1236.956) -- 0:00:20 688000 -- (-1238.058) (-1239.899) (-1236.620) [-1235.070] * (-1236.128) (-1235.213) [-1234.771] (-1237.027) -- 0:00:20 688500 -- (-1237.217) [-1238.580] (-1238.650) (-1233.854) * (-1234.060) (-1233.570) (-1235.525) [-1240.511] -- 0:00:20 689000 -- (-1236.924) (-1239.821) [-1237.231] (-1235.179) * [-1233.083] (-1234.150) (-1235.897) (-1235.332) -- 0:00:21 689500 -- (-1236.254) (-1239.020) [-1236.569] (-1235.983) * [-1237.606] (-1236.179) (-1239.438) (-1236.060) -- 0:00:21 690000 -- (-1238.771) (-1235.585) [-1235.422] (-1235.616) * [-1235.514] (-1235.130) (-1239.048) (-1237.037) -- 0:00:21 Average standard deviation of split frequencies: 0.007869 690500 -- (-1234.831) [-1234.356] (-1235.952) (-1234.190) * (-1238.460) (-1235.950) [-1235.926] (-1235.753) -- 0:00:21 691000 -- [-1235.738] (-1235.446) (-1234.507) (-1239.685) * (-1234.149) (-1235.826) (-1234.224) [-1235.329] -- 0:00:21 691500 -- (-1237.428) [-1234.078] (-1235.807) (-1238.095) * (-1234.685) (-1235.782) (-1234.727) [-1233.656] -- 0:00:20 692000 -- (-1235.012) (-1235.914) (-1240.647) [-1234.366] * (-1238.261) (-1235.360) [-1233.793] (-1238.767) -- 0:00:20 692500 -- (-1235.174) [-1237.932] (-1241.260) (-1233.977) * (-1235.412) [-1234.028] (-1236.761) (-1236.770) -- 0:00:20 693000 -- [-1234.957] (-1237.070) (-1236.021) (-1236.806) * [-1236.334] (-1235.273) (-1236.364) (-1236.205) -- 0:00:20 693500 -- (-1235.235) (-1235.973) [-1237.481] (-1236.228) * (-1236.126) (-1234.174) [-1236.811] (-1236.802) -- 0:00:20 694000 -- (-1236.261) [-1234.713] (-1242.239) (-1235.581) * [-1233.465] (-1240.920) (-1236.171) (-1239.025) -- 0:00:20 694500 -- (-1235.414) (-1236.732) [-1237.454] (-1239.859) * [-1235.811] (-1235.512) (-1239.991) (-1236.743) -- 0:00:20 695000 -- (-1235.147) (-1237.353) [-1235.387] (-1235.641) * [-1237.909] (-1235.870) (-1235.791) (-1235.802) -- 0:00:20 Average standard deviation of split frequencies: 0.007662 695500 -- (-1236.942) (-1237.355) (-1237.295) [-1236.569] * (-1235.813) (-1236.694) (-1234.483) [-1236.205] -- 0:00:20 696000 -- (-1235.902) (-1237.572) [-1237.214] (-1239.038) * [-1237.420] (-1235.606) (-1234.811) (-1234.469) -- 0:00:20 696500 -- (-1236.090) [-1235.468] (-1235.652) (-1239.368) * [-1235.505] (-1235.309) (-1235.395) (-1236.238) -- 0:00:20 697000 -- (-1235.205) [-1235.834] (-1240.024) (-1242.322) * (-1235.147) (-1235.120) [-1233.659] (-1234.873) -- 0:00:20 697500 -- (-1237.732) [-1234.643] (-1235.063) (-1236.952) * (-1236.005) (-1234.838) (-1240.671) [-1233.855] -- 0:00:20 698000 -- [-1235.478] (-1235.088) (-1234.953) (-1237.114) * [-1235.943] (-1235.306) (-1234.210) (-1238.535) -- 0:00:20 698500 -- [-1235.024] (-1236.736) (-1235.733) (-1234.355) * [-1233.848] (-1236.854) (-1234.350) (-1235.626) -- 0:00:20 699000 -- (-1236.611) [-1236.254] (-1242.890) (-1235.476) * (-1238.456) (-1237.530) [-1234.687] (-1234.927) -- 0:00:20 699500 -- (-1235.897) (-1235.080) [-1235.026] (-1238.325) * (-1236.245) [-1238.054] (-1234.002) (-1234.997) -- 0:00:20 700000 -- (-1237.013) (-1238.269) (-1236.247) [-1236.674] * (-1234.865) (-1236.892) (-1235.473) [-1233.335] -- 0:00:20 Average standard deviation of split frequencies: 0.008113 700500 -- (-1237.550) (-1236.940) [-1236.702] (-1238.109) * (-1233.827) (-1237.021) [-1234.909] (-1235.873) -- 0:00:20 701000 -- (-1239.377) [-1236.364] (-1235.174) (-1239.885) * (-1236.340) (-1237.503) (-1234.744) [-1236.605] -- 0:00:20 701500 -- [-1235.955] (-1235.386) (-1238.341) (-1238.904) * (-1235.326) (-1238.050) (-1236.453) [-1235.896] -- 0:00:19 702000 -- (-1238.183) (-1237.269) [-1235.713] (-1239.513) * (-1236.896) [-1237.327] (-1233.589) (-1236.382) -- 0:00:19 702500 -- [-1235.546] (-1236.690) (-1235.776) (-1238.463) * (-1238.314) [-1238.656] (-1241.033) (-1236.040) -- 0:00:19 703000 -- (-1237.225) (-1234.522) [-1236.263] (-1235.502) * (-1237.166) (-1238.012) (-1233.649) [-1235.122] -- 0:00:19 703500 -- (-1239.956) (-1237.947) [-1234.933] (-1235.015) * (-1236.104) (-1240.322) (-1236.729) [-1241.267] -- 0:00:20 704000 -- [-1234.988] (-1237.740) (-1235.423) (-1235.969) * [-1233.212] (-1239.110) (-1237.543) (-1238.686) -- 0:00:20 704500 -- [-1235.009] (-1235.173) (-1235.233) (-1238.941) * (-1238.013) (-1236.434) (-1235.371) [-1237.337] -- 0:00:20 705000 -- (-1234.979) (-1237.669) [-1236.630] (-1235.031) * [-1233.096] (-1237.144) (-1235.328) (-1238.090) -- 0:00:20 Average standard deviation of split frequencies: 0.007720 705500 -- (-1233.711) (-1237.908) (-1234.364) [-1233.557] * [-1232.146] (-1235.102) (-1235.323) (-1237.918) -- 0:00:20 706000 -- (-1234.518) [-1241.232] (-1236.059) (-1234.968) * (-1234.260) (-1235.472) [-1236.614] (-1238.354) -- 0:00:19 706500 -- [-1235.788] (-1240.740) (-1235.360) (-1235.340) * (-1235.842) (-1238.243) (-1233.899) [-1234.520] -- 0:00:19 707000 -- [-1234.629] (-1237.756) (-1234.286) (-1235.011) * (-1235.794) (-1236.931) (-1232.994) [-1239.905] -- 0:00:19 707500 -- (-1234.186) (-1236.148) [-1236.068] (-1238.264) * (-1234.424) [-1236.354] (-1236.523) (-1238.214) -- 0:00:19 708000 -- (-1238.099) [-1237.579] (-1234.744) (-1238.131) * (-1235.101) (-1234.397) (-1236.058) [-1235.783] -- 0:00:19 708500 -- (-1234.137) (-1236.030) [-1233.473] (-1237.726) * (-1237.074) (-1237.149) [-1236.569] (-1236.263) -- 0:00:19 709000 -- (-1235.897) (-1236.995) [-1234.433] (-1235.080) * (-1235.062) (-1236.464) [-1234.463] (-1239.677) -- 0:00:19 709500 -- [-1232.855] (-1239.342) (-1234.805) (-1233.080) * [-1236.970] (-1234.844) (-1240.078) (-1236.770) -- 0:00:19 710000 -- (-1234.826) [-1236.236] (-1234.871) (-1233.384) * (-1234.876) (-1237.770) (-1234.207) [-1234.663] -- 0:00:19 Average standard deviation of split frequencies: 0.007545 710500 -- (-1235.091) (-1240.426) [-1235.944] (-1233.638) * (-1235.641) [-1236.429] (-1237.342) (-1238.686) -- 0:00:19 711000 -- [-1235.510] (-1236.407) (-1235.576) (-1234.306) * (-1238.693) (-1235.705) [-1236.178] (-1238.520) -- 0:00:19 711500 -- (-1235.077) [-1234.634] (-1237.471) (-1235.426) * [-1234.654] (-1240.129) (-1236.260) (-1234.189) -- 0:00:19 712000 -- [-1234.722] (-1237.300) (-1237.183) (-1234.743) * (-1238.520) [-1236.904] (-1238.617) (-1235.079) -- 0:00:19 712500 -- (-1235.174) [-1236.941] (-1236.085) (-1237.298) * (-1239.225) [-1235.974] (-1234.623) (-1233.700) -- 0:00:19 713000 -- (-1234.970) (-1237.040) [-1234.113] (-1237.437) * (-1235.055) (-1240.526) (-1233.525) [-1235.197] -- 0:00:19 713500 -- [-1236.252] (-1241.272) (-1235.272) (-1237.367) * (-1236.743) (-1236.081) [-1232.345] (-1235.014) -- 0:00:19 714000 -- [-1235.404] (-1237.802) (-1237.264) (-1238.529) * [-1234.720] (-1245.487) (-1232.538) (-1233.645) -- 0:00:19 714500 -- (-1234.970) (-1237.748) (-1235.707) [-1235.620] * (-1243.131) (-1234.930) [-1232.600] (-1235.488) -- 0:00:19 715000 -- [-1237.413] (-1240.707) (-1234.187) (-1239.746) * (-1235.272) (-1235.472) [-1234.247] (-1233.837) -- 0:00:19 Average standard deviation of split frequencies: 0.007489 715500 -- (-1240.502) (-1237.121) [-1234.575] (-1235.899) * (-1235.435) (-1238.736) [-1232.854] (-1237.989) -- 0:00:19 716000 -- (-1234.040) [-1233.516] (-1235.553) (-1236.964) * (-1236.698) [-1235.297] (-1235.229) (-1236.763) -- 0:00:19 716500 -- (-1236.284) (-1235.425) (-1238.162) [-1234.810] * (-1234.545) (-1235.277) [-1232.968] (-1235.318) -- 0:00:18 717000 -- [-1236.220] (-1236.595) (-1238.218) (-1236.571) * (-1235.681) [-1235.780] (-1233.743) (-1236.112) -- 0:00:18 717500 -- (-1240.153) (-1235.457) [-1238.308] (-1233.988) * [-1234.891] (-1235.274) (-1235.856) (-1235.586) -- 0:00:18 718000 -- (-1242.030) (-1234.747) [-1236.587] (-1235.325) * [-1233.493] (-1236.373) (-1235.801) (-1236.404) -- 0:00:18 718500 -- (-1236.708) (-1235.633) (-1234.916) [-1236.449] * [-1234.707] (-1233.901) (-1234.280) (-1235.653) -- 0:00:19 719000 -- (-1237.891) [-1235.070] (-1235.242) (-1236.011) * (-1235.891) [-1235.988] (-1234.929) (-1236.408) -- 0:00:19 719500 -- (-1240.120) (-1235.037) (-1237.911) [-1236.846] * (-1240.839) (-1235.162) (-1233.796) [-1237.853] -- 0:00:19 720000 -- (-1235.807) [-1237.615] (-1235.226) (-1239.082) * (-1234.450) [-1234.918] (-1239.459) (-1237.717) -- 0:00:19 Average standard deviation of split frequencies: 0.007195 720500 -- (-1235.273) (-1243.193) (-1237.230) [-1235.183] * [-1233.029] (-1236.460) (-1234.908) (-1235.589) -- 0:00:19 721000 -- (-1234.101) (-1240.206) (-1238.049) [-1234.889] * (-1235.056) (-1235.698) [-1234.196] (-1236.338) -- 0:00:18 721500 -- (-1235.116) (-1238.916) [-1236.131] (-1236.160) * (-1236.431) (-1235.969) [-1233.338] (-1236.165) -- 0:00:18 722000 -- (-1235.733) (-1240.679) (-1236.519) [-1234.966] * [-1234.173] (-1235.303) (-1234.794) (-1236.886) -- 0:00:18 722500 -- (-1238.915) (-1235.318) [-1237.087] (-1235.750) * (-1235.897) (-1236.031) (-1235.777) [-1234.552] -- 0:00:18 723000 -- (-1237.627) [-1234.952] (-1235.667) (-1236.664) * (-1236.105) (-1240.134) [-1234.143] (-1238.189) -- 0:00:18 723500 -- (-1239.582) (-1236.422) (-1239.549) [-1232.729] * [-1237.372] (-1241.231) (-1234.027) (-1237.680) -- 0:00:18 724000 -- (-1234.457) (-1235.329) [-1239.174] (-1236.756) * [-1233.690] (-1236.396) (-1236.910) (-1233.864) -- 0:00:18 724500 -- (-1235.383) [-1234.221] (-1235.593) (-1235.443) * (-1234.879) (-1234.955) (-1237.810) [-1236.765] -- 0:00:18 725000 -- (-1237.748) (-1236.830) (-1235.588) [-1233.978] * (-1235.076) (-1236.331) [-1236.379] (-1235.259) -- 0:00:18 Average standard deviation of split frequencies: 0.007670 725500 -- (-1237.181) (-1234.386) (-1237.573) [-1235.248] * (-1235.198) [-1237.413] (-1235.917) (-1239.131) -- 0:00:18 726000 -- (-1237.075) [-1233.292] (-1240.710) (-1234.238) * [-1236.067] (-1236.964) (-1235.012) (-1236.771) -- 0:00:18 726500 -- (-1236.399) [-1236.157] (-1236.248) (-1235.162) * (-1236.068) (-1236.040) [-1236.577] (-1236.866) -- 0:00:18 727000 -- (-1234.533) (-1232.671) (-1235.260) [-1235.344] * [-1236.904] (-1236.811) (-1238.264) (-1237.333) -- 0:00:18 727500 -- (-1239.832) [-1234.023] (-1235.778) (-1238.099) * (-1237.242) (-1236.870) [-1237.532] (-1237.422) -- 0:00:18 728000 -- [-1236.855] (-1236.156) (-1235.311) (-1239.192) * (-1233.581) (-1235.216) [-1238.122] (-1235.155) -- 0:00:18 728500 -- (-1237.433) [-1236.297] (-1236.520) (-1235.471) * [-1236.008] (-1240.718) (-1236.025) (-1234.779) -- 0:00:18 729000 -- (-1239.316) [-1237.901] (-1236.058) (-1238.563) * (-1238.057) [-1235.152] (-1236.063) (-1235.944) -- 0:00:18 729500 -- [-1239.810] (-1235.956) (-1235.658) (-1237.578) * (-1238.086) (-1233.013) [-1235.245] (-1240.739) -- 0:00:18 730000 -- (-1239.055) [-1235.207] (-1236.278) (-1239.616) * (-1233.128) [-1234.711] (-1237.744) (-1246.641) -- 0:00:18 Average standard deviation of split frequencies: 0.007135 730500 -- (-1241.318) (-1234.966) (-1237.372) [-1236.445] * (-1234.811) [-1239.849] (-1237.438) (-1238.310) -- 0:00:18 731000 -- (-1239.044) (-1233.339) (-1233.928) [-1235.706] * (-1235.359) (-1236.338) [-1234.671] (-1233.201) -- 0:00:18 731500 -- (-1237.307) [-1235.723] (-1235.850) (-1235.280) * [-1238.003] (-1236.286) (-1237.657) (-1235.601) -- 0:00:17 732000 -- (-1234.378) (-1233.523) [-1236.782] (-1237.838) * (-1233.426) (-1236.568) [-1233.255] (-1235.918) -- 0:00:17 732500 -- [-1235.207] (-1234.246) (-1234.573) (-1236.974) * (-1236.553) [-1236.610] (-1233.834) (-1237.636) -- 0:00:17 733000 -- (-1234.310) [-1237.056] (-1236.446) (-1235.875) * (-1236.682) (-1234.505) [-1234.691] (-1236.961) -- 0:00:17 733500 -- (-1237.183) (-1236.659) [-1236.520] (-1236.022) * (-1239.230) [-1236.158] (-1237.829) (-1236.590) -- 0:00:18 734000 -- (-1236.831) (-1237.188) [-1235.785] (-1235.180) * (-1235.314) [-1238.574] (-1237.690) (-1235.239) -- 0:00:18 734500 -- (-1236.014) (-1236.309) (-1233.727) [-1235.464] * (-1235.847) [-1236.411] (-1239.486) (-1234.576) -- 0:00:18 735000 -- [-1236.416] (-1235.816) (-1235.941) (-1236.470) * (-1237.164) (-1235.105) (-1238.056) [-1236.434] -- 0:00:18 Average standard deviation of split frequencies: 0.007196 735500 -- (-1236.908) [-1236.006] (-1233.688) (-1239.355) * (-1235.900) (-1236.029) (-1235.060) [-1236.372] -- 0:00:17 736000 -- (-1237.202) [-1235.550] (-1235.478) (-1235.534) * (-1236.305) (-1236.565) (-1235.401) [-1234.983] -- 0:00:17 736500 -- (-1236.782) (-1236.246) (-1238.631) [-1235.321] * (-1234.265) [-1237.550] (-1240.375) (-1236.493) -- 0:00:17 737000 -- (-1238.501) (-1236.240) [-1236.168] (-1238.204) * [-1236.150] (-1234.282) (-1239.630) (-1235.670) -- 0:00:17 737500 -- [-1235.958] (-1236.340) (-1237.085) (-1235.856) * (-1240.267) (-1235.519) [-1235.956] (-1235.490) -- 0:00:17 738000 -- (-1238.168) (-1236.464) [-1233.220] (-1234.462) * [-1236.542] (-1233.480) (-1233.586) (-1235.054) -- 0:00:17 738500 -- (-1236.793) [-1235.997] (-1235.936) (-1236.003) * (-1237.540) (-1235.364) [-1233.773] (-1235.755) -- 0:00:17 739000 -- (-1237.512) (-1234.267) (-1234.903) [-1234.671] * (-1235.751) [-1234.809] (-1236.013) (-1236.439) -- 0:00:17 739500 -- (-1234.466) [-1233.181] (-1235.927) (-1236.556) * (-1237.172) [-1235.226] (-1235.984) (-1236.221) -- 0:00:17 740000 -- [-1236.363] (-1233.347) (-1235.681) (-1235.591) * (-1235.843) (-1237.025) (-1239.123) [-1234.681] -- 0:00:17 Average standard deviation of split frequencies: 0.006926 740500 -- [-1233.506] (-1236.984) (-1233.577) (-1237.699) * (-1235.376) [-1234.211] (-1238.376) (-1235.351) -- 0:00:17 741000 -- (-1236.287) (-1236.844) [-1234.806] (-1238.189) * [-1234.189] (-1236.684) (-1240.477) (-1235.581) -- 0:00:17 741500 -- (-1234.230) (-1236.177) [-1235.295] (-1235.734) * (-1236.023) [-1235.208] (-1235.901) (-1237.100) -- 0:00:17 742000 -- (-1234.795) (-1235.106) [-1233.047] (-1235.481) * [-1235.085] (-1235.736) (-1236.826) (-1237.568) -- 0:00:17 742500 -- (-1236.451) [-1236.246] (-1235.666) (-1235.351) * (-1236.898) [-1234.073] (-1234.805) (-1238.766) -- 0:00:17 743000 -- (-1235.808) [-1234.761] (-1238.194) (-1233.325) * (-1236.976) [-1236.816] (-1237.359) (-1235.440) -- 0:00:17 743500 -- (-1236.881) (-1236.970) [-1233.257] (-1234.234) * [-1236.091] (-1237.333) (-1237.241) (-1234.716) -- 0:00:17 744000 -- (-1236.350) (-1236.012) (-1232.897) [-1233.215] * (-1238.107) (-1242.857) [-1234.624] (-1242.376) -- 0:00:17 744500 -- (-1236.809) [-1234.841] (-1234.260) (-1236.232) * (-1236.734) [-1234.474] (-1234.754) (-1233.572) -- 0:00:17 745000 -- (-1235.259) (-1236.587) [-1236.159] (-1239.172) * (-1236.981) (-1234.421) [-1233.322] (-1235.411) -- 0:00:17 Average standard deviation of split frequencies: 0.007025 745500 -- [-1235.341] (-1236.629) (-1235.155) (-1233.640) * [-1237.291] (-1234.919) (-1237.155) (-1235.831) -- 0:00:17 746000 -- (-1234.733) [-1234.479] (-1238.600) (-1235.525) * [-1237.539] (-1234.608) (-1238.698) (-1236.502) -- 0:00:17 746500 -- [-1236.602] (-1235.515) (-1237.805) (-1235.473) * (-1236.346) [-1238.746] (-1236.519) (-1236.958) -- 0:00:16 747000 -- (-1238.057) [-1235.421] (-1240.618) (-1235.080) * (-1236.229) (-1235.071) [-1235.006] (-1236.543) -- 0:00:16 747500 -- (-1236.463) (-1240.616) (-1234.550) [-1234.808] * (-1234.965) [-1234.758] (-1234.839) (-1236.567) -- 0:00:16 748000 -- (-1235.058) [-1235.326] (-1237.413) (-1238.644) * (-1235.203) (-1239.015) [-1234.576] (-1237.299) -- 0:00:16 748500 -- [-1234.014] (-1233.893) (-1235.526) (-1235.646) * (-1236.576) (-1236.607) (-1234.936) [-1235.421] -- 0:00:17 749000 -- [-1235.698] (-1234.932) (-1237.180) (-1235.223) * (-1234.975) (-1237.016) (-1235.967) [-1236.511] -- 0:00:17 749500 -- (-1236.996) (-1236.397) (-1238.940) [-1234.196] * (-1234.400) (-1236.702) (-1234.837) [-1238.849] -- 0:00:17 750000 -- [-1234.104] (-1237.132) (-1240.462) (-1235.455) * (-1235.693) (-1237.012) [-1234.639] (-1240.111) -- 0:00:17 Average standard deviation of split frequencies: 0.007720 750500 -- (-1233.885) (-1236.920) [-1239.401] (-1234.611) * [-1234.217] (-1236.122) (-1236.287) (-1240.122) -- 0:00:16 751000 -- (-1235.431) (-1236.965) (-1234.732) [-1236.424] * [-1236.122] (-1236.996) (-1239.410) (-1235.676) -- 0:00:16 751500 -- (-1238.255) [-1235.689] (-1235.592) (-1236.248) * (-1236.815) (-1238.327) [-1235.965] (-1233.677) -- 0:00:16 752000 -- (-1237.185) (-1236.788) [-1233.847] (-1235.528) * [-1235.667] (-1236.052) (-1234.505) (-1235.850) -- 0:00:16 752500 -- (-1237.244) (-1235.026) [-1232.954] (-1235.880) * (-1237.231) (-1237.737) (-1235.850) [-1233.480] -- 0:00:16 753000 -- [-1235.453] (-1233.925) (-1236.193) (-1235.804) * (-1235.812) (-1235.781) (-1238.470) [-1236.418] -- 0:00:16 753500 -- (-1236.356) [-1233.883] (-1234.309) (-1236.004) * (-1235.657) (-1237.982) (-1235.011) [-1234.380] -- 0:00:16 754000 -- (-1240.390) (-1234.166) [-1236.300] (-1235.930) * (-1235.777) (-1234.913) [-1234.211] (-1236.356) -- 0:00:16 754500 -- [-1237.568] (-1233.183) (-1236.659) (-1236.005) * (-1235.482) [-1233.705] (-1235.617) (-1234.431) -- 0:00:16 755000 -- (-1236.837) (-1234.503) (-1239.024) [-1237.758] * [-1238.079] (-1233.949) (-1234.239) (-1234.128) -- 0:00:16 Average standard deviation of split frequencies: 0.007409 755500 -- (-1236.072) (-1233.983) [-1236.386] (-1234.560) * (-1235.601) [-1232.157] (-1236.166) (-1235.788) -- 0:00:16 756000 -- (-1236.228) (-1234.993) (-1241.731) [-1238.668] * (-1235.229) (-1234.344) [-1235.571] (-1236.955) -- 0:00:16 756500 -- [-1235.746] (-1237.746) (-1235.585) (-1235.920) * (-1235.428) (-1236.495) (-1235.871) [-1236.572] -- 0:00:16 757000 -- (-1236.141) (-1236.362) (-1234.850) [-1235.974] * (-1236.267) [-1236.523] (-1239.969) (-1239.840) -- 0:00:16 757500 -- (-1235.769) [-1237.133] (-1234.176) (-1235.013) * (-1236.405) [-1238.627] (-1238.828) (-1235.418) -- 0:00:16 758000 -- (-1233.977) (-1236.591) (-1238.262) [-1237.997] * (-1234.986) (-1236.889) [-1235.516] (-1238.179) -- 0:00:16 758500 -- (-1234.804) (-1234.479) [-1234.624] (-1235.005) * (-1236.180) (-1236.954) [-1235.592] (-1237.777) -- 0:00:16 759000 -- [-1233.895] (-1235.410) (-1235.463) (-1233.669) * (-1236.588) [-1234.886] (-1236.688) (-1237.859) -- 0:00:16 759500 -- [-1234.605] (-1236.015) (-1234.621) (-1235.885) * (-1235.703) (-1235.108) [-1235.268] (-1237.663) -- 0:00:16 760000 -- (-1235.356) (-1234.796) [-1234.278] (-1239.719) * (-1236.605) [-1234.692] (-1235.022) (-1235.587) -- 0:00:16 Average standard deviation of split frequencies: 0.007398 760500 -- (-1238.384) [-1236.465] (-1235.883) (-1236.944) * (-1236.859) (-1234.156) [-1235.898] (-1235.841) -- 0:00:16 761000 -- (-1236.278) (-1235.018) (-1236.193) [-1234.716] * (-1236.815) (-1235.831) (-1235.466) [-1235.364] -- 0:00:16 761500 -- (-1240.996) (-1237.723) [-1236.614] (-1236.030) * [-1235.344] (-1237.593) (-1234.765) (-1237.240) -- 0:00:15 762000 -- (-1240.188) (-1238.947) (-1236.452) [-1235.455] * [-1237.349] (-1234.241) (-1234.364) (-1238.247) -- 0:00:15 762500 -- (-1235.194) (-1235.212) (-1241.761) [-1234.021] * (-1238.022) (-1234.509) (-1235.683) [-1236.869] -- 0:00:15 763000 -- (-1237.344) [-1239.207] (-1238.077) (-1237.176) * (-1237.397) (-1234.213) [-1234.734] (-1238.064) -- 0:00:15 763500 -- (-1234.206) (-1240.317) (-1236.964) [-1238.909] * [-1236.786] (-1235.352) (-1235.603) (-1236.065) -- 0:00:16 764000 -- (-1234.300) (-1241.327) [-1236.578] (-1235.278) * (-1236.105) [-1235.979] (-1233.348) (-1236.137) -- 0:00:16 764500 -- (-1235.516) (-1234.980) [-1238.036] (-1236.171) * [-1236.162] (-1237.648) (-1235.846) (-1237.064) -- 0:00:16 765000 -- (-1235.138) (-1235.153) (-1234.128) [-1234.285] * [-1234.472] (-1237.509) (-1234.391) (-1235.936) -- 0:00:15 Average standard deviation of split frequencies: 0.008145 765500 -- (-1236.961) (-1235.235) (-1240.490) [-1237.937] * (-1237.783) (-1236.637) [-1233.981] (-1233.932) -- 0:00:15 766000 -- (-1237.262) [-1234.920] (-1236.205) (-1239.052) * (-1238.339) (-1236.107) (-1234.950) [-1232.665] -- 0:00:15 766500 -- [-1237.254] (-1235.722) (-1234.908) (-1234.307) * (-1235.018) (-1235.032) (-1235.589) [-1233.713] -- 0:00:15 767000 -- (-1234.966) (-1238.772) (-1234.924) [-1235.147] * [-1234.035] (-1235.588) (-1234.522) (-1236.226) -- 0:00:15 767500 -- (-1236.157) (-1238.400) (-1238.330) [-1234.104] * (-1243.948) (-1236.061) (-1236.096) [-1234.674] -- 0:00:15 768000 -- (-1235.272) (-1238.416) (-1235.947) [-1237.460] * (-1235.622) (-1234.629) [-1235.117] (-1235.172) -- 0:00:15 768500 -- (-1234.125) (-1236.588) (-1234.940) [-1235.568] * (-1235.935) (-1238.079) (-1234.560) [-1235.287] -- 0:00:15 769000 -- (-1242.445) (-1237.179) (-1238.217) [-1237.928] * [-1233.688] (-1234.097) (-1235.076) (-1237.468) -- 0:00:15 769500 -- (-1249.099) (-1239.710) [-1233.952] (-1241.954) * (-1234.342) [-1234.872] (-1239.473) (-1235.543) -- 0:00:15 770000 -- (-1235.137) (-1237.562) (-1235.498) [-1236.319] * [-1235.780] (-1236.577) (-1234.530) (-1235.309) -- 0:00:15 Average standard deviation of split frequencies: 0.008028 770500 -- (-1236.536) (-1234.154) [-1234.274] (-1234.902) * (-1237.287) (-1235.914) [-1235.149] (-1236.464) -- 0:00:15 771000 -- [-1235.343] (-1240.011) (-1233.895) (-1235.611) * (-1236.832) (-1236.544) (-1241.621) [-1237.310] -- 0:00:15 771500 -- (-1235.973) [-1236.487] (-1244.106) (-1238.328) * (-1234.085) [-1234.516] (-1236.862) (-1236.494) -- 0:00:15 772000 -- (-1233.983) [-1236.674] (-1244.558) (-1235.228) * [-1234.759] (-1234.096) (-1236.664) (-1235.715) -- 0:00:15 772500 -- (-1234.111) (-1235.698) (-1242.801) [-1235.416] * [-1236.440] (-1232.917) (-1236.932) (-1235.161) -- 0:00:15 773000 -- [-1234.680] (-1233.876) (-1239.439) (-1236.868) * (-1236.975) [-1233.839] (-1236.542) (-1236.022) -- 0:00:15 773500 -- (-1235.720) [-1234.662] (-1237.736) (-1235.196) * (-1237.205) (-1233.313) [-1236.057] (-1236.080) -- 0:00:15 774000 -- (-1236.540) (-1233.316) [-1237.802] (-1235.298) * (-1242.633) (-1236.612) (-1233.868) [-1234.831] -- 0:00:15 774500 -- (-1236.355) (-1236.219) (-1237.880) [-1235.370] * (-1235.741) (-1234.751) (-1234.035) [-1234.651] -- 0:00:15 775000 -- (-1235.317) [-1234.749] (-1236.094) (-1239.716) * (-1241.210) (-1240.397) [-1234.070] (-1235.250) -- 0:00:15 Average standard deviation of split frequencies: 0.008581 775500 -- (-1235.672) (-1234.233) [-1234.134] (-1239.807) * (-1242.402) (-1236.220) [-1236.245] (-1236.093) -- 0:00:15 776000 -- (-1235.050) [-1235.099] (-1237.176) (-1235.983) * (-1234.000) [-1235.976] (-1236.284) (-1237.501) -- 0:00:15 776500 -- (-1238.945) (-1237.362) (-1234.774) [-1235.689] * [-1235.099] (-1234.665) (-1234.740) (-1236.109) -- 0:00:14 777000 -- (-1240.008) [-1238.151] (-1238.293) (-1237.593) * [-1235.316] (-1232.954) (-1236.945) (-1235.527) -- 0:00:14 777500 -- (-1237.049) [-1239.782] (-1240.254) (-1237.079) * (-1236.189) [-1233.977] (-1236.694) (-1237.000) -- 0:00:14 778000 -- (-1238.130) (-1234.506) [-1233.694] (-1234.952) * (-1235.669) [-1233.628] (-1236.710) (-1235.037) -- 0:00:14 778500 -- [-1236.751] (-1234.459) (-1236.285) (-1235.613) * (-1234.796) [-1233.728] (-1235.344) (-1237.334) -- 0:00:14 779000 -- (-1234.591) (-1235.530) (-1238.249) [-1236.746] * [-1237.965] (-1235.440) (-1238.975) (-1236.106) -- 0:00:15 779500 -- (-1236.468) [-1236.091] (-1238.142) (-1237.155) * (-1237.664) (-1235.309) (-1235.379) [-1237.205] -- 0:00:14 780000 -- (-1235.131) (-1235.497) (-1235.171) [-1235.576] * (-1237.062) (-1239.194) [-1232.789] (-1237.876) -- 0:00:14 Average standard deviation of split frequencies: 0.008227 780500 -- (-1236.105) (-1238.008) [-1234.618] (-1235.842) * (-1236.872) [-1235.744] (-1236.740) (-1235.832) -- 0:00:14 781000 -- (-1236.139) (-1235.994) [-1234.448] (-1236.988) * (-1235.238) (-1237.672) (-1234.222) [-1232.414] -- 0:00:14 781500 -- (-1236.382) (-1238.809) (-1236.860) [-1235.949] * (-1235.119) (-1234.875) (-1233.144) [-1236.311] -- 0:00:14 782000 -- [-1235.065] (-1234.141) (-1235.974) (-1240.904) * (-1236.451) (-1235.910) (-1234.079) [-1235.662] -- 0:00:14 782500 -- (-1235.813) [-1235.432] (-1235.402) (-1235.080) * (-1236.802) (-1237.232) [-1234.111] (-1234.354) -- 0:00:14 783000 -- [-1235.119] (-1235.356) (-1235.605) (-1232.526) * (-1234.810) [-1233.617] (-1235.072) (-1235.539) -- 0:00:14 783500 -- (-1235.288) [-1234.400] (-1236.340) (-1237.970) * [-1234.322] (-1235.267) (-1235.451) (-1233.424) -- 0:00:14 784000 -- (-1237.309) (-1234.248) (-1235.525) [-1234.997] * (-1235.891) (-1238.726) [-1235.262] (-1233.186) -- 0:00:14 784500 -- (-1238.052) (-1235.491) (-1235.337) [-1234.010] * (-1236.541) [-1238.253] (-1234.892) (-1234.399) -- 0:00:14 785000 -- (-1236.864) [-1233.962] (-1234.962) (-1235.004) * (-1237.090) [-1236.349] (-1235.361) (-1233.548) -- 0:00:14 Average standard deviation of split frequencies: 0.007872 785500 -- (-1240.596) [-1232.953] (-1235.550) (-1235.240) * [-1235.088] (-1235.653) (-1234.690) (-1239.466) -- 0:00:14 786000 -- (-1239.184) (-1235.827) (-1235.859) [-1235.910] * (-1237.542) (-1238.652) [-1235.332] (-1233.556) -- 0:00:14 786500 -- [-1238.836] (-1236.516) (-1235.735) (-1234.646) * (-1238.341) (-1236.668) [-1235.416] (-1234.112) -- 0:00:14 787000 -- (-1238.698) (-1234.490) [-1234.654] (-1235.288) * (-1237.676) [-1236.338] (-1235.651) (-1232.492) -- 0:00:14 787500 -- (-1243.656) [-1235.570] (-1235.943) (-1235.342) * (-1240.357) [-1235.840] (-1235.982) (-1240.190) -- 0:00:14 788000 -- (-1241.716) (-1239.846) (-1236.025) [-1235.956] * (-1234.689) (-1234.894) [-1235.353] (-1235.660) -- 0:00:14 788500 -- (-1234.496) (-1239.127) [-1237.279] (-1237.986) * [-1235.790] (-1236.527) (-1235.265) (-1235.079) -- 0:00:14 789000 -- [-1234.022] (-1235.519) (-1234.942) (-1237.096) * (-1237.314) (-1234.733) (-1237.385) [-1233.504] -- 0:00:14 789500 -- (-1235.208) (-1234.471) [-1234.789] (-1237.333) * (-1236.355) [-1233.801] (-1236.813) (-1235.539) -- 0:00:14 790000 -- (-1235.242) (-1234.565) [-1234.332] (-1241.794) * (-1235.345) (-1235.444) [-1239.489] (-1233.338) -- 0:00:14 Average standard deviation of split frequencies: 0.007639 790500 -- (-1234.920) [-1234.980] (-1233.799) (-1235.784) * (-1234.539) (-1236.526) (-1237.939) [-1235.379] -- 0:00:14 791000 -- (-1235.004) (-1235.575) (-1236.286) [-1233.591] * (-1236.779) [-1234.466] (-1236.829) (-1234.520) -- 0:00:14 791500 -- [-1234.667] (-1237.166) (-1238.657) (-1236.864) * (-1236.432) (-1235.953) [-1236.184] (-1235.605) -- 0:00:13 792000 -- (-1234.096) [-1239.564] (-1236.310) (-1235.473) * (-1238.078) (-1235.658) (-1236.423) [-1235.241] -- 0:00:13 792500 -- (-1237.357) (-1234.595) [-1237.652] (-1235.593) * [-1235.838] (-1235.415) (-1234.754) (-1235.866) -- 0:00:13 793000 -- (-1236.050) [-1235.067] (-1236.924) (-1235.738) * [-1235.098] (-1235.630) (-1238.231) (-1235.156) -- 0:00:13 793500 -- (-1241.585) (-1234.827) (-1234.893) [-1236.518] * [-1233.558] (-1237.377) (-1235.798) (-1237.089) -- 0:00:13 794000 -- (-1239.090) (-1236.260) [-1237.525] (-1236.287) * (-1235.932) [-1234.975] (-1238.581) (-1235.077) -- 0:00:14 794500 -- (-1237.313) (-1234.764) [-1237.260] (-1237.065) * (-1233.278) (-1236.621) [-1235.919] (-1234.050) -- 0:00:13 795000 -- [-1239.199] (-1234.866) (-1237.520) (-1238.945) * (-1235.723) [-1235.827] (-1236.493) (-1234.289) -- 0:00:13 Average standard deviation of split frequencies: 0.007662 795500 -- (-1239.116) (-1235.006) [-1233.789] (-1240.034) * (-1236.638) [-1234.699] (-1238.117) (-1232.671) -- 0:00:13 796000 -- (-1237.693) (-1236.640) (-1235.364) [-1236.397] * (-1235.208) (-1235.294) (-1235.854) [-1236.837] -- 0:00:13 796500 -- [-1235.176] (-1236.988) (-1235.901) (-1234.767) * (-1239.298) [-1233.677] (-1239.214) (-1234.847) -- 0:00:13 797000 -- [-1231.864] (-1236.897) (-1234.528) (-1235.086) * [-1235.963] (-1235.565) (-1237.735) (-1236.032) -- 0:00:13 797500 -- [-1232.013] (-1237.264) (-1236.641) (-1234.866) * (-1235.790) [-1236.570] (-1241.445) (-1236.809) -- 0:00:13 798000 -- (-1234.557) [-1237.162] (-1235.404) (-1236.759) * (-1236.979) (-1235.678) (-1236.872) [-1238.624] -- 0:00:13 798500 -- (-1233.329) (-1235.157) [-1233.625] (-1236.280) * [-1235.344] (-1236.939) (-1235.010) (-1234.667) -- 0:00:13 799000 -- (-1235.059) (-1235.874) (-1236.876) [-1235.881] * (-1236.319) [-1235.495] (-1234.257) (-1234.451) -- 0:00:13 799500 -- [-1235.820] (-1236.601) (-1234.656) (-1235.797) * (-1236.571) (-1235.360) (-1234.275) [-1234.952] -- 0:00:13 800000 -- [-1232.227] (-1235.756) (-1234.450) (-1236.118) * (-1235.633) (-1237.333) (-1236.141) [-1234.169] -- 0:00:13 Average standard deviation of split frequencies: 0.007433 800500 -- (-1238.504) (-1236.669) [-1234.854] (-1235.541) * (-1235.621) [-1236.061] (-1233.444) (-1238.555) -- 0:00:13 801000 -- (-1236.200) [-1237.562] (-1233.631) (-1236.460) * (-1237.705) (-1241.277) (-1235.574) [-1236.991] -- 0:00:13 801500 -- (-1236.906) (-1236.222) [-1234.584] (-1235.538) * (-1234.313) [-1237.545] (-1233.708) (-1237.633) -- 0:00:13 802000 -- (-1233.523) [-1239.669] (-1234.697) (-1235.152) * (-1235.838) (-1235.646) [-1233.474] (-1240.336) -- 0:00:13 802500 -- [-1237.608] (-1235.438) (-1235.597) (-1239.666) * (-1234.521) (-1236.427) [-1233.889] (-1238.880) -- 0:00:13 803000 -- [-1235.243] (-1234.927) (-1234.921) (-1237.659) * (-1238.244) [-1236.683] (-1237.764) (-1235.397) -- 0:00:13 803500 -- (-1236.963) (-1236.363) (-1235.283) [-1238.568] * (-1234.668) (-1237.097) [-1234.438] (-1234.201) -- 0:00:13 804000 -- (-1238.646) (-1235.870) (-1234.882) [-1236.259] * [-1233.669] (-1235.315) (-1235.402) (-1233.026) -- 0:00:13 804500 -- (-1236.400) (-1235.061) (-1236.672) [-1234.517] * [-1235.030] (-1237.231) (-1236.171) (-1237.207) -- 0:00:13 805000 -- (-1237.111) (-1236.009) (-1236.123) [-1237.041] * [-1237.330] (-1242.387) (-1236.858) (-1234.222) -- 0:00:13 Average standard deviation of split frequencies: 0.007457 805500 -- (-1239.022) (-1234.706) (-1234.531) [-1237.799] * (-1233.232) (-1242.371) (-1236.583) [-1237.920] -- 0:00:13 806000 -- (-1236.055) (-1236.914) [-1235.437] (-1239.147) * [-1237.113] (-1236.819) (-1237.705) (-1237.874) -- 0:00:12 806500 -- [-1238.217] (-1235.966) (-1235.333) (-1236.416) * (-1236.168) [-1234.860] (-1238.557) (-1236.559) -- 0:00:12 807000 -- (-1238.536) [-1236.358] (-1238.056) (-1235.992) * [-1234.745] (-1237.982) (-1235.028) (-1237.854) -- 0:00:12 807500 -- (-1234.181) (-1236.245) (-1238.360) [-1234.843] * (-1237.698) (-1237.715) (-1234.597) [-1235.241] -- 0:00:12 808000 -- (-1236.529) (-1240.587) [-1235.676] (-1236.162) * (-1238.157) [-1237.890] (-1234.879) (-1234.780) -- 0:00:13 808500 -- (-1234.216) (-1235.478) [-1237.580] (-1235.789) * (-1236.865) (-1237.545) (-1233.075) [-1234.279] -- 0:00:13 809000 -- (-1235.791) (-1236.385) [-1236.445] (-1238.719) * (-1235.849) (-1241.414) [-1234.938] (-1235.508) -- 0:00:12 809500 -- (-1234.358) (-1236.804) (-1237.945) [-1237.139] * [-1236.873] (-1234.689) (-1237.786) (-1238.636) -- 0:00:12 810000 -- (-1234.625) [-1235.723] (-1235.765) (-1239.638) * [-1236.146] (-1238.610) (-1233.936) (-1236.022) -- 0:00:12 Average standard deviation of split frequencies: 0.006578 810500 -- (-1233.789) (-1235.651) (-1237.257) [-1235.731] * (-1235.111) [-1233.557] (-1234.377) (-1236.067) -- 0:00:12 811000 -- [-1233.835] (-1235.424) (-1238.695) (-1245.348) * [-1238.426] (-1243.268) (-1235.355) (-1237.675) -- 0:00:12 811500 -- (-1237.932) (-1237.742) (-1239.510) [-1236.783] * (-1237.178) [-1234.451] (-1235.402) (-1237.518) -- 0:00:12 812000 -- (-1237.359) (-1238.427) (-1236.783) [-1238.179] * (-1238.546) (-1232.898) [-1238.582] (-1236.360) -- 0:00:12 812500 -- [-1233.826] (-1235.793) (-1235.878) (-1237.293) * (-1237.361) (-1234.928) (-1234.624) [-1235.199] -- 0:00:12 813000 -- [-1234.516] (-1237.359) (-1235.193) (-1240.054) * (-1235.461) (-1232.773) (-1234.076) [-1235.041] -- 0:00:12 813500 -- (-1239.308) (-1235.736) (-1245.429) [-1235.966] * (-1235.936) (-1232.909) (-1236.362) [-1235.469] -- 0:00:12 814000 -- [-1234.324] (-1235.792) (-1236.159) (-1236.274) * [-1235.444] (-1235.127) (-1237.226) (-1238.193) -- 0:00:12 814500 -- (-1234.106) [-1235.577] (-1237.684) (-1234.060) * (-1237.748) (-1232.662) (-1235.906) [-1238.716] -- 0:00:12 815000 -- [-1233.992] (-1238.933) (-1236.847) (-1236.982) * (-1237.252) [-1236.174] (-1238.420) (-1235.232) -- 0:00:12 Average standard deviation of split frequencies: 0.006499 815500 -- (-1235.313) (-1237.668) [-1234.659] (-1234.753) * (-1237.233) (-1239.016) (-1237.222) [-1235.492] -- 0:00:12 816000 -- [-1235.159] (-1238.481) (-1235.416) (-1234.898) * (-1235.118) [-1233.516] (-1236.429) (-1234.288) -- 0:00:12 816500 -- [-1238.448] (-1236.220) (-1236.231) (-1235.819) * (-1234.998) (-1232.649) [-1235.137] (-1234.322) -- 0:00:12 817000 -- [-1237.556] (-1236.644) (-1237.289) (-1235.425) * (-1233.283) (-1235.017) (-1236.723) [-1237.362] -- 0:00:12 817500 -- (-1234.436) [-1235.041] (-1238.250) (-1236.820) * [-1232.886] (-1233.444) (-1234.967) (-1236.526) -- 0:00:12 818000 -- (-1234.996) (-1234.138) (-1237.529) [-1234.254] * (-1234.248) (-1239.613) (-1234.326) [-1236.846] -- 0:00:12 818500 -- (-1235.705) [-1234.744] (-1235.592) (-1234.196) * (-1235.639) (-1235.628) (-1237.393) [-1234.626] -- 0:00:12 819000 -- (-1239.986) (-1234.970) [-1235.960] (-1233.633) * [-1233.351] (-1237.161) (-1237.784) (-1237.508) -- 0:00:12 819500 -- [-1238.975] (-1238.459) (-1240.184) (-1235.376) * (-1237.069) [-1237.555] (-1237.636) (-1236.020) -- 0:00:12 820000 -- (-1237.840) [-1235.598] (-1240.304) (-1235.244) * (-1234.288) (-1234.656) [-1234.740] (-1235.111) -- 0:00:12 Average standard deviation of split frequencies: 0.006713 820500 -- [-1239.528] (-1235.146) (-1237.051) (-1235.518) * (-1240.603) (-1234.527) (-1237.581) [-1235.645] -- 0:00:12 821000 -- (-1234.198) (-1237.103) [-1234.692] (-1237.316) * (-1235.286) (-1237.621) [-1237.750] (-1235.235) -- 0:00:11 821500 -- (-1236.702) (-1237.214) (-1235.655) [-1234.022] * (-1235.677) [-1235.056] (-1236.257) (-1235.294) -- 0:00:11 822000 -- (-1235.505) (-1235.288) (-1235.490) [-1235.838] * (-1235.834) (-1236.476) (-1233.765) [-1235.885] -- 0:00:11 822500 -- [-1235.099] (-1234.764) (-1236.758) (-1237.057) * (-1236.835) (-1236.799) [-1232.898] (-1241.695) -- 0:00:11 823000 -- [-1236.718] (-1234.608) (-1237.343) (-1236.242) * (-1236.483) (-1234.950) [-1234.611] (-1235.880) -- 0:00:12 823500 -- [-1235.545] (-1235.717) (-1238.207) (-1236.061) * (-1234.838) (-1235.902) (-1235.956) [-1237.002] -- 0:00:12 824000 -- (-1235.487) (-1237.204) [-1238.995] (-1235.622) * (-1236.217) (-1237.096) [-1233.230] (-1234.084) -- 0:00:11 824500 -- [-1235.897] (-1233.919) (-1236.149) (-1237.824) * (-1234.424) (-1234.076) (-1236.119) [-1236.049] -- 0:00:11 825000 -- [-1234.923] (-1236.844) (-1237.201) (-1241.272) * [-1235.585] (-1234.700) (-1234.429) (-1236.775) -- 0:00:11 Average standard deviation of split frequencies: 0.007098 825500 -- (-1236.134) (-1235.766) [-1235.262] (-1240.578) * (-1236.384) [-1235.554] (-1235.985) (-1237.635) -- 0:00:11 826000 -- (-1236.400) (-1236.012) (-1237.168) [-1240.786] * (-1238.029) (-1235.321) [-1235.757] (-1236.068) -- 0:00:11 826500 -- (-1235.974) [-1238.649] (-1235.539) (-1238.012) * (-1235.565) [-1237.052] (-1234.665) (-1234.064) -- 0:00:11 827000 -- [-1235.875] (-1235.972) (-1235.832) (-1234.652) * (-1236.069) [-1235.426] (-1234.276) (-1234.362) -- 0:00:11 827500 -- (-1236.330) (-1238.605) [-1235.578] (-1236.106) * [-1234.733] (-1235.803) (-1244.389) (-1234.909) -- 0:00:11 828000 -- (-1239.215) (-1236.388) [-1236.248] (-1235.994) * [-1237.211] (-1234.221) (-1238.413) (-1234.409) -- 0:00:11 828500 -- (-1235.926) [-1234.697] (-1234.370) (-1234.769) * (-1234.676) (-1235.757) (-1234.712) [-1234.210] -- 0:00:11 829000 -- (-1237.218) [-1232.993] (-1234.734) (-1236.890) * (-1236.227) [-1234.489] (-1235.129) (-1235.976) -- 0:00:11 829500 -- (-1241.137) (-1235.892) (-1235.149) [-1239.235] * (-1242.613) (-1234.135) [-1235.508] (-1236.175) -- 0:00:11 830000 -- [-1234.633] (-1235.581) (-1236.263) (-1238.248) * (-1235.903) (-1236.302) [-1237.079] (-1233.434) -- 0:00:11 Average standard deviation of split frequencies: 0.006987 830500 -- (-1236.374) (-1235.387) (-1235.659) [-1236.440] * (-1236.242) (-1236.609) (-1235.413) [-1236.389] -- 0:00:11 831000 -- [-1233.260] (-1235.445) (-1238.378) (-1240.447) * [-1234.051] (-1235.949) (-1237.595) (-1235.176) -- 0:00:11 831500 -- (-1236.635) (-1233.850) (-1238.641) [-1239.363] * (-1234.386) (-1235.698) (-1237.235) [-1232.967] -- 0:00:11 832000 -- [-1236.225] (-1233.546) (-1238.918) (-1233.594) * (-1234.536) [-1235.464] (-1238.370) (-1237.337) -- 0:00:11 832500 -- (-1236.603) [-1233.862] (-1238.876) (-1242.701) * [-1235.833] (-1233.891) (-1236.831) (-1236.924) -- 0:00:11 833000 -- (-1236.074) (-1232.933) [-1238.357] (-1238.513) * [-1233.816] (-1236.778) (-1237.702) (-1236.854) -- 0:00:11 833500 -- (-1234.968) [-1238.250] (-1237.419) (-1239.919) * [-1233.854] (-1236.234) (-1236.002) (-1236.245) -- 0:00:11 834000 -- (-1236.377) [-1235.665] (-1234.741) (-1243.313) * [-1234.408] (-1236.892) (-1234.935) (-1233.735) -- 0:00:11 834500 -- [-1236.005] (-1235.864) (-1237.197) (-1237.522) * (-1235.100) [-1236.248] (-1237.971) (-1234.786) -- 0:00:11 835000 -- (-1236.340) [-1235.235] (-1240.556) (-1234.426) * (-1235.378) [-1238.600] (-1240.425) (-1237.727) -- 0:00:11 Average standard deviation of split frequencies: 0.007049 835500 -- (-1234.145) (-1234.910) [-1236.887] (-1234.777) * (-1235.478) (-1240.631) (-1235.527) [-1235.812] -- 0:00:11 836000 -- (-1237.091) (-1234.405) [-1239.840] (-1239.447) * (-1234.415) (-1235.038) (-1238.568) [-1235.021] -- 0:00:10 836500 -- (-1236.475) [-1234.754] (-1241.222) (-1234.607) * (-1237.043) (-1233.787) [-1236.183] (-1235.044) -- 0:00:10 837000 -- (-1241.629) [-1234.301] (-1236.813) (-1237.164) * (-1236.284) (-1236.632) (-1233.451) [-1235.905] -- 0:00:10 837500 -- (-1234.282) (-1235.243) (-1235.659) [-1232.875] * [-1236.213] (-1235.257) (-1235.035) (-1238.594) -- 0:00:10 838000 -- (-1235.326) [-1234.665] (-1236.456) (-1233.575) * [-1237.695] (-1233.643) (-1233.884) (-1235.877) -- 0:00:11 838500 -- [-1234.241] (-1235.441) (-1237.352) (-1234.568) * [-1238.822] (-1232.731) (-1234.529) (-1238.102) -- 0:00:10 839000 -- (-1235.349) (-1237.994) [-1240.141] (-1234.974) * (-1240.848) [-1233.474] (-1234.809) (-1233.084) -- 0:00:10 839500 -- (-1235.742) (-1235.012) (-1239.188) [-1236.918] * (-1235.885) [-1237.862] (-1236.401) (-1234.982) -- 0:00:10 840000 -- [-1235.204] (-1236.715) (-1233.876) (-1235.949) * (-1237.962) (-1237.436) (-1235.256) [-1234.715] -- 0:00:10 Average standard deviation of split frequencies: 0.006554 840500 -- [-1233.638] (-1236.154) (-1235.663) (-1235.454) * (-1235.389) (-1240.121) (-1236.372) [-1233.248] -- 0:00:10 841000 -- (-1236.331) (-1232.738) [-1239.663] (-1237.852) * (-1234.008) (-1235.315) (-1237.449) [-1234.363] -- 0:00:10 841500 -- (-1234.942) (-1234.853) [-1236.269] (-1234.262) * (-1236.180) (-1234.958) (-1235.499) [-1234.551] -- 0:00:10 842000 -- (-1234.627) (-1234.811) [-1243.604] (-1233.846) * (-1234.827) (-1239.281) (-1235.179) [-1233.894] -- 0:00:10 842500 -- (-1234.375) [-1234.130] (-1235.094) (-1237.237) * (-1235.253) (-1237.329) [-1237.690] (-1236.796) -- 0:00:10 843000 -- [-1239.550] (-1234.497) (-1237.669) (-1234.653) * (-1233.983) [-1234.615] (-1237.326) (-1235.719) -- 0:00:10 843500 -- [-1236.597] (-1234.386) (-1235.192) (-1233.563) * (-1237.811) [-1234.432] (-1235.224) (-1232.154) -- 0:00:10 844000 -- (-1233.206) [-1239.567] (-1237.414) (-1237.431) * (-1234.875) [-1234.450] (-1236.452) (-1237.545) -- 0:00:10 844500 -- (-1237.888) (-1234.984) [-1242.196] (-1241.745) * (-1234.480) (-1234.281) (-1238.245) [-1235.490] -- 0:00:10 845000 -- (-1236.268) (-1234.374) [-1236.679] (-1238.898) * (-1240.036) (-1234.406) (-1236.191) [-1237.004] -- 0:00:10 Average standard deviation of split frequencies: 0.006443 845500 -- (-1235.765) (-1235.094) [-1235.129] (-1237.466) * (-1238.103) [-1233.786] (-1236.664) (-1233.737) -- 0:00:10 846000 -- [-1233.596] (-1237.061) (-1235.869) (-1239.692) * (-1242.615) (-1238.539) [-1236.990] (-1232.551) -- 0:00:10 846500 -- (-1233.355) (-1235.996) [-1234.375] (-1234.271) * (-1240.476) (-1239.974) [-1237.588] (-1235.167) -- 0:00:10 847000 -- (-1237.545) [-1234.848] (-1234.919) (-1240.689) * (-1238.700) (-1238.980) [-1235.031] (-1234.366) -- 0:00:10 847500 -- (-1232.955) [-1234.225] (-1238.804) (-1233.282) * (-1234.580) (-1238.926) (-1236.192) [-1236.315] -- 0:00:10 848000 -- (-1238.137) (-1233.424) [-1237.528] (-1234.776) * (-1234.234) (-1235.456) (-1240.489) [-1235.891] -- 0:00:10 848500 -- (-1239.250) (-1235.430) (-1237.137) [-1235.363] * (-1237.802) [-1235.658] (-1238.795) (-1237.486) -- 0:00:10 849000 -- [-1234.124] (-1238.195) (-1232.737) (-1239.124) * [-1233.451] (-1234.824) (-1236.603) (-1238.505) -- 0:00:10 849500 -- (-1235.909) (-1233.530) (-1235.778) [-1236.775] * (-1233.996) (-1237.035) [-1234.231] (-1237.671) -- 0:00:10 850000 -- (-1236.362) [-1234.650] (-1238.494) (-1235.236) * [-1238.598] (-1235.109) (-1236.224) (-1236.508) -- 0:00:10 Average standard deviation of split frequencies: 0.006234 850500 -- [-1232.950] (-1237.802) (-1234.863) (-1237.459) * (-1235.808) [-1233.012] (-1234.589) (-1235.916) -- 0:00:10 851000 -- (-1237.885) (-1240.561) (-1235.189) [-1237.629] * (-1242.221) (-1235.666) (-1245.781) [-1235.237] -- 0:00:09 851500 -- (-1236.698) (-1237.733) [-1233.606] (-1237.720) * (-1238.186) (-1236.699) (-1235.336) [-1234.015] -- 0:00:09 852000 -- [-1236.119] (-1237.063) (-1237.851) (-1238.187) * (-1233.890) [-1237.999] (-1235.253) (-1236.047) -- 0:00:09 852500 -- (-1233.894) [-1236.112] (-1236.686) (-1237.972) * [-1233.480] (-1238.443) (-1237.360) (-1237.385) -- 0:00:09 853000 -- (-1240.453) (-1233.359) (-1233.239) [-1233.137] * (-1234.314) (-1235.513) [-1236.561] (-1236.934) -- 0:00:09 853500 -- [-1234.989] (-1235.524) (-1236.058) (-1236.737) * (-1238.593) (-1235.012) (-1235.704) [-1236.260] -- 0:00:09 854000 -- [-1234.725] (-1236.416) (-1233.534) (-1242.657) * (-1234.761) [-1236.999] (-1234.351) (-1234.677) -- 0:00:09 854500 -- (-1237.563) (-1234.128) [-1234.315] (-1234.337) * (-1238.616) [-1238.071] (-1234.998) (-1234.775) -- 0:00:09 855000 -- (-1237.290) (-1234.944) [-1236.660] (-1233.261) * (-1239.178) [-1234.238] (-1234.372) (-1237.648) -- 0:00:09 Average standard deviation of split frequencies: 0.006161 855500 -- (-1234.689) (-1235.682) (-1246.382) [-1233.592] * [-1234.811] (-1235.321) (-1239.661) (-1236.118) -- 0:00:09 856000 -- [-1235.137] (-1235.363) (-1236.928) (-1234.722) * (-1235.258) (-1236.206) [-1237.441] (-1236.088) -- 0:00:09 856500 -- (-1235.279) (-1238.020) (-1235.288) [-1234.380] * [-1235.882] (-1235.914) (-1240.150) (-1235.783) -- 0:00:09 857000 -- (-1235.976) (-1233.750) [-1235.770] (-1238.216) * (-1234.732) [-1236.376] (-1236.460) (-1234.247) -- 0:00:09 857500 -- (-1233.947) [-1234.625] (-1238.489) (-1235.237) * (-1236.338) [-1237.668] (-1234.702) (-1235.047) -- 0:00:09 858000 -- (-1235.855) (-1234.559) [-1240.431] (-1237.812) * (-1238.020) [-1236.745] (-1235.869) (-1238.813) -- 0:00:09 858500 -- [-1235.687] (-1236.069) (-1239.611) (-1238.967) * [-1239.514] (-1239.041) (-1233.505) (-1234.003) -- 0:00:09 859000 -- (-1235.613) (-1235.415) [-1235.837] (-1234.791) * (-1236.869) (-1235.950) [-1240.487] (-1233.310) -- 0:00:09 859500 -- (-1236.192) (-1234.385) [-1234.614] (-1236.257) * (-1236.451) (-1235.853) [-1234.200] (-1234.609) -- 0:00:09 860000 -- (-1235.107) [-1237.070] (-1235.433) (-1234.812) * (-1237.763) (-1236.042) [-1235.503] (-1236.283) -- 0:00:09 Average standard deviation of split frequencies: 0.006059 860500 -- (-1238.382) [-1233.778] (-1237.783) (-1237.832) * (-1236.857) [-1235.598] (-1235.472) (-1233.253) -- 0:00:09 861000 -- (-1233.808) [-1235.397] (-1234.974) (-1235.898) * (-1236.416) (-1241.527) (-1236.473) [-1234.990] -- 0:00:09 861500 -- (-1237.422) [-1235.624] (-1235.524) (-1234.578) * [-1235.208] (-1239.107) (-1235.099) (-1234.931) -- 0:00:09 862000 -- [-1237.140] (-1233.085) (-1234.831) (-1234.136) * (-1234.817) (-1235.341) (-1237.105) [-1233.015] -- 0:00:09 862500 -- (-1237.377) [-1234.679] (-1233.218) (-1236.969) * (-1237.787) (-1237.545) (-1235.412) [-1233.895] -- 0:00:09 863000 -- (-1235.799) (-1232.486) (-1235.239) [-1236.584] * (-1238.905) (-1236.269) (-1239.790) [-1233.218] -- 0:00:09 863500 -- (-1236.408) [-1235.461] (-1236.611) (-1237.855) * (-1235.528) (-1234.761) (-1238.017) [-1237.045] -- 0:00:09 864000 -- (-1235.352) (-1235.536) [-1235.458] (-1236.390) * (-1234.805) [-1235.536] (-1237.657) (-1236.403) -- 0:00:09 864500 -- (-1236.688) (-1234.985) (-1236.403) [-1235.012] * (-1237.415) (-1236.771) (-1237.705) [-1235.038] -- 0:00:09 865000 -- (-1240.330) (-1234.120) [-1235.085] (-1234.781) * (-1237.696) (-1237.953) (-1236.056) [-1234.227] -- 0:00:09 Average standard deviation of split frequencies: 0.006124 865500 -- (-1238.218) (-1236.877) [-1236.119] (-1235.706) * [-1236.384] (-1238.465) (-1236.690) (-1236.449) -- 0:00:09 866000 -- (-1237.477) (-1236.170) [-1235.426] (-1237.308) * [-1235.907] (-1237.545) (-1235.001) (-1236.100) -- 0:00:08 866500 -- (-1235.191) [-1241.249] (-1234.518) (-1236.822) * [-1236.478] (-1235.816) (-1237.472) (-1239.208) -- 0:00:08 867000 -- (-1235.012) (-1241.740) (-1234.634) [-1234.550] * (-1236.933) [-1233.727] (-1235.170) (-1235.663) -- 0:00:08 867500 -- (-1236.015) (-1238.219) (-1235.190) [-1233.958] * [-1237.803] (-1237.793) (-1232.815) (-1238.923) -- 0:00:08 868000 -- (-1236.967) [-1239.919] (-1236.451) (-1235.013) * (-1239.471) (-1235.693) (-1234.355) [-1235.201] -- 0:00:08 868500 -- (-1237.664) (-1236.065) (-1234.728) [-1235.758] * (-1243.854) (-1238.721) (-1235.815) [-1238.405] -- 0:00:08 869000 -- (-1235.855) (-1236.180) (-1235.630) [-1238.826] * (-1237.539) (-1237.425) [-1235.914] (-1235.791) -- 0:00:08 869500 -- (-1236.952) (-1236.334) (-1237.088) [-1234.933] * [-1235.884] (-1237.888) (-1235.176) (-1237.779) -- 0:00:08 870000 -- [-1236.876] (-1236.138) (-1235.169) (-1235.466) * (-1234.996) (-1238.689) [-1232.683] (-1235.921) -- 0:00:08 Average standard deviation of split frequencies: 0.006193 870500 -- (-1235.052) [-1235.286] (-1236.751) (-1235.857) * [-1234.417] (-1236.264) (-1238.418) (-1236.091) -- 0:00:08 871000 -- (-1234.113) [-1236.134] (-1233.458) (-1235.896) * [-1235.971] (-1237.916) (-1239.125) (-1238.756) -- 0:00:08 871500 -- (-1234.497) [-1236.343] (-1235.160) (-1236.201) * (-1236.286) [-1239.145] (-1240.574) (-1235.413) -- 0:00:08 872000 -- (-1235.249) (-1235.723) [-1235.832] (-1236.806) * (-1237.266) (-1237.471) (-1237.021) [-1234.758] -- 0:00:08 872500 -- (-1235.737) [-1237.459] (-1237.318) (-1234.642) * (-1234.662) (-1240.144) (-1235.878) [-1236.691] -- 0:00:08 873000 -- (-1241.927) [-1234.887] (-1236.521) (-1233.829) * [-1233.623] (-1234.554) (-1240.355) (-1235.651) -- 0:00:08 873500 -- (-1236.054) (-1235.571) (-1237.067) [-1235.263] * [-1235.270] (-1236.967) (-1239.890) (-1236.739) -- 0:00:08 874000 -- (-1244.596) [-1234.841] (-1233.953) (-1236.538) * [-1235.735] (-1239.784) (-1236.752) (-1235.986) -- 0:00:08 874500 -- (-1235.586) (-1236.082) [-1234.506] (-1237.194) * [-1236.031] (-1238.924) (-1235.725) (-1235.729) -- 0:00:08 875000 -- (-1236.803) [-1234.563] (-1234.653) (-1238.856) * (-1237.154) (-1234.458) (-1236.944) [-1235.562] -- 0:00:08 Average standard deviation of split frequencies: 0.006323 875500 -- [-1234.131] (-1236.950) (-1235.170) (-1242.031) * (-1235.624) (-1239.395) [-1234.748] (-1238.051) -- 0:00:08 876000 -- (-1235.618) (-1235.161) [-1236.418] (-1238.155) * (-1238.756) (-1236.054) [-1236.921] (-1235.070) -- 0:00:08 876500 -- (-1236.887) (-1237.361) (-1234.386) [-1237.392] * [-1237.754] (-1238.581) (-1235.717) (-1237.732) -- 0:00:08 877000 -- (-1235.034) [-1235.858] (-1238.783) (-1239.856) * (-1235.578) (-1241.653) [-1236.035] (-1237.283) -- 0:00:08 877500 -- (-1238.405) (-1237.509) (-1235.546) [-1232.890] * (-1237.177) [-1235.521] (-1233.411) (-1241.258) -- 0:00:08 878000 -- [-1236.096] (-1235.841) (-1236.708) (-1234.707) * (-1237.389) (-1235.533) (-1237.214) [-1236.166] -- 0:00:08 878500 -- (-1237.475) [-1237.045] (-1236.664) (-1235.036) * (-1234.996) (-1240.153) [-1237.747] (-1236.166) -- 0:00:08 879000 -- (-1241.261) [-1235.404] (-1236.114) (-1238.063) * (-1235.106) (-1240.504) [-1234.181] (-1240.623) -- 0:00:08 879500 -- (-1240.524) [-1233.094] (-1239.056) (-1239.799) * [-1234.912] (-1235.909) (-1244.434) (-1239.653) -- 0:00:08 880000 -- [-1235.623] (-1235.457) (-1236.406) (-1234.675) * (-1234.014) [-1235.875] (-1239.135) (-1233.723) -- 0:00:08 Average standard deviation of split frequencies: 0.006281 880500 -- (-1238.345) (-1236.878) (-1236.463) [-1236.085] * [-1236.021] (-1234.020) (-1235.710) (-1236.882) -- 0:00:08 881000 -- (-1235.374) (-1234.813) [-1233.524] (-1240.194) * (-1236.145) (-1234.073) (-1239.450) [-1234.586] -- 0:00:07 881500 -- (-1236.361) (-1234.601) [-1237.989] (-1238.334) * [-1235.037] (-1237.098) (-1235.264) (-1236.116) -- 0:00:07 882000 -- (-1233.943) (-1236.870) (-1239.016) [-1234.713] * (-1236.819) [-1234.858] (-1235.661) (-1236.536) -- 0:00:08 882500 -- (-1236.233) (-1236.152) [-1237.800] (-1235.308) * (-1237.114) (-1236.351) (-1236.159) [-1233.247] -- 0:00:07 883000 -- (-1240.711) (-1234.351) (-1242.283) [-1234.964] * [-1233.606] (-1236.607) (-1237.539) (-1235.623) -- 0:00:07 883500 -- (-1240.564) (-1232.659) [-1242.659] (-1232.796) * (-1236.128) (-1235.013) [-1235.252] (-1234.749) -- 0:00:07 884000 -- (-1234.647) (-1234.371) (-1233.509) [-1234.091] * [-1235.280] (-1233.195) (-1233.508) (-1243.477) -- 0:00:07 884500 -- (-1234.370) (-1236.922) [-1233.721] (-1234.677) * (-1241.694) [-1236.312] (-1233.819) (-1234.513) -- 0:00:07 885000 -- [-1234.482] (-1235.722) (-1235.391) (-1237.551) * (-1238.504) (-1234.560) [-1235.573] (-1235.545) -- 0:00:07 Average standard deviation of split frequencies: 0.006030 885500 -- (-1235.233) (-1235.459) (-1233.861) [-1236.820] * (-1240.579) (-1234.625) [-1234.867] (-1238.747) -- 0:00:07 886000 -- (-1239.469) (-1234.285) (-1235.636) [-1235.391] * [-1237.828] (-1235.733) (-1234.151) (-1240.924) -- 0:00:07 886500 -- (-1236.454) [-1234.436] (-1235.215) (-1238.301) * [-1234.794] (-1233.157) (-1238.999) (-1236.522) -- 0:00:07 887000 -- [-1233.288] (-1233.870) (-1233.562) (-1236.036) * (-1235.992) (-1235.765) (-1235.262) [-1236.343] -- 0:00:07 887500 -- [-1235.096] (-1232.769) (-1235.183) (-1235.683) * [-1235.827] (-1234.738) (-1235.793) (-1235.546) -- 0:00:07 888000 -- (-1234.841) (-1237.336) (-1233.960) [-1235.247] * (-1236.819) (-1236.135) (-1237.121) [-1237.674] -- 0:00:07 888500 -- (-1235.598) [-1235.178] (-1236.753) (-1236.261) * (-1239.242) (-1235.222) [-1234.924] (-1235.548) -- 0:00:07 889000 -- (-1238.023) (-1235.202) [-1233.271] (-1235.018) * (-1235.674) (-1236.444) (-1233.631) [-1235.161] -- 0:00:07 889500 -- (-1235.173) (-1237.215) (-1235.674) [-1237.018] * (-1233.908) [-1235.066] (-1237.137) (-1236.907) -- 0:00:07 890000 -- (-1234.504) (-1239.283) [-1235.454] (-1237.287) * [-1233.684] (-1237.567) (-1235.572) (-1234.120) -- 0:00:07 Average standard deviation of split frequencies: 0.005822 890500 -- (-1236.839) (-1236.784) [-1237.098] (-1235.620) * (-1236.284) [-1236.330] (-1236.433) (-1234.846) -- 0:00:07 891000 -- [-1236.593] (-1235.559) (-1234.587) (-1239.657) * (-1236.504) (-1232.115) (-1235.818) [-1234.442] -- 0:00:07 891500 -- (-1235.357) [-1236.067] (-1235.973) (-1237.237) * (-1235.584) (-1233.503) [-1236.642] (-1234.508) -- 0:00:07 892000 -- (-1237.823) (-1236.214) (-1235.118) [-1242.502] * (-1236.933) (-1233.956) [-1234.999] (-1235.183) -- 0:00:07 892500 -- (-1237.428) (-1234.087) (-1234.956) [-1236.028] * (-1233.214) (-1237.787) [-1232.920] (-1235.753) -- 0:00:07 893000 -- (-1235.101) (-1234.487) (-1236.333) [-1234.818] * (-1237.468) [-1232.320] (-1235.677) (-1234.676) -- 0:00:07 893500 -- [-1236.600] (-1235.712) (-1233.465) (-1241.563) * (-1234.117) [-1234.998] (-1236.172) (-1235.845) -- 0:00:07 894000 -- (-1236.690) (-1234.932) (-1237.850) [-1234.411] * (-1236.816) (-1234.993) [-1235.541] (-1237.511) -- 0:00:07 894500 -- (-1237.359) (-1233.349) [-1235.304] (-1236.744) * [-1237.568] (-1236.363) (-1234.861) (-1242.666) -- 0:00:07 895000 -- (-1238.808) [-1235.949] (-1237.469) (-1235.332) * (-1241.974) (-1235.717) [-1234.761] (-1235.345) -- 0:00:07 Average standard deviation of split frequencies: 0.005752 895500 -- [-1234.956] (-1233.587) (-1236.762) (-1236.533) * (-1238.551) (-1234.946) (-1237.006) [-1236.824] -- 0:00:07 896000 -- (-1235.575) (-1235.789) (-1242.470) [-1235.694] * (-1237.791) (-1236.505) [-1236.969] (-1237.134) -- 0:00:06 896500 -- (-1234.524) (-1235.995) (-1233.583) [-1239.068] * (-1237.000) (-1241.645) [-1238.190] (-1237.973) -- 0:00:06 897000 -- (-1235.898) [-1233.534] (-1235.418) (-1235.589) * [-1236.928] (-1233.835) (-1238.376) (-1234.184) -- 0:00:07 897500 -- (-1234.795) (-1233.330) [-1234.614] (-1237.112) * (-1235.144) (-1235.136) [-1234.318] (-1235.294) -- 0:00:06 898000 -- [-1232.923] (-1234.527) (-1236.145) (-1235.256) * (-1238.017) (-1236.321) [-1234.315] (-1235.772) -- 0:00:06 898500 -- (-1237.923) (-1235.949) (-1238.977) [-1234.631] * (-1234.379) (-1234.752) (-1236.722) [-1234.595] -- 0:00:06 899000 -- (-1235.108) (-1236.566) (-1236.919) [-1234.602] * [-1239.649] (-1233.156) (-1240.379) (-1233.420) -- 0:00:06 899500 -- (-1235.504) (-1234.637) [-1233.791] (-1235.057) * (-1238.466) (-1236.263) [-1236.069] (-1234.755) -- 0:00:06 900000 -- (-1236.108) (-1235.241) [-1234.110] (-1236.346) * (-1237.024) (-1238.702) [-1236.627] (-1235.426) -- 0:00:06 Average standard deviation of split frequencies: 0.005618 900500 -- (-1236.670) [-1235.283] (-1233.749) (-1234.687) * (-1234.825) (-1235.496) [-1235.706] (-1234.647) -- 0:00:06 901000 -- (-1236.188) (-1234.591) [-1242.236] (-1235.379) * (-1236.324) [-1237.152] (-1237.288) (-1236.012) -- 0:00:06 901500 -- (-1234.573) (-1241.262) [-1236.540] (-1238.824) * [-1237.078] (-1236.824) (-1238.187) (-1236.990) -- 0:00:06 902000 -- (-1236.430) [-1235.844] (-1235.612) (-1237.625) * [-1236.006] (-1236.931) (-1241.617) (-1237.237) -- 0:00:06 902500 -- (-1235.477) [-1237.227] (-1235.367) (-1237.814) * (-1233.964) [-1235.055] (-1240.509) (-1235.025) -- 0:00:06 903000 -- (-1236.771) (-1235.374) [-1235.086] (-1238.686) * [-1232.900] (-1237.045) (-1238.957) (-1238.872) -- 0:00:06 903500 -- (-1234.028) [-1234.541] (-1233.844) (-1237.729) * [-1235.559] (-1237.374) (-1239.992) (-1234.675) -- 0:00:06 904000 -- (-1234.155) [-1237.062] (-1233.711) (-1235.824) * (-1237.627) (-1238.282) [-1235.871] (-1235.350) -- 0:00:06 904500 -- (-1235.467) (-1237.070) (-1234.737) [-1237.087] * (-1234.791) [-1235.906] (-1235.108) (-1236.245) -- 0:00:06 905000 -- [-1235.080] (-1240.783) (-1236.908) (-1233.000) * (-1235.008) (-1234.187) [-1235.721] (-1237.827) -- 0:00:06 Average standard deviation of split frequencies: 0.005550 905500 -- [-1234.875] (-1237.366) (-1232.980) (-1235.272) * (-1234.129) (-1236.008) (-1242.537) [-1236.410] -- 0:00:06 906000 -- [-1235.727] (-1234.580) (-1236.731) (-1238.206) * (-1235.001) (-1236.547) (-1238.883) [-1235.518] -- 0:00:06 906500 -- (-1236.452) [-1235.507] (-1238.067) (-1235.959) * [-1236.510] (-1235.167) (-1238.213) (-1236.598) -- 0:00:06 907000 -- (-1235.974) (-1237.368) (-1236.710) [-1236.385] * (-1239.273) [-1236.457] (-1237.312) (-1234.395) -- 0:00:06 907500 -- (-1236.408) (-1234.409) (-1235.856) [-1233.331] * (-1234.859) (-1241.062) [-1234.239] (-1234.343) -- 0:00:06 908000 -- (-1235.365) (-1234.978) (-1237.349) [-1234.771] * [-1235.260] (-1233.938) (-1235.193) (-1234.195) -- 0:00:06 908500 -- (-1235.467) (-1238.034) (-1238.213) [-1234.768] * [-1234.545] (-1235.446) (-1235.109) (-1237.381) -- 0:00:06 909000 -- (-1235.646) [-1235.359] (-1239.157) (-1235.269) * (-1241.341) [-1234.164] (-1236.846) (-1235.838) -- 0:00:06 909500 -- (-1235.665) (-1233.843) (-1237.930) [-1235.305] * (-1236.986) [-1233.718] (-1237.026) (-1234.253) -- 0:00:06 910000 -- (-1237.934) (-1236.529) [-1235.650] (-1236.206) * (-1240.081) (-1234.297) [-1234.150] (-1233.068) -- 0:00:06 Average standard deviation of split frequencies: 0.005867 910500 -- (-1237.354) (-1234.808) [-1234.318] (-1234.209) * [-1234.865] (-1237.485) (-1236.189) (-1237.165) -- 0:00:05 911000 -- (-1234.980) (-1235.188) (-1235.609) [-1236.114] * (-1236.066) (-1239.864) [-1235.107] (-1236.104) -- 0:00:05 911500 -- (-1235.276) (-1236.763) (-1234.975) [-1239.805] * [-1236.560] (-1238.065) (-1236.912) (-1236.620) -- 0:00:06 912000 -- [-1237.047] (-1235.839) (-1235.815) (-1237.142) * (-1235.416) [-1237.283] (-1235.804) (-1233.670) -- 0:00:05 912500 -- (-1235.236) (-1235.409) [-1234.670] (-1235.476) * (-1234.959) (-1236.901) (-1235.993) [-1236.383] -- 0:00:05 913000 -- (-1240.213) (-1233.779) [-1236.382] (-1235.443) * (-1236.198) [-1235.907] (-1235.112) (-1235.419) -- 0:00:05 913500 -- (-1235.715) (-1238.292) (-1237.726) [-1235.005] * (-1234.811) (-1235.172) [-1234.714] (-1233.905) -- 0:00:05 914000 -- (-1237.228) [-1237.910] (-1239.767) (-1236.681) * [-1234.293] (-1235.198) (-1236.149) (-1238.226) -- 0:00:05 914500 -- (-1235.275) [-1234.382] (-1235.680) (-1236.248) * (-1235.906) [-1234.729] (-1234.898) (-1235.470) -- 0:00:05 915000 -- [-1235.114] (-1238.240) (-1237.733) (-1235.844) * (-1238.051) [-1235.568] (-1240.250) (-1235.424) -- 0:00:05 Average standard deviation of split frequencies: 0.005627 915500 -- [-1233.701] (-1235.095) (-1237.064) (-1240.047) * [-1238.953] (-1234.803) (-1240.177) (-1236.949) -- 0:00:05 916000 -- (-1238.383) (-1234.849) (-1235.333) [-1234.812] * [-1236.079] (-1238.206) (-1234.546) (-1238.693) -- 0:00:05 916500 -- (-1239.913) [-1233.873] (-1237.421) (-1235.145) * (-1236.394) (-1235.717) (-1236.061) [-1238.371] -- 0:00:05 917000 -- (-1236.508) [-1233.536] (-1234.870) (-1235.558) * (-1236.926) [-1237.882] (-1236.577) (-1238.200) -- 0:00:05 917500 -- [-1236.548] (-1239.302) (-1234.940) (-1234.791) * [-1234.185] (-1238.359) (-1243.518) (-1236.217) -- 0:00:05 918000 -- (-1237.699) (-1240.117) (-1234.805) [-1234.872] * (-1237.158) [-1236.911] (-1237.068) (-1236.504) -- 0:00:05 918500 -- (-1237.606) (-1238.305) [-1239.656] (-1235.225) * (-1235.984) (-1235.040) (-1237.652) [-1236.533] -- 0:00:05 919000 -- (-1237.994) (-1236.205) (-1238.653) [-1235.779] * (-1235.973) [-1237.451] (-1241.717) (-1244.940) -- 0:00:05 919500 -- (-1238.630) [-1235.419] (-1236.539) (-1236.239) * (-1238.703) [-1238.383] (-1233.399) (-1238.314) -- 0:00:05 920000 -- [-1238.517] (-1237.077) (-1233.650) (-1236.203) * [-1237.186] (-1236.462) (-1234.577) (-1234.513) -- 0:00:05 Average standard deviation of split frequencies: 0.005359 920500 -- (-1234.686) (-1236.470) [-1236.272] (-1235.702) * (-1238.327) (-1236.865) [-1236.491] (-1234.868) -- 0:00:05 921000 -- (-1236.347) (-1234.956) [-1234.603] (-1236.243) * (-1242.714) [-1235.237] (-1235.994) (-1234.130) -- 0:00:05 921500 -- (-1235.526) (-1233.300) [-1235.342] (-1234.931) * (-1234.424) (-1236.714) [-1236.051] (-1234.207) -- 0:00:05 922000 -- [-1236.631] (-1234.891) (-1234.981) (-1241.726) * (-1235.479) [-1236.147] (-1235.950) (-1235.486) -- 0:00:05 922500 -- (-1238.089) (-1234.277) (-1236.937) [-1234.064] * [-1234.698] (-1234.973) (-1236.020) (-1233.363) -- 0:00:05 923000 -- (-1238.619) (-1236.720) [-1238.341] (-1233.815) * (-1235.590) (-1234.074) (-1235.887) [-1232.872] -- 0:00:05 923500 -- (-1234.266) [-1235.634] (-1239.606) (-1237.616) * [-1237.956] (-1234.754) (-1236.315) (-1234.175) -- 0:00:05 924000 -- (-1235.995) [-1236.108] (-1241.008) (-1238.273) * (-1235.004) [-1235.072] (-1235.685) (-1234.961) -- 0:00:05 924500 -- [-1235.762] (-1235.048) (-1238.791) (-1235.007) * (-1240.851) [-1236.381] (-1237.583) (-1237.758) -- 0:00:05 925000 -- (-1240.143) (-1233.823) [-1237.237] (-1235.733) * (-1237.301) (-1239.038) (-1238.710) [-1235.370] -- 0:00:05 Average standard deviation of split frequencies: 0.005159 925500 -- (-1237.012) (-1234.862) (-1240.376) [-1236.402] * [-1237.406] (-1237.697) (-1239.911) (-1237.726) -- 0:00:04 926000 -- (-1236.497) [-1236.849] (-1236.935) (-1233.423) * (-1235.695) [-1237.874] (-1239.108) (-1237.305) -- 0:00:04 926500 -- (-1235.645) [-1235.487] (-1238.483) (-1236.264) * (-1239.341) (-1236.778) (-1239.830) [-1234.789] -- 0:00:04 927000 -- (-1236.289) [-1236.619] (-1236.376) (-1234.388) * (-1235.717) (-1235.348) [-1237.549] (-1235.620) -- 0:00:04 927500 -- (-1239.644) (-1234.833) (-1236.432) [-1234.443] * [-1238.563] (-1235.069) (-1235.915) (-1235.493) -- 0:00:04 928000 -- (-1238.127) [-1234.428] (-1234.992) (-1235.889) * (-1233.862) (-1238.516) [-1236.653] (-1234.097) -- 0:00:04 928500 -- (-1238.050) (-1235.248) [-1240.003] (-1233.973) * [-1235.438] (-1235.236) (-1232.497) (-1236.088) -- 0:00:04 929000 -- [-1237.154] (-1240.716) (-1235.718) (-1235.306) * (-1234.070) (-1234.564) (-1233.775) [-1234.478] -- 0:00:04 929500 -- (-1240.462) [-1242.108] (-1235.941) (-1237.438) * (-1235.141) [-1235.219] (-1235.071) (-1237.547) -- 0:00:04 930000 -- (-1240.002) (-1237.565) (-1236.378) [-1237.429] * (-1236.537) [-1234.742] (-1235.230) (-1236.619) -- 0:00:04 Average standard deviation of split frequencies: 0.005234 930500 -- (-1242.621) (-1234.031) [-1235.391] (-1235.154) * (-1236.824) (-1233.715) (-1236.175) [-1236.501] -- 0:00:04 931000 -- [-1237.199] (-1235.907) (-1234.436) (-1235.231) * [-1235.608] (-1236.267) (-1234.370) (-1238.061) -- 0:00:04 931500 -- [-1235.533] (-1237.511) (-1235.456) (-1237.781) * (-1234.948) (-1237.334) [-1234.932] (-1235.551) -- 0:00:04 932000 -- (-1236.497) (-1235.457) [-1236.333] (-1234.880) * (-1235.078) (-1246.048) (-1235.451) [-1232.921] -- 0:00:04 932500 -- (-1235.444) (-1234.465) [-1234.782] (-1234.096) * (-1239.016) (-1244.183) [-1236.916] (-1234.305) -- 0:00:04 933000 -- (-1235.285) (-1234.874) (-1238.847) [-1234.134] * (-1239.826) (-1233.641) [-1233.571] (-1236.776) -- 0:00:04 933500 -- (-1235.713) [-1237.411] (-1237.634) (-1232.526) * (-1237.267) (-1233.417) (-1237.753) [-1233.655] -- 0:00:04 934000 -- (-1238.648) (-1236.192) [-1237.977] (-1233.471) * [-1237.930] (-1236.005) (-1239.523) (-1235.148) -- 0:00:04 934500 -- (-1236.435) (-1235.244) [-1234.830] (-1234.815) * (-1236.091) [-1234.410] (-1236.374) (-1241.108) -- 0:00:04 935000 -- (-1236.212) (-1236.313) [-1237.739] (-1238.952) * (-1236.205) (-1234.527) (-1234.432) [-1236.178] -- 0:00:04 Average standard deviation of split frequencies: 0.005204 935500 -- (-1235.361) [-1236.134] (-1236.824) (-1232.838) * (-1235.060) (-1234.980) (-1237.078) [-1237.118] -- 0:00:04 936000 -- (-1233.226) [-1235.717] (-1239.312) (-1233.635) * (-1236.786) [-1235.043] (-1237.929) (-1238.260) -- 0:00:04 936500 -- [-1234.483] (-1235.579) (-1237.904) (-1237.807) * [-1235.980] (-1237.001) (-1235.994) (-1239.119) -- 0:00:04 937000 -- (-1239.785) (-1236.460) (-1233.936) [-1234.087] * [-1236.702] (-1232.956) (-1238.353) (-1237.374) -- 0:00:04 937500 -- (-1236.785) [-1237.479] (-1236.820) (-1235.961) * (-1235.226) [-1235.316] (-1235.569) (-1237.744) -- 0:00:04 938000 -- (-1235.441) [-1236.348] (-1237.808) (-1235.709) * (-1235.996) (-1238.588) (-1235.301) [-1237.177] -- 0:00:04 938500 -- (-1237.935) (-1234.813) (-1234.835) [-1235.224] * (-1235.944) [-1238.038] (-1236.206) (-1236.364) -- 0:00:04 939000 -- (-1238.532) [-1234.315] (-1239.673) (-1235.750) * [-1238.732] (-1234.903) (-1232.654) (-1236.757) -- 0:00:04 939500 -- (-1232.811) (-1236.253) (-1236.258) [-1235.439] * (-1236.276) [-1236.040] (-1234.989) (-1238.091) -- 0:00:04 940000 -- [-1235.454] (-1236.941) (-1235.280) (-1235.362) * (-1235.827) (-1235.683) (-1240.225) [-1236.701] -- 0:00:04 Average standard deviation of split frequencies: 0.005479 940500 -- (-1236.401) (-1234.788) [-1234.749] (-1235.789) * (-1236.668) (-1235.171) [-1235.890] (-1235.338) -- 0:00:03 941000 -- (-1234.845) [-1235.680] (-1238.671) (-1235.342) * [-1234.619] (-1236.385) (-1238.650) (-1234.475) -- 0:00:03 941500 -- (-1232.475) (-1235.116) [-1235.537] (-1233.720) * [-1234.000] (-1235.289) (-1239.894) (-1240.869) -- 0:00:03 942000 -- (-1237.474) (-1237.206) (-1238.092) [-1234.744] * (-1233.831) (-1233.652) [-1234.997] (-1236.534) -- 0:00:03 942500 -- (-1236.173) [-1238.105] (-1238.656) (-1235.131) * [-1235.706] (-1236.327) (-1234.939) (-1236.053) -- 0:00:03 943000 -- [-1235.621] (-1236.570) (-1237.753) (-1236.232) * (-1233.983) (-1238.782) (-1239.309) [-1235.093] -- 0:00:03 943500 -- [-1235.606] (-1238.468) (-1236.832) (-1236.946) * [-1235.736] (-1238.285) (-1234.975) (-1237.336) -- 0:00:03 944000 -- [-1237.018] (-1235.741) (-1234.770) (-1236.808) * (-1236.766) (-1237.767) (-1236.724) [-1235.867] -- 0:00:03 944500 -- (-1241.648) [-1236.350] (-1239.687) (-1234.912) * (-1234.613) (-1234.905) [-1234.295] (-1236.875) -- 0:00:03 945000 -- [-1238.457] (-1234.836) (-1238.591) (-1239.300) * [-1234.600] (-1233.639) (-1235.773) (-1235.335) -- 0:00:03 Average standard deviation of split frequencies: 0.005315 945500 -- (-1238.441) (-1234.145) (-1233.824) [-1234.941] * (-1234.704) (-1238.096) [-1238.327] (-1238.068) -- 0:00:03 946000 -- (-1237.206) (-1233.926) (-1236.301) [-1234.210] * (-1233.981) [-1235.148] (-1235.579) (-1237.868) -- 0:00:03 946500 -- (-1235.370) (-1234.952) (-1239.329) [-1233.072] * [-1235.788] (-1236.447) (-1235.811) (-1237.577) -- 0:00:03 947000 -- (-1233.577) (-1234.946) [-1236.139] (-1232.933) * (-1235.303) [-1235.753] (-1238.247) (-1237.880) -- 0:00:03 947500 -- (-1233.639) [-1234.168] (-1234.746) (-1235.729) * (-1234.914) (-1235.699) (-1235.448) [-1240.354] -- 0:00:03 948000 -- [-1236.835] (-1235.161) (-1233.975) (-1235.441) * (-1234.449) (-1240.423) [-1234.896] (-1237.794) -- 0:00:03 948500 -- (-1235.704) [-1234.026] (-1234.137) (-1238.070) * [-1239.380] (-1237.264) (-1235.566) (-1234.453) -- 0:00:03 949000 -- [-1234.691] (-1237.106) (-1237.208) (-1235.361) * (-1238.298) [-1236.720] (-1241.158) (-1236.216) -- 0:00:03 949500 -- (-1234.242) [-1235.678] (-1234.353) (-1235.810) * (-1234.960) [-1236.165] (-1237.679) (-1235.272) -- 0:00:03 950000 -- (-1240.862) [-1233.380] (-1234.272) (-1234.434) * (-1233.809) (-1239.186) (-1234.746) [-1234.185] -- 0:00:03 Average standard deviation of split frequencies: 0.005124 950500 -- (-1235.818) [-1233.556] (-1233.051) (-1236.049) * (-1235.074) (-1235.418) [-1233.135] (-1239.362) -- 0:00:03 951000 -- (-1234.411) [-1234.477] (-1233.165) (-1238.392) * [-1235.213] (-1234.899) (-1234.948) (-1234.477) -- 0:00:03 951500 -- (-1236.312) [-1235.648] (-1234.292) (-1237.580) * (-1237.573) (-1235.560) [-1234.795] (-1236.023) -- 0:00:03 952000 -- (-1233.740) [-1235.555] (-1235.537) (-1235.666) * (-1236.064) (-1233.933) (-1237.574) [-1234.829] -- 0:00:03 952500 -- (-1235.615) (-1234.780) [-1234.965] (-1235.329) * (-1236.304) (-1235.915) (-1235.463) [-1234.743] -- 0:00:03 953000 -- (-1236.784) [-1234.718] (-1234.724) (-1235.530) * (-1235.919) (-1236.468) (-1236.092) [-1234.967] -- 0:00:03 953500 -- [-1236.353] (-1235.182) (-1235.581) (-1238.275) * (-1235.948) [-1236.519] (-1240.894) (-1237.720) -- 0:00:03 954000 -- [-1234.039] (-1238.168) (-1234.049) (-1235.405) * [-1233.583] (-1238.576) (-1237.631) (-1236.384) -- 0:00:03 954500 -- (-1233.629) (-1236.816) (-1239.295) [-1235.276] * (-1235.235) (-1235.873) [-1235.340] (-1237.578) -- 0:00:03 955000 -- (-1235.078) (-1238.062) (-1238.116) [-1238.384] * (-1234.916) (-1237.412) [-1234.999] (-1235.628) -- 0:00:03 Average standard deviation of split frequencies: 0.005128 955500 -- [-1234.554] (-1236.138) (-1237.376) (-1236.043) * [-1234.149] (-1234.733) (-1241.509) (-1233.744) -- 0:00:02 956000 -- (-1236.382) (-1235.698) [-1236.046] (-1238.359) * [-1233.908] (-1239.354) (-1239.885) (-1236.016) -- 0:00:02 956500 -- (-1234.806) (-1236.102) [-1233.922] (-1235.310) * (-1234.718) (-1236.472) (-1235.294) [-1240.024] -- 0:00:02 957000 -- [-1234.129] (-1237.202) (-1234.704) (-1234.926) * [-1234.752] (-1237.759) (-1236.385) (-1237.789) -- 0:00:02 957500 -- (-1236.786) (-1235.588) (-1233.856) [-1235.129] * (-1234.290) [-1235.162] (-1233.920) (-1234.411) -- 0:00:02 958000 -- (-1237.072) (-1236.754) (-1237.122) [-1235.047] * (-1235.294) (-1240.281) (-1235.025) [-1235.093] -- 0:00:02 958500 -- (-1236.544) (-1240.221) (-1240.061) [-1234.556] * [-1234.296] (-1235.791) (-1234.886) (-1235.522) -- 0:00:02 959000 -- (-1235.005) (-1235.630) (-1237.758) [-1234.257] * (-1238.123) (-1235.590) (-1235.815) [-1241.881] -- 0:00:02 959500 -- (-1236.162) [-1235.460] (-1235.518) (-1235.708) * (-1236.182) (-1237.186) [-1235.670] (-1235.414) -- 0:00:02 960000 -- [-1232.653] (-1235.199) (-1236.064) (-1234.815) * (-1238.455) (-1233.890) (-1238.396) [-1235.176] -- 0:00:02 Average standard deviation of split frequencies: 0.005758 960500 -- [-1232.945] (-1236.462) (-1236.122) (-1237.054) * (-1234.426) (-1235.956) [-1236.926] (-1242.626) -- 0:00:02 961000 -- [-1235.012] (-1241.196) (-1236.567) (-1237.002) * (-1236.103) (-1234.421) [-1234.522] (-1237.278) -- 0:00:02 961500 -- (-1234.282) (-1240.013) (-1238.278) [-1235.051] * (-1237.333) (-1234.448) [-1236.820] (-1235.365) -- 0:00:02 962000 -- (-1236.964) (-1233.662) (-1234.608) [-1235.735] * [-1235.183] (-1236.158) (-1236.119) (-1235.377) -- 0:00:02 962500 -- [-1234.868] (-1238.184) (-1232.973) (-1236.560) * (-1235.939) (-1238.688) [-1236.854] (-1235.439) -- 0:00:02 963000 -- [-1235.399] (-1236.526) (-1237.055) (-1233.647) * (-1234.992) (-1239.110) [-1234.365] (-1235.423) -- 0:00:02 963500 -- (-1236.910) (-1238.849) (-1235.690) [-1237.245] * (-1234.810) [-1235.567] (-1234.890) (-1234.515) -- 0:00:02 964000 -- (-1235.142) [-1234.517] (-1234.866) (-1235.108) * (-1235.459) (-1234.640) [-1237.109] (-1240.133) -- 0:00:02 964500 -- (-1236.900) (-1233.576) (-1237.356) [-1233.373] * [-1234.070] (-1235.097) (-1235.716) (-1236.083) -- 0:00:02 965000 -- [-1236.182] (-1236.177) (-1234.303) (-1237.206) * (-1235.314) (-1236.321) (-1235.991) [-1233.880] -- 0:00:02 Average standard deviation of split frequencies: 0.005986 965500 -- [-1234.736] (-1235.839) (-1236.253) (-1235.142) * (-1235.782) (-1237.184) (-1233.177) [-1235.544] -- 0:00:02 966000 -- (-1233.612) [-1241.424] (-1235.345) (-1234.991) * (-1237.999) [-1237.484] (-1236.766) (-1236.807) -- 0:00:02 966500 -- [-1237.669] (-1236.372) (-1239.888) (-1237.471) * (-1238.096) (-1236.099) [-1236.315] (-1236.337) -- 0:00:02 967000 -- [-1235.229] (-1233.694) (-1241.012) (-1236.358) * (-1237.060) [-1235.982] (-1236.336) (-1235.629) -- 0:00:02 967500 -- [-1234.790] (-1233.510) (-1238.107) (-1235.830) * (-1239.294) (-1240.510) [-1235.374] (-1233.114) -- 0:00:02 968000 -- (-1235.494) (-1237.345) [-1233.747] (-1239.227) * (-1235.078) (-1239.589) [-1235.884] (-1235.151) -- 0:00:02 968500 -- (-1235.660) [-1234.471] (-1234.914) (-1236.720) * (-1238.734) (-1234.450) (-1233.977) [-1233.984] -- 0:00:02 969000 -- [-1235.444] (-1236.937) (-1237.693) (-1235.404) * (-1236.845) (-1234.189) [-1236.057] (-1236.663) -- 0:00:02 969500 -- [-1234.928] (-1234.378) (-1237.653) (-1237.745) * (-1237.419) (-1234.808) [-1234.440] (-1234.974) -- 0:00:02 970000 -- [-1235.091] (-1235.853) (-1234.777) (-1237.108) * (-1235.099) (-1237.214) [-1234.645] (-1234.711) -- 0:00:02 Average standard deviation of split frequencies: 0.006344 970500 -- (-1235.872) (-1241.922) [-1233.819] (-1235.727) * [-1235.524] (-1233.895) (-1236.572) (-1234.188) -- 0:00:01 971000 -- [-1235.629] (-1240.001) (-1236.197) (-1235.412) * (-1234.381) (-1236.302) (-1238.565) [-1234.647] -- 0:00:01 971500 -- (-1236.260) (-1234.628) [-1236.371] (-1238.747) * (-1236.860) [-1235.609] (-1237.277) (-1234.322) -- 0:00:01 972000 -- (-1238.067) (-1235.832) (-1235.892) [-1239.253] * (-1234.194) [-1235.035] (-1237.106) (-1237.684) -- 0:00:01 972500 -- (-1234.997) (-1237.633) [-1233.299] (-1234.369) * [-1235.259] (-1237.434) (-1238.424) (-1236.425) -- 0:00:01 973000 -- (-1234.949) [-1234.651] (-1234.538) (-1233.285) * (-1235.992) (-1236.312) [-1239.334] (-1235.855) -- 0:00:01 973500 -- [-1236.783] (-1235.718) (-1239.377) (-1237.586) * (-1234.535) (-1234.877) [-1237.529] (-1236.321) -- 0:00:01 974000 -- (-1233.933) (-1237.445) [-1239.292] (-1236.629) * [-1234.274] (-1237.907) (-1232.238) (-1235.982) -- 0:00:01 974500 -- (-1235.463) (-1235.100) (-1238.893) [-1236.931] * (-1237.613) (-1236.992) (-1235.806) [-1234.428] -- 0:00:01 975000 -- (-1235.870) (-1236.362) [-1235.987] (-1235.044) * (-1240.657) (-1236.713) [-1235.596] (-1234.902) -- 0:00:01 Average standard deviation of split frequencies: 0.006641 975500 -- (-1235.000) (-1235.278) (-1243.084) [-1234.948] * (-1236.810) [-1235.162] (-1235.732) (-1236.303) -- 0:00:01 976000 -- (-1235.825) (-1235.432) (-1237.015) [-1236.828] * (-1236.113) (-1235.399) (-1235.971) [-1237.314] -- 0:00:01 976500 -- [-1238.228] (-1236.202) (-1239.119) (-1234.858) * (-1241.606) [-1234.123] (-1237.233) (-1236.427) -- 0:00:01 977000 -- (-1235.343) (-1237.351) [-1238.179] (-1234.252) * (-1235.129) (-1238.396) [-1234.804] (-1239.847) -- 0:00:01 977500 -- (-1236.897) [-1234.398] (-1237.817) (-1235.264) * [-1235.567] (-1236.531) (-1236.759) (-1237.612) -- 0:00:01 978000 -- [-1234.302] (-1237.191) (-1233.563) (-1235.797) * (-1240.351) (-1234.582) [-1236.244] (-1235.062) -- 0:00:01 978500 -- [-1235.549] (-1239.386) (-1234.092) (-1238.905) * (-1236.156) [-1233.944] (-1235.819) (-1235.444) -- 0:00:01 979000 -- (-1235.284) (-1236.294) [-1233.873] (-1237.388) * (-1236.043) (-1234.413) [-1235.740] (-1236.863) -- 0:00:01 979500 -- [-1237.270] (-1234.015) (-1237.852) (-1240.342) * (-1237.480) (-1236.379) (-1237.903) [-1238.472] -- 0:00:01 980000 -- (-1234.795) (-1235.580) (-1236.085) [-1237.285] * [-1235.366] (-1235.770) (-1236.762) (-1239.118) -- 0:00:01 Average standard deviation of split frequencies: 0.006249 980500 -- (-1234.272) (-1234.941) (-1236.328) [-1237.425] * [-1235.810] (-1240.154) (-1237.123) (-1238.813) -- 0:00:01 981000 -- (-1238.733) (-1236.844) (-1234.784) [-1233.091] * [-1236.501] (-1242.359) (-1235.499) (-1237.550) -- 0:00:01 981500 -- (-1238.704) [-1238.302] (-1233.293) (-1236.963) * (-1234.783) (-1237.933) (-1235.029) [-1235.365] -- 0:00:01 982000 -- (-1239.257) [-1235.026] (-1234.490) (-1234.004) * (-1234.629) (-1234.912) (-1237.433) [-1235.314] -- 0:00:01 982500 -- [-1235.047] (-1235.202) (-1235.597) (-1236.724) * (-1234.183) [-1237.304] (-1235.940) (-1234.601) -- 0:00:01 983000 -- [-1236.890] (-1235.007) (-1235.258) (-1234.689) * [-1236.330] (-1237.240) (-1235.467) (-1237.946) -- 0:00:01 983500 -- [-1234.068] (-1238.336) (-1236.267) (-1236.043) * (-1235.402) (-1239.851) (-1239.172) [-1232.572] -- 0:00:01 984000 -- (-1236.564) [-1237.246] (-1237.647) (-1242.994) * [-1233.500] (-1239.223) (-1238.322) (-1238.300) -- 0:00:01 984500 -- (-1237.430) [-1237.271] (-1236.742) (-1237.469) * [-1234.424] (-1236.073) (-1234.120) (-1234.555) -- 0:00:01 985000 -- (-1236.042) [-1238.233] (-1235.610) (-1238.200) * (-1235.744) (-1236.242) (-1234.939) [-1236.087] -- 0:00:01 Average standard deviation of split frequencies: 0.006407 985500 -- (-1235.693) [-1235.438] (-1239.339) (-1238.062) * (-1238.059) [-1233.693] (-1234.148) (-1235.369) -- 0:00:00 986000 -- (-1236.074) (-1236.619) (-1237.062) [-1234.396] * [-1239.046] (-1236.138) (-1234.340) (-1235.975) -- 0:00:00 986500 -- (-1233.980) (-1234.363) [-1236.307] (-1238.919) * (-1236.199) (-1235.654) (-1234.324) [-1234.534] -- 0:00:00 987000 -- (-1235.805) (-1238.622) (-1235.490) [-1234.784] * [-1237.471] (-1235.192) (-1241.522) (-1236.410) -- 0:00:00 987500 -- (-1235.290) (-1236.405) (-1234.838) [-1233.758] * [-1236.206] (-1236.743) (-1236.085) (-1234.879) -- 0:00:00 988000 -- (-1235.980) (-1236.288) (-1237.821) [-1234.814] * (-1237.256) (-1235.127) (-1233.625) [-1236.291] -- 0:00:00 988500 -- (-1237.727) (-1235.099) (-1238.215) [-1235.231] * (-1236.889) (-1236.329) [-1236.806] (-1234.773) -- 0:00:00 989000 -- (-1237.905) [-1236.341] (-1236.165) (-1233.922) * (-1239.078) [-1236.728] (-1240.282) (-1236.761) -- 0:00:00 989500 -- (-1234.263) [-1233.438] (-1235.462) (-1234.445) * (-1236.348) (-1234.749) (-1237.898) [-1234.358] -- 0:00:00 990000 -- (-1235.585) (-1234.799) (-1236.111) [-1235.314] * (-1235.647) (-1237.507) [-1240.328] (-1237.342) -- 0:00:00 Average standard deviation of split frequencies: 0.006820 990500 -- (-1235.931) [-1238.436] (-1236.482) (-1237.687) * [-1235.596] (-1238.057) (-1242.309) (-1242.316) -- 0:00:00 991000 -- (-1234.459) [-1234.069] (-1235.417) (-1235.941) * (-1235.345) (-1240.030) [-1235.812] (-1234.647) -- 0:00:00 991500 -- (-1238.216) (-1235.029) (-1237.627) [-1236.873] * (-1236.126) (-1234.749) (-1235.067) [-1235.646] -- 0:00:00 992000 -- [-1234.389] (-1234.168) (-1236.978) (-1236.990) * (-1233.734) (-1232.886) [-1234.598] (-1234.656) -- 0:00:00 992500 -- [-1233.917] (-1235.887) (-1234.818) (-1237.218) * (-1235.554) (-1237.259) (-1235.635) [-1237.231] -- 0:00:00 993000 -- [-1232.519] (-1239.287) (-1234.193) (-1237.232) * (-1239.146) (-1236.376) (-1235.484) [-1234.471] -- 0:00:00 993500 -- [-1238.270] (-1238.440) (-1236.082) (-1239.046) * [-1237.342] (-1236.613) (-1236.796) (-1237.514) -- 0:00:00 994000 -- (-1234.282) (-1233.772) (-1236.119) [-1234.964] * (-1238.571) (-1233.965) (-1238.714) [-1236.208] -- 0:00:00 994500 -- [-1234.855] (-1234.807) (-1235.645) (-1235.909) * (-1236.323) (-1235.482) [-1234.402] (-1241.155) -- 0:00:00 995000 -- (-1239.609) (-1238.079) (-1234.798) [-1233.528] * (-1235.944) (-1236.437) (-1237.573) [-1234.099] -- 0:00:00 Average standard deviation of split frequencies: 0.006626 995500 -- (-1233.720) (-1235.928) (-1234.171) [-1234.252] * [-1234.055] (-1240.370) (-1236.075) (-1233.970) -- 0:00:00 996000 -- (-1235.296) (-1238.858) (-1235.258) [-1237.045] * (-1234.761) (-1235.999) (-1236.389) [-1237.025] -- 0:00:00 996500 -- [-1234.869] (-1237.761) (-1237.245) (-1235.943) * (-1235.801) [-1233.563] (-1235.335) (-1234.613) -- 0:00:00 997000 -- [-1234.952] (-1236.095) (-1237.079) (-1236.350) * (-1235.129) (-1233.115) [-1236.458] (-1235.840) -- 0:00:00 997500 -- [-1234.786] (-1238.197) (-1237.144) (-1233.834) * (-1237.514) [-1235.337] (-1238.550) (-1238.260) -- 0:00:00 998000 -- [-1235.098] (-1240.807) (-1235.617) (-1236.235) * (-1235.907) (-1235.236) [-1236.533] (-1236.682) -- 0:00:00 998500 -- (-1235.602) (-1240.538) [-1235.000] (-1234.470) * (-1235.920) (-1235.676) (-1237.208) [-1237.278] -- 0:00:00 999000 -- (-1233.676) (-1234.195) [-1236.671] (-1237.777) * (-1235.266) [-1234.742] (-1235.168) (-1237.065) -- 0:00:00 999500 -- (-1236.214) (-1235.589) [-1232.652] (-1239.365) * (-1235.000) (-1234.503) [-1237.956] (-1238.892) -- 0:00:00 1000000 -- (-1238.862) [-1236.151] (-1235.522) (-1234.898) * (-1237.238) [-1234.701] (-1235.354) (-1236.418) -- 0:00:00 Average standard deviation of split frequencies: 0.007066 Analysis completed in 1 mins 7 seconds Analysis used 66.59 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1231.34 Likelihood of best state for "cold" chain of run 2 was -1231.28 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.5 % ( 62 %) Dirichlet(Revmat{all}) 98.5 % ( 98 %) Slider(Revmat{all}) 26.4 % ( 29 %) Dirichlet(Pi{all}) 28.4 % ( 26 %) Slider(Pi{all}) 69.3 % ( 40 %) Multiplier(Alpha{1,2}) 79.2 % ( 51 %) Multiplier(Alpha{3}) 25.5 % ( 28 %) Slider(Pinvar{all}) 97.3 % ( 96 %) ExtSPR(Tau{all},V{all}) 69.2 % ( 72 %) ExtTBR(Tau{all},V{all}) 98.2 % ( 98 %) NNI(Tau{all},V{all}) 87.9 % ( 85 %) ParsSPR(Tau{all},V{all}) 28.0 % ( 27 %) Multiplier(V{all}) 95.3 % ( 95 %) Nodeslider(V{all}) 30.5 % ( 31 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.9 % ( 73 %) Dirichlet(Revmat{all}) 98.8 % ( 97 %) Slider(Revmat{all}) 26.0 % ( 23 %) Dirichlet(Pi{all}) 27.6 % ( 23 %) Slider(Pi{all}) 68.7 % ( 36 %) Multiplier(Alpha{1,2}) 79.5 % ( 52 %) Multiplier(Alpha{3}) 23.6 % ( 32 %) Slider(Pinvar{all}) 97.3 % (100 %) ExtSPR(Tau{all},V{all}) 69.3 % ( 62 %) ExtTBR(Tau{all},V{all}) 98.3 % ( 99 %) NNI(Tau{all},V{all}) 87.9 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 30 %) Multiplier(V{all}) 95.5 % ( 97 %) Nodeslider(V{all}) 30.5 % ( 29 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.80 0.62 0.48 2 | 166356 0.82 0.66 3 | 166543 167269 0.83 4 | 166612 166683 166537 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.80 0.63 0.49 2 | 166010 0.82 0.66 3 | 166621 166863 0.83 4 | 166965 166516 167025 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1234.60 | 2 | | 1 1 | | | | 1 2 1| | 2 1 2 | | 22 *1 1 2 2 2 | | 1 11 1 1 2 2 1 2 1 2 | |2 1 12* 1 22 1 1 2 2 * 22 2* 2 1 2 | | 1 2 2 1 2 2 1 * 1 2 | | 1 2 1 12 2 2 1 1 21 2 1 | |1 1 1 2 1 1 2 12 1 1 2| | 2 1 2 2 2 1 *1 1 1 21 1 | | 1 2 1 1 2 2 | | 2 1 2 1 1 | | 2 22 2 2 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1236.48 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1234.76 -1238.75 2 -1234.76 -1238.09 -------------------------------------- TOTAL -1234.76 -1238.47 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.882682 0.094457 0.363963 1.513897 0.850241 1072.27 1248.02 1.000 r(A<->C){all} 0.138869 0.016407 0.000023 0.390455 0.099241 116.86 210.14 1.000 r(A<->G){all} 0.167980 0.021216 0.000040 0.456989 0.123502 133.65 228.64 1.001 r(A<->T){all} 0.165448 0.020099 0.000074 0.453862 0.129930 224.36 225.61 1.006 r(C<->G){all} 0.212972 0.024887 0.000185 0.522299 0.183738 96.65 158.45 1.001 r(C<->T){all} 0.151544 0.018320 0.000032 0.429644 0.112974 188.01 247.02 1.001 r(G<->T){all} 0.163188 0.019090 0.000039 0.438789 0.126281 278.83 339.15 1.000 pi(A){all} 0.200224 0.000173 0.173619 0.225986 0.200224 1382.75 1405.24 1.000 pi(C){all} 0.313172 0.000229 0.284773 0.343092 0.313246 941.61 1176.14 1.001 pi(G){all} 0.308164 0.000230 0.276933 0.335607 0.308236 1248.19 1350.28 1.000 pi(T){all} 0.178440 0.000165 0.155069 0.203738 0.178083 1183.83 1320.71 1.000 alpha{1,2} 0.343353 0.172830 0.000488 1.191478 0.211134 1272.13 1352.79 1.000 alpha{3} 0.403915 0.220870 0.000141 1.333924 0.236442 1133.36 1183.11 1.000 pinvar{all} 0.996404 0.000009 0.990893 0.999936 0.997188 1366.65 1414.36 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ....** 8 -- ..**** 9 -- ..*.*. 10 -- .**.** 11 -- ..**.. 12 -- .*.*** 13 -- .***.* 14 -- .*.*.. 15 -- .**... 16 -- .*...* 17 -- .****. 18 -- ..*..* 19 -- .*..*. 20 -- ...**. 21 -- ...*.* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 471 0.156895 0.004240 0.153897 0.159893 2 8 458 0.152565 0.000942 0.151899 0.153231 2 9 453 0.150899 0.018373 0.137908 0.163891 2 10 444 0.147901 0.010364 0.140573 0.155230 2 11 443 0.147568 0.007066 0.142572 0.152565 2 12 441 0.146902 0.014604 0.136576 0.157229 2 13 438 0.145903 0.000942 0.145237 0.146569 2 14 432 0.143904 0.014133 0.133911 0.153897 2 15 420 0.139907 0.001884 0.138574 0.141239 2 16 412 0.137242 0.007537 0.131912 0.142572 2 17 411 0.136909 0.006124 0.132578 0.141239 2 18 408 0.135909 0.003769 0.133245 0.138574 2 19 408 0.135909 0.003769 0.133245 0.138574 2 20 402 0.133911 0.000942 0.133245 0.134577 2 21 402 0.133911 0.011306 0.125916 0.141905 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.094257 0.009717 0.000031 0.289150 0.063394 1.000 2 length{all}[2] 0.093599 0.009319 0.000007 0.290282 0.063201 1.000 2 length{all}[3] 0.093566 0.009014 0.000038 0.280415 0.065261 1.000 2 length{all}[4] 0.089611 0.008655 0.000033 0.280706 0.058917 1.000 2 length{all}[5] 0.094611 0.010040 0.000008 0.298540 0.061499 1.000 2 length{all}[6] 0.135849 0.015136 0.000032 0.376427 0.101077 1.000 2 length{all}[7] 0.099031 0.010926 0.000334 0.311507 0.063511 0.998 2 length{all}[8] 0.091640 0.008893 0.000348 0.292256 0.063216 0.998 2 length{all}[9] 0.091393 0.009618 0.000235 0.253651 0.062497 0.998 2 length{all}[10] 0.085916 0.007980 0.000116 0.275461 0.056378 0.998 2 length{all}[11] 0.092542 0.009513 0.000014 0.272514 0.062457 1.000 2 length{all}[12] 0.092901 0.009639 0.000483 0.282785 0.058743 0.998 2 length{all}[13] 0.089249 0.008335 0.000462 0.272265 0.059108 0.998 2 length{all}[14] 0.097073 0.010718 0.000001 0.309635 0.066370 0.999 2 length{all}[15] 0.087394 0.008246 0.000105 0.268287 0.059658 0.999 2 length{all}[16] 0.098319 0.008928 0.000321 0.309112 0.070524 1.010 2 length{all}[17] 0.093597 0.010258 0.000081 0.291485 0.063157 1.001 2 length{all}[18] 0.099504 0.009226 0.000039 0.273702 0.069990 0.998 2 length{all}[19] 0.094565 0.010234 0.000405 0.265067 0.063310 0.998 2 length{all}[20] 0.089281 0.007740 0.000050 0.244625 0.062876 0.998 2 length{all}[21] 0.100603 0.010657 0.000073 0.293217 0.066725 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007066 Maximum standard deviation of split frequencies = 0.018373 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.010 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /--------------------------------------------- C1 (1) | |--------------------------------------------- C2 (2) | |---------------------------------------------- C3 (3) + |------------------------------------------ C4 (4) | |-------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |-------------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 92 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 900 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 58 patterns at 300 / 300 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 58 patterns at 300 / 300 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 56608 bytes for conP 5104 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 1 0.095987 0.051164 0.074143 0.020070 0.019450 0.028579 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1273.908335 Iterating by ming2 Initial: fx= 1273.908335 x= 0.09599 0.05116 0.07414 0.02007 0.01945 0.02858 0.30000 1.30000 1 h-m-p 0.0000 0.0001 706.1287 ++ 1241.338984 m 0.0001 13 | 1/8 2 h-m-p 0.0000 0.0000 4409.9027 ++ 1240.602041 m 0.0000 24 | 2/8 3 h-m-p 0.0000 0.0016 42.1842 ++++ 1214.378145 m 0.0016 37 | 3/8 4 h-m-p 0.0001 0.0003 142.9750 ++ 1199.315847 m 0.0003 48 | 4/8 5 h-m-p 0.0002 0.0009 41.7019 ++ 1192.248987 m 0.0009 59 | 5/8 6 h-m-p 0.0578 0.5200 0.4480 ++ 1191.837102 m 0.5200 70 | 6/8 7 h-m-p 0.4131 8.0000 0.1722 +YCYC 1191.582552 3 3.7085 89 | 6/8 8 h-m-p 1.6000 8.0000 0.0638 ++ 1191.555238 m 8.0000 102 | 6/8 9 h-m-p 0.5467 8.0000 0.9343 +YCC 1191.508660 2 3.1351 119 | 6/8 10 h-m-p 1.6000 8.0000 0.3910 YCC 1191.491494 2 2.7292 135 | 6/8 11 h-m-p 1.4165 8.0000 0.7533 ++ 1191.471486 m 8.0000 148 | 6/8 12 h-m-p 1.6000 8.0000 2.0442 YCC 1191.464574 2 3.0431 164 | 6/8 13 h-m-p 1.6000 8.0000 2.4214 YC 1191.459089 1 3.6242 176 | 6/8 14 h-m-p 1.6000 8.0000 4.0464 YC 1191.455548 1 3.6229 188 | 6/8 15 h-m-p 1.6000 8.0000 6.1347 YC 1191.453224 1 2.8857 200 | 6/8 16 h-m-p 1.6000 8.0000 8.8239 YC 1191.451528 1 3.9480 212 | 6/8 17 h-m-p 1.6000 8.0000 13.5907 YC 1191.450513 1 2.6741 224 | 6/8 18 h-m-p 1.6000 8.0000 19.0827 +YC 1191.449713 1 4.3342 237 | 6/8 19 h-m-p 1.6000 8.0000 30.1999 CC 1191.449271 1 2.4846 250 | 6/8 20 h-m-p 1.6000 8.0000 42.1134 +YC 1191.448887 1 4.9090 263 | 6/8 21 h-m-p 1.4796 7.3980 68.0517 CC 1191.448701 1 2.2558 276 | 6/8 22 h-m-p 0.7659 3.8294 91.3803 ++ 1191.448537 m 3.8294 287 | 7/8 23 h-m-p 1.6000 8.0000 0.0000 Y 1191.448531 0 0.9839 298 | 7/8 24 h-m-p 1.6000 8.0000 0.0000 -----Y 1191.448531 0 0.0004 315 Out.. lnL = -1191.448531 316 lfun, 316 eigenQcodon, 1896 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 1 0.063064 0.094608 0.077459 0.056139 0.087673 0.083817 0.000100 0.825560 0.219883 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 16.778190 np = 9 lnL0 = -1316.244038 Iterating by ming2 Initial: fx= 1316.244038 x= 0.06306 0.09461 0.07746 0.05614 0.08767 0.08382 0.00011 0.82556 0.21988 1 h-m-p 0.0000 0.0000 639.7557 ++ 1315.801848 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0001 1513.6515 ++ 1222.371456 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 4237.0619 ++ 1214.165835 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0001 321.7932 +YCYYCYCYC 1203.639793 8 0.0001 63 | 3/9 5 h-m-p 0.0000 0.0002 141.7865 ++ 1200.589313 m 0.0002 75 | 4/9 6 h-m-p 0.0000 0.0000 120295.2723 ++ 1194.689842 m 0.0000 87 | 5/9 7 h-m-p 0.0000 0.0000 3410.7371 ++ 1194.131361 m 0.0000 99 | 5/9 8 h-m-p -0.0000 -0.0000 27.5268 h-m-p: -6.30541524e-19 -3.15270762e-18 2.75268080e+01 1194.131361 .. | 5/9 9 h-m-p 0.0000 0.0000 934.0642 YYCCCC 1193.170062 5 0.0000 128 | 5/9 10 h-m-p 0.0000 0.0000 325.1615 ++ 1192.380525 m 0.0000 140 | 6/9 11 h-m-p 0.0000 0.0000 1.4654 ++ 1192.380465 m 0.0000 152 | 6/9 12 h-m-p 0.0000 0.0000 21.1426 h-m-p: 7.11606069e-24 3.55803035e-23 2.11425958e+01 1192.380465 .. | 6/9 13 h-m-p 0.0000 0.0001 97.6505 CYCCC 1192.285514 4 0.0000 180 | 6/9 14 h-m-p 0.0006 0.2974 3.3551 +++++ 1191.697261 m 0.2974 195 | 7/9 15 h-m-p 1.6000 8.0000 0.0002 YC 1191.696841 1 0.6384 208 | 7/9 16 h-m-p 1.6000 8.0000 0.0000 Y 1191.696841 0 2.6591 222 | 7/9 17 h-m-p 1.6000 8.0000 0.0000 ---Y 1191.696841 0 0.0021 239 Out.. lnL = -1191.696841 240 lfun, 720 eigenQcodon, 2880 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 1 0.054855 0.082385 0.062029 0.096057 0.072852 0.051186 0.000100 0.815843 0.216327 0.167274 1088.081068 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 0.050873 np = 11 lnL0 = -1246.732473 Iterating by ming2 Initial: fx= 1246.732473 x= 0.05485 0.08238 0.06203 0.09606 0.07285 0.05119 0.00011 0.81584 0.21633 0.16727 951.42857 1 h-m-p 0.0000 0.0000 131.0636 ++ 1246.687517 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0213 41.7114 +++++ 1217.222252 m 0.0213 33 | 2/11 3 h-m-p 0.0000 0.0001 303.2639 ++ 1215.261244 m 0.0001 47 | 3/11 4 h-m-p 0.0002 0.0010 165.0389 ++ 1211.782192 m 0.0010 61 | 4/11 5 h-m-p 0.0000 0.0000 1176.3078 ++ 1210.301389 m 0.0000 75 | 5/11 6 h-m-p 0.0000 0.0000 584828.4253 ++ 1209.052767 m 0.0000 89 | 6/11 7 h-m-p 0.0000 0.0024 2776.4526 ++YCCCC 1196.526529 4 0.0009 112 | 6/11 8 h-m-p 0.0053 0.0266 3.7673 ++ 1196.238105 m 0.0266 126 | 7/11 9 h-m-p 0.0608 8.0000 0.6820 ++CC 1196.059255 1 1.1314 144 | 7/11 10 h-m-p 0.8260 8.0000 0.9342 ++ 1192.919563 m 8.0000 162 | 7/11 11 h-m-p 0.0051 0.0253 101.9343 +YYYYCYYYYY 1191.401745 10 0.0228 191 | 7/11 12 h-m-p 0.1253 0.6267 0.4269 YC 1191.401389 1 0.0242 206 | 7/11 13 h-m-p 0.3035 8.0000 0.0341 ---------------.. | 7/11 14 h-m-p 0.0000 0.0052 1.2166 +YC 1191.401325 1 0.0001 257 | 7/11 15 h-m-p 0.0160 8.0000 0.1471 +++YCCC 1191.379490 3 2.1507 279 | 7/11 16 h-m-p 1.6000 8.0000 0.0123 YYC 1191.378371 2 1.2059 299 | 7/11 17 h-m-p 0.7711 8.0000 0.0192 YC 1191.378258 1 1.5270 318 | 7/11 18 h-m-p 1.6000 8.0000 0.0001 Y 1191.378258 0 0.9786 336 | 7/11 19 h-m-p 1.2280 8.0000 0.0001 ++ 1191.378258 m 8.0000 354 | 7/11 20 h-m-p 0.9895 8.0000 0.0006 ++ 1191.378258 m 8.0000 372 | 7/11 21 h-m-p 0.0160 8.0000 1.8694 +++YC 1191.378110 1 1.9567 394 | 7/11 22 h-m-p 1.6000 8.0000 1.9015 ++ 1191.376930 m 8.0000 408 | 7/11 23 h-m-p 0.0089 0.0443 647.6645 ++ 1191.374756 m 0.0443 422 | 8/11 24 h-m-p 0.5353 8.0000 0.0377 CC 1191.374628 1 0.8299 438 | 8/11 25 h-m-p 0.5924 8.0000 0.0529 Y 1191.374602 0 0.2884 455 | 8/11 26 h-m-p 1.6000 8.0000 0.0001 C 1191.374602 0 0.6367 472 | 8/11 27 h-m-p 1.6000 8.0000 0.0000 ----N 1191.374602 0 0.0016 493 Out.. lnL = -1191.374602 494 lfun, 1976 eigenQcodon, 8892 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1191.772535 S = -1189.517538 -2.609354 Calculating f(w|X), posterior probabilities of site classes. did 10 / 58 patterns 0:04 did 20 / 58 patterns 0:04 did 30 / 58 patterns 0:04 did 40 / 58 patterns 0:04 did 50 / 58 patterns 0:04 did 58 / 58 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 1 0.059583 0.038276 0.093730 0.040602 0.062341 0.058132 0.000100 0.238379 1.773938 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 26.882346 np = 9 lnL0 = -1287.266905 Iterating by ming2 Initial: fx= 1287.266905 x= 0.05958 0.03828 0.09373 0.04060 0.06234 0.05813 0.00011 0.23838 1.77394 1 h-m-p 0.0000 0.0000 645.0319 ++ 1286.894319 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0003 191.1055 ++YCYYYYYYY 1278.398346 8 0.0003 38 | 1/9 3 h-m-p 0.0009 0.0150 66.1139 +++ 1236.200229 m 0.0150 51 | 2/9 4 h-m-p 0.0000 0.0000 3915.8844 ++ 1232.614803 m 0.0000 63 | 3/9 5 h-m-p 0.0002 0.0034 243.2364 ++ 1219.798905 m 0.0034 75 | 4/9 6 h-m-p 0.0000 0.0001 402.0628 ++ 1216.563191 m 0.0001 87 | 5/9 7 h-m-p 0.0032 0.0535 8.3040 ------------.. | 5/9 8 h-m-p 0.0000 0.0000 316.8652 +YYYYCYCCC 1213.443047 8 0.0000 133 | 5/9 9 h-m-p 0.0000 0.0001 1233.3567 ++ 1192.828462 m 0.0001 145 | 6/9 10 h-m-p 0.0014 0.6842 0.6608 +++YCCC 1192.733855 3 0.1781 165 | 6/9 11 h-m-p 0.2876 4.7549 0.4093 +++ 1191.703750 m 4.7549 181 | 7/9 12 h-m-p 1.6000 8.0000 0.0216 +YC 1191.696841 1 4.4000 198 | 7/9 13 h-m-p 1.6000 8.0000 0.0011 Y 1191.696840 0 0.9534 212 | 7/9 14 h-m-p 1.6000 8.0000 0.0001 -----Y 1191.696840 0 0.0004 231 | 7/9 15 h-m-p 0.0160 8.0000 0.0001 -----Y 1191.696840 0 0.0000 250 Out.. lnL = -1191.696840 251 lfun, 2761 eigenQcodon, 15060 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 1 0.020700 0.015480 0.010856 0.014477 0.035704 0.034396 0.000100 0.900000 0.380591 1.221367 999.000000 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 0.112740 np = 11 lnL0 = -1209.943636 Iterating by ming2 Initial: fx= 1209.943636 x= 0.02070 0.01548 0.01086 0.01448 0.03570 0.03440 0.00011 0.90000 0.38059 1.22137 951.42857 1 h-m-p 0.0000 0.0000 225.3167 ++ 1209.679452 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 705.1050 ++ 1200.604487 m 0.0001 30 | 2/11 3 h-m-p 0.0000 0.0000 700.3425 ++ 1198.784394 m 0.0000 44 | 3/11 4 h-m-p 0.0000 0.0000 20355.4209 ++ 1198.329889 m 0.0000 58 | 4/11 5 h-m-p 0.0000 0.0001 292.2421 ++ 1194.705725 m 0.0001 72 | 5/11 6 h-m-p 0.0000 0.0000 538.0844 ++ 1192.964975 m 0.0000 86 | 6/11 7 h-m-p 0.0190 0.0950 0.5534 -------------.. | 6/11 8 h-m-p 0.0000 0.0003 90.7531 ++YCYCYC 1191.676985 5 0.0002 140 | 6/11 9 h-m-p 0.0001 0.0003 48.1550 +YYCYCCC 1191.386430 6 0.0002 164 | 6/11 10 h-m-p 0.7622 8.0000 0.0148 C 1191.386207 0 0.6899 178 | 6/11 11 h-m-p 0.1461 5.5014 0.0697 +CCC 1191.385287 2 0.8005 202 | 6/11 12 h-m-p 1.6000 8.0000 0.0301 ++ 1191.381151 m 8.0000 221 | 6/11 13 h-m-p 0.0000 0.0002 473.8344 ++ 1191.379753 m 0.0002 240 | 7/11 14 h-m-p 0.2468 5.9573 0.0934 YC 1191.378261 1 0.4875 255 | 7/11 15 h-m-p 1.6000 8.0000 0.0015 Y 1191.378260 0 0.9389 273 | 7/11 16 h-m-p 1.6000 8.0000 0.0001 C 1191.378260 0 1.5267 291 | 7/11 17 h-m-p 1.6000 8.0000 0.0001 Y 1191.378260 0 3.3624 309 | 7/11 18 h-m-p 0.5468 8.0000 0.0005 ++ 1191.378259 m 8.0000 327 | 7/11 19 h-m-p 0.3044 8.0000 0.0123 ++Y 1191.378258 0 3.8813 347 | 7/11 20 h-m-p 1.5759 8.0000 0.0302 ++ 1191.378239 m 8.0000 365 | 7/11 21 h-m-p 0.0032 0.6329 74.7021 ++++ 1191.375142 m 0.6329 385 | 8/11 22 h-m-p 0.9278 8.0000 0.1544 CC 1191.374605 1 1.4128 401 | 8/11 23 h-m-p 1.6000 8.0000 0.0037 Y 1191.374602 0 1.0355 418 | 8/11 24 h-m-p 1.6000 8.0000 0.0006 ---Y 1191.374602 0 0.0047 438 Out.. lnL = -1191.374602 439 lfun, 5268 eigenQcodon, 28974 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1191.761846 S = -1189.517554 -2.345510 Calculating f(w|X), posterior probabilities of site classes. did 10 / 58 patterns 0:16 did 20 / 58 patterns 0:16 did 30 / 58 patterns 0:16 did 40 / 58 patterns 0:16 did 50 / 58 patterns 0:16 did 58 / 58 patterns 0:17 Time used: 0:17 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=300 NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT NC_002677_1_NP_302568_1_1440_ML2424 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT ************************************************** NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK NC_002677_1_NP_302568_1_1440_ML2424 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQGKFQLLGK ******************************************.******* NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ NC_002677_1_NP_302568_1_1440_ML2424 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ ************************************************** NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD NC_002677_1_NP_302568_1_1440_ML2424 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ************************************************** NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP NC_002677_1_NP_302568_1_1440_ML2424 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP ************************************************** NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE NC_002677_1_NP_302568_1_1440_ML2424 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE **************************************************
>NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >NC_002677_1_NP_302568_1_1440_ML2424 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGCTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA >NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 ATGGCTTCCCCTGACCTGAGTAACGCATATAACGGTCGCATTGACCTGGG TTCCCTGGCCAACAACGCGAGCATCAACCGGGCGCTTAACGATATGCCCA CAGCAGTGGACGACGCAGGGGTCCGCCCGCAACCACCGATCGACCTGACC GCAGCAGCATTTTTTGACGTCGACAACACGCTGGTGCAGGGCTCGTCGGC GGTGCACTTCGGTCGCGGGCTGGCCGCTCGCGACTATTTCACCTATCGCG ATGTACTCGGATTCATCTACGCCCAGGGTAAATTTCAATTACTCGGAAAA GAAAATAGCCAGGACGTGGCAGCCGGCCAGCGCAAAGCGCTCGCGTTCAT CGAAGGACGATCAGTCGAGCAGCTGGTAGCTCTGGGCGAGGAGATCTACG ATGAGATCATCGCTGATAAAATCTGGGCTGGCACCCGCCAGCTCACCCAG ATACACCTTGATGCCGGCCAGCAGGTGTGGCTGATCACTGCCACGCCATA CGAACTCGCTGCCACCATCGCACGTCGGCTCGGCCTGACCGGGGCATTGG GAACAGTCGCCGAGTCGGTAGACGGGATATTCACTGGCAGACTGGTAGAT GAGCTCCTGCATGGAGTCGGGAAAGCACATGCAGTCCGATCGCTGGCGAT CCGGGAGGGCCTCAATCTGAAGCGCTGCACCGCCTATTCCGACAGCTACA ACGACGTGCCCATGCTGTCGTTGGTGGGCACCGCGGTCGCCATCAACCCG GACGCCCAGCTACGCAGTCTGGCCCGTGAACGGGGCTGGGAGATCCGCGA CTTTCGAACCGCTCGCAAGGCTGCCCGGATCGGGGTGCCGTCGGCCTTGG CGTTGGGCGGCGCGTTGGCAGCGGCCGTGTCGCGTCGCCGCGACCGCGAA
>NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >NC_002677_1_NP_302568_1_1440_ML2424 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQAKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE >NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 MASPDLSNAYNGRIDLGSLANNASINRALNDMPTAVDDAGVRPQPPIDLT AAAFFDVDNTLVQGSSAVHFGRGLAARDYFTYRDVLGFIYAQGKFQLLGK ENSQDVAAGQRKALAFIEGRSVEQLVALGEEIYDEIIADKIWAGTRQLTQ IHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVD ELLHGVGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAINP DAQLRSLARERGWEIRDFRTARKAARIGVPSALALGGALAAAVSRRRDRE
#NEXUS [ID: 5386625527] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 NC_002677_1_NP_302568_1_1440_ML2424 NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 ; end; begin trees; translate 1 NC_011896_1_WP_010908888_1_2591_MLBR_RS12335, 2 NC_002677_1_NP_302568_1_1440_ML2424, 3 NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880, 4 NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530, 5 NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340, 6 NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06339445,2:0.0632006,3:0.06526079,4:0.05891698,5:0.06149943,6:0.1010773); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06339445,2:0.0632006,3:0.06526079,4:0.05891698,5:0.06149943,6:0.1010773); end;
Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1234.76 -1238.75 2 -1234.76 -1238.09 -------------------------------------- TOTAL -1234.76 -1238.47 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2424/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.882682 0.094457 0.363963 1.513897 0.850241 1072.27 1248.02 1.000 r(A<->C){all} 0.138869 0.016407 0.000023 0.390455 0.099241 116.86 210.14 1.000 r(A<->G){all} 0.167980 0.021216 0.000040 0.456989 0.123502 133.65 228.64 1.001 r(A<->T){all} 0.165448 0.020099 0.000074 0.453862 0.129930 224.36 225.61 1.006 r(C<->G){all} 0.212972 0.024887 0.000185 0.522299 0.183738 96.65 158.45 1.001 r(C<->T){all} 0.151544 0.018320 0.000032 0.429644 0.112974 188.01 247.02 1.001 r(G<->T){all} 0.163188 0.019090 0.000039 0.438789 0.126281 278.83 339.15 1.000 pi(A){all} 0.200224 0.000173 0.173619 0.225986 0.200224 1382.75 1405.24 1.000 pi(C){all} 0.313172 0.000229 0.284773 0.343092 0.313246 941.61 1176.14 1.001 pi(G){all} 0.308164 0.000230 0.276933 0.335607 0.308236 1248.19 1350.28 1.000 pi(T){all} 0.178440 0.000165 0.155069 0.203738 0.178083 1183.83 1320.71 1.000 alpha{1,2} 0.343353 0.172830 0.000488 1.191478 0.211134 1272.13 1352.79 1.000 alpha{3} 0.403915 0.220870 0.000141 1.333924 0.236442 1133.36 1183.11 1.000 pinvar{all} 0.996404 0.000009 0.990893 0.999936 0.997188 1366.65 1414.36 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2424/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 300 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 4 4 4 4 4 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0 TTC 5 5 5 5 5 5 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 1 1 1 1 1 1 Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 5 5 5 5 5 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3 CTC 8 8 8 8 8 8 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 14 14 14 14 14 14 CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3 CTG 16 16 16 16 16 16 | CCG 4 4 4 4 4 4 | CAG 10 10 10 10 10 10 | CGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 2 2 2 2 2 2 ATC 14 14 14 14 14 14 | ACC 9 9 9 9 9 9 | AAC 9 9 9 9 9 9 | AGC 3 3 3 3 3 3 ATA 2 2 2 2 2 2 | ACA 2 2 2 2 2 2 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1 Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 0 0 0 0 0 0 | Ala GCT 9 9 9 9 9 8 | Asp GAT 6 6 6 6 6 6 | Gly GGT 3 3 3 3 3 4 GTC 7 7 7 7 7 7 | GCC 15 15 15 15 15 15 | GAC 15 15 15 15 15 15 | GGC 12 12 12 12 12 12 GTA 4 4 4 4 4 4 | GCA 12 12 12 12 12 12 | Glu GAA 5 5 5 5 5 5 | GGA 5 5 5 5 5 5 GTG 9 9 9 9 9 9 | GCG 10 10 10 10 10 10 | GAG 8 8 8 8 8 8 | GGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908888_1_2591_MLBR_RS12335 position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.27000 A:0.25333 G:0.20333 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31222 A:0.20111 G:0.30778 #2: NC_002677_1_NP_302568_1_1440_ML2424 position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.27000 A:0.25333 G:0.20333 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31222 A:0.20111 G:0.30778 #3: NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880 position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.27000 A:0.25333 G:0.20333 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31222 A:0.20111 G:0.30778 #4: NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530 position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.27000 A:0.25333 G:0.20333 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31222 A:0.20111 G:0.30778 #5: NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340 position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.27000 A:0.25333 G:0.20333 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31222 A:0.20111 G:0.30778 #6: NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665 position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.26667 A:0.25333 G:0.20667 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31111 A:0.20111 G:0.30889 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 24 | Ser S TCT 0 | Tyr Y TAT 24 | Cys C TGT 0 TTC 30 | TCC 18 | TAC 24 | TGC 6 Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 30 | TCG 42 | TAG 0 | Trp W TGG 18 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 18 CTC 48 | CCC 12 | CAC 12 | CGC 84 CTA 6 | CCA 12 | Gln Q CAA 12 | CGA 18 CTG 96 | CCG 24 | CAG 60 | CGG 30 ------------------------------------------------------------------------------ Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 12 ATC 84 | ACC 54 | AAC 54 | AGC 18 ATA 12 | ACA 12 | Lys K AAA 30 | Arg R AGA 6 Met M ATG 18 | ACG 12 | AAG 12 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 0 | Ala A GCT 53 | Asp D GAT 36 | Gly G GGT 19 GTC 42 | GCC 90 | GAC 90 | GGC 72 GTA 24 | GCA 72 | Glu E GAA 30 | GGA 30 GTG 54 | GCG 60 | GAG 48 | GGG 36 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.12667 C:0.25667 A:0.19667 G:0.42000 position 2: T:0.27333 C:0.26944 A:0.25333 G:0.20389 position 3: T:0.13667 C:0.41000 A:0.15333 G:0.30000 Average T:0.17889 C:0.31204 A:0.20111 G:0.30796 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1 lnL(ntime: 6 np: 8): -1191.448531 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.003368 0.000100 999.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.003388 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.003368); (NC_011896_1_WP_010908888_1_2591_MLBR_RS12335: 0.000004, NC_002677_1_NP_302568_1_1440_ML2424: 0.000004, NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880: 0.000004, NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530: 0.000004, NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340: 0.000004, NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665: 0.003368); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 999.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 699.5 200.5 999.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 699.5 200.5 999.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 699.5 200.5 999.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 699.5 200.5 999.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 699.5 200.5 999.0000 0.0000 0.0000 0.0 0.0 7..6 0.003 699.5 200.5 999.0000 0.0014 0.0000 1.0 0.0 tree length for dN: 0.0015 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1 lnL(ntime: 6 np: 9): -1191.696841 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.003379 0.000100 0.000010 0.616575 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.003399 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.003379); (NC_011896_1_WP_010908888_1_2591_MLBR_RS12335: 0.000004, NC_002677_1_NP_302568_1_1440_ML2424: 0.000004, NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880: 0.000004, NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530: 0.000004, NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340: 0.000004, NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665: 0.003379); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 0.61658 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.003 699.5 200.5 1.0000 0.0011 0.0011 0.8 0.2 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1 lnL(ntime: 6 np: 11): -1191.374602 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.005953 0.000100 0.993562 0.000001 0.000001 999.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.005973 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005953); (NC_011896_1_WP_010908888_1_2591_MLBR_RS12335: 0.000004, NC_002677_1_NP_302568_1_1440_ML2424: 0.000004, NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880: 0.000004, NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530: 0.000004, NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340: 0.000004, NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665: 0.005953); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.99356 0.00000 0.00644 w: 0.00000 1.00000 999.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..2 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..3 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..4 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..5 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..6 0.006 699.5 200.5 6.4309 0.0024 0.0004 1.7 0.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908888_1_2591_MLBR_RS12335) Pr(w>1) post mean +- SE for w 93 A 1.000** 999.000 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908888_1_2591_MLBR_RS12335) Pr(w>1) post mean +- SE for w 93 A 0.721 5.015 +- 3.434 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.095 0.096 0.097 0.098 0.100 0.101 0.102 0.103 0.104 0.105 w2: 0.070 0.084 0.094 0.101 0.105 0.108 0.110 0.110 0.110 0.108 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.008 0.010 0.008 0.008 0.011 0.010 0.009 0.008 0.007 0.011 0.011 0.011 0.010 0.009 0.008 0.007 0.012 0.012 0.011 0.011 0.011 0.010 0.009 0.008 0.007 0.012 0.012 0.012 0.011 0.011 0.011 0.010 0.010 0.009 0.008 0.006 0.011 0.012 0.012 0.012 0.012 0.011 0.011 0.011 0.010 0.009 0.009 0.007 0.006 0.011 0.011 0.011 0.012 0.012 0.012 0.011 0.011 0.011 0.011 0.010 0.009 0.008 0.007 0.006 0.011 0.011 0.011 0.011 0.011 0.012 0.012 0.011 0.011 0.011 0.011 0.010 0.010 0.009 0.008 0.007 0.006 0.010 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.010 0.009 0.008 0.006 0.005 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1 lnL(ntime: 6 np: 9): -1191.696840 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.003379 0.000100 1.349387 0.005000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.003399 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.003379); (NC_011896_1_WP_010908888_1_2591_MLBR_RS12335: 0.000004, NC_002677_1_NP_302568_1_1440_ML2424: 0.000004, NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880: 0.000004, NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530: 0.000004, NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340: 0.000004, NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665: 0.003379); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 1.34939 q = 0.00500 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.99998 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 699.5 200.5 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.003 699.5 200.5 1.0000 0.0011 0.0011 0.8 0.2 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1 lnL(ntime: 6 np: 11): -1191.374602 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.005953 0.000100 0.993563 0.005000 1.204569 999.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.005973 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005953); (NC_011896_1_WP_010908888_1_2591_MLBR_RS12335: 0.000004, NC_002677_1_NP_302568_1_1440_ML2424: 0.000004, NZ_LVXE01000055_1_WP_010908888_1_2204_A3216_RS11880: 0.000004, NZ_LYPH01000045_1_WP_010908888_1_1788_A8144_RS08530: 0.000004, NZ_CP029543_1_WP_010908888_1_2619_DIJ64_RS13340: 0.000004, NZ_AP014567_1_WP_119608015_1_2684_JK2ML_RS13665: 0.005953); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99356 p = 0.00500 q = 1.20457 (p1 = 0.00644) w = 999.00000 MLEs of dN/dS (w) for site classes (K=11) p: 0.09936 0.09936 0.09936 0.09936 0.09936 0.09936 0.09936 0.09936 0.09936 0.09936 0.00644 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 999.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..2 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..3 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..4 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..5 0.000 699.5 200.5 6.4309 0.0000 0.0000 0.0 0.0 7..6 0.006 699.5 200.5 6.4309 0.0024 0.0004 1.7 0.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908888_1_2591_MLBR_RS12335) Pr(w>1) post mean +- SE for w 93 A 1.000** 998.999 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908888_1_2591_MLBR_RS12335) Pr(w>1) post mean +- SE for w 1 M 0.531 3.453 +- 3.410 2 A 0.532 3.457 +- 3.411 3 S 0.531 3.453 +- 3.410 4 P 0.532 3.457 +- 3.411 5 D 0.530 3.447 +- 3.408 6 L 0.531 3.454 +- 3.410 7 S 0.532 3.457 +- 3.411 8 N 0.531 3.452 +- 3.410 9 A 0.532 3.456 +- 3.411 10 Y 0.532 3.457 +- 3.411 11 N 0.531 3.452 +- 3.410 12 G 0.532 3.457 +- 3.411 13 R 0.531 3.452 +- 3.410 14 I 0.532 3.457 +- 3.411 15 D 0.530 3.447 +- 3.408 16 L 0.531 3.454 +- 3.410 17 G 0.532 3.457 +- 3.411 18 S 0.531 3.453 +- 3.410 19 L 0.531 3.454 +- 3.410 20 A 0.531 3.451 +- 3.410 21 N 0.531 3.452 +- 3.410 22 N 0.531 3.452 +- 3.410 23 A 0.531 3.453 +- 3.410 24 S 0.531 3.453 +- 3.410 25 I 0.531 3.453 +- 3.410 26 N 0.531 3.452 +- 3.410 27 R 0.532 3.455 +- 3.411 28 A 0.531 3.453 +- 3.410 29 L 0.532 3.457 +- 3.411 30 N 0.531 3.452 +- 3.410 31 D 0.531 3.453 +- 3.410 32 M 0.531 3.453 +- 3.410 33 P 0.531 3.451 +- 3.410 34 T 0.532 3.458 +- 3.411 35 A 0.532 3.456 +- 3.411 36 V 0.531 3.453 +- 3.410 37 D 0.530 3.447 +- 3.408 38 D 0.530 3.447 +- 3.408 39 A 0.532 3.456 +- 3.411 40 G 0.531 3.453 +- 3.410 41 V 0.531 3.451 +- 3.410 42 R 0.531 3.452 +- 3.410 43 P 0.531 3.454 +- 3.410 44 Q 0.531 3.454 +- 3.410 45 P 0.532 3.457 +- 3.411 46 P 0.531 3.454 +- 3.410 47 I 0.531 3.453 +- 3.410 48 D 0.530 3.447 +- 3.408 49 L 0.531 3.454 +- 3.410 50 T 0.531 3.454 +- 3.410 51 A 0.532 3.456 +- 3.411 52 A 0.532 3.456 +- 3.411 53 A 0.532 3.456 +- 3.411 54 F 0.532 3.456 +- 3.411 55 F 0.532 3.456 +- 3.411 56 D 0.530 3.447 +- 3.408 57 V 0.531 3.451 +- 3.410 58 D 0.530 3.447 +- 3.408 59 N 0.531 3.452 +- 3.410 60 T 0.532 3.456 +- 3.411 61 L 0.531 3.454 +- 3.410 62 V 0.531 3.453 +- 3.410 63 Q 0.531 3.451 +- 3.410 64 G 0.531 3.451 +- 3.410 65 S 0.532 3.456 +- 3.411 66 S 0.532 3.456 +- 3.411 67 A 0.531 3.453 +- 3.410 68 V 0.531 3.453 +- 3.410 69 H 0.531 3.449 +- 3.409 70 F 0.531 3.452 +- 3.410 71 G 0.532 3.457 +- 3.411 72 R 0.531 3.452 +- 3.410 73 G 0.531 3.453 +- 3.410 74 L 0.531 3.454 +- 3.410 75 A 0.531 3.451 +- 3.410 76 A 0.532 3.457 +- 3.411 77 R 0.531 3.452 +- 3.410 78 D 0.530 3.447 +- 3.408 79 Y 0.532 3.457 +- 3.411 80 F 0.531 3.452 +- 3.410 81 T 0.531 3.454 +- 3.410 82 Y 0.532 3.457 +- 3.411 83 R 0.531 3.452 +- 3.410 84 D 0.531 3.453 +- 3.410 85 V 0.532 3.456 +- 3.411 86 L 0.531 3.451 +- 3.410 87 G 0.532 3.457 +- 3.411 88 F 0.531 3.452 +- 3.410 89 I 0.531 3.453 +- 3.410 90 Y 0.531 3.453 +- 3.410 91 A 0.531 3.451 +- 3.410 92 Q 0.531 3.451 +- 3.410 93 A 0.868 5.593 +- 3.158 94 K 0.532 3.456 +- 3.411 95 F 0.532 3.456 +- 3.411 96 Q 0.531 3.454 +- 3.410 97 L 0.532 3.456 +- 3.411 98 L 0.531 3.451 +- 3.410 99 G 0.532 3.457 +- 3.411 100 K 0.532 3.456 +- 3.411 101 E 0.531 3.452 +- 3.410 102 N 0.532 3.456 +- 3.411 103 S 0.531 3.453 +- 3.410 104 Q 0.531 3.451 +- 3.410 105 D 0.530 3.447 +- 3.408 106 V 0.531 3.453 +- 3.410 107 A 0.532 3.456 +- 3.411 108 A 0.531 3.451 +- 3.410 109 G 0.531 3.451 +- 3.410 110 Q 0.531 3.451 +- 3.410 111 R 0.531 3.452 +- 3.410 112 K 0.532 3.456 +- 3.411 113 A 0.531 3.453 +- 3.410 114 L 0.531 3.451 +- 3.410 115 A 0.531 3.453 +- 3.410 116 F 0.531 3.452 +- 3.410 117 I 0.531 3.453 +- 3.410 118 E 0.531 3.452 +- 3.410 119 G 0.532 3.457 +- 3.411 120 R 0.532 3.457 +- 3.411 121 S 0.532 3.458 +- 3.412 122 V 0.531 3.451 +- 3.410 123 E 0.531 3.449 +- 3.409 124 Q 0.531 3.451 +- 3.410 125 L 0.531 3.454 +- 3.410 126 V 0.532 3.456 +- 3.411 127 A 0.532 3.457 +- 3.411 128 L 0.531 3.454 +- 3.410 129 G 0.531 3.451 +- 3.410 130 E 0.531 3.449 +- 3.409 131 E 0.531 3.449 +- 3.409 132 I 0.531 3.453 +- 3.410 133 Y 0.531 3.453 +- 3.410 134 D 0.531 3.453 +- 3.410 135 E 0.531 3.449 +- 3.409 136 I 0.531 3.453 +- 3.410 137 I 0.531 3.453 +- 3.410 138 A 0.532 3.457 +- 3.411 139 D 0.531 3.453 +- 3.410 140 K 0.532 3.456 +- 3.411 141 I 0.531 3.453 +- 3.410 142 W 0.531 3.455 +- 3.411 143 A 0.532 3.457 +- 3.411 144 G 0.531 3.451 +- 3.410 145 T 0.531 3.454 +- 3.410 146 R 0.531 3.452 +- 3.410 147 Q 0.531 3.451 +- 3.410 148 L 0.531 3.451 +- 3.410 149 T 0.531 3.454 +- 3.410 150 Q 0.531 3.451 +- 3.410 151 I 0.532 3.458 +- 3.411 152 H 0.531 3.449 +- 3.409 153 L 0.532 3.457 +- 3.411 154 D 0.531 3.453 +- 3.410 155 A 0.531 3.451 +- 3.410 156 G 0.531 3.451 +- 3.410 157 Q 0.531 3.451 +- 3.410 158 Q 0.531 3.451 +- 3.410 159 V 0.531 3.453 +- 3.410 160 W 0.531 3.455 +- 3.411 161 L 0.531 3.454 +- 3.410 162 I 0.531 3.453 +- 3.410 163 T 0.532 3.458 +- 3.412 164 A 0.531 3.451 +- 3.410 165 T 0.532 3.456 +- 3.411 166 P 0.532 3.457 +- 3.411 167 Y 0.531 3.453 +- 3.410 168 E 0.531 3.452 +- 3.410 169 L 0.531 3.451 +- 3.410 170 A 0.532 3.457 +- 3.411 171 A 0.531 3.451 +- 3.410 172 T 0.531 3.454 +- 3.410 173 I 0.531 3.453 +- 3.410 174 A 0.532 3.456 +- 3.411 175 R 0.532 3.457 +- 3.411 176 R 0.532 3.455 +- 3.411 177 L 0.531 3.451 +- 3.410 178 G 0.531 3.451 +- 3.410 179 L 0.531 3.454 +- 3.410 180 T 0.531 3.454 +- 3.410 181 G 0.531 3.453 +- 3.410 182 A 0.532 3.456 +- 3.411 183 L 0.531 3.454 +- 3.411 184 G 0.532 3.457 +- 3.411 185 T 0.532 3.458 +- 3.411 186 V 0.531 3.451 +- 3.410 187 A 0.531 3.451 +- 3.410 188 E 0.531 3.449 +- 3.409 189 S 0.532 3.456 +- 3.411 190 V 0.532 3.456 +- 3.411 191 D 0.530 3.447 +- 3.408 192 G 0.531 3.453 +- 3.410 193 I 0.532 3.458 +- 3.411 194 F 0.531 3.452 +- 3.410 195 T 0.532 3.458 +- 3.412 196 G 0.531 3.451 +- 3.410 197 R 0.532 3.457 +- 3.411 198 L 0.531 3.454 +- 3.410 199 V 0.532 3.456 +- 3.411 200 D 0.531 3.453 +- 3.410 201 E 0.531 3.449 +- 3.409 202 L 0.531 3.451 +- 3.410 203 L 0.531 3.454 +- 3.410 204 H 0.531 3.455 +- 3.411 205 G 0.532 3.457 +- 3.411 206 V 0.531 3.451 +- 3.410 207 G 0.531 3.453 +- 3.410 208 K 0.532 3.456 +- 3.411 209 A 0.532 3.456 +- 3.411 210 H 0.531 3.455 +- 3.411 211 A 0.532 3.456 +- 3.411 212 V 0.531 3.451 +- 3.410 213 R 0.532 3.457 +- 3.411 214 S 0.532 3.456 +- 3.411 215 L 0.531 3.454 +- 3.410 216 A 0.531 3.453 +- 3.410 217 I 0.531 3.453 +- 3.410 218 R 0.532 3.455 +- 3.411 219 E 0.531 3.449 +- 3.409 220 G 0.531 3.451 +- 3.410 221 L 0.531 3.451 +- 3.410 222 N 0.532 3.456 +- 3.411 223 L 0.531 3.454 +- 3.410 224 K 0.531 3.454 +- 3.410 225 R 0.531 3.452 +- 3.410 226 C 0.531 3.453 +- 3.410 227 T 0.531 3.454 +- 3.410 228 A 0.531 3.451 +- 3.410 229 Y 0.532 3.457 +- 3.411 230 S 0.531 3.453 +- 3.410 231 D 0.530 3.447 +- 3.408 232 S 0.531 3.453 +- 3.410 233 Y 0.531 3.453 +- 3.410 234 N 0.531 3.452 +- 3.410 235 D 0.530 3.447 +- 3.408 236 V 0.531 3.453 +- 3.410 237 P 0.531 3.451 +- 3.410 238 M 0.531 3.453 +- 3.410 239 L 0.531 3.454 +- 3.410 240 S 0.532 3.456 +- 3.411 241 L 0.531 3.454 +- 3.411 242 V 0.531 3.453 +- 3.410 243 G 0.531 3.451 +- 3.410 244 T 0.531 3.454 +- 3.410 245 A 0.531 3.453 +- 3.410 246 V 0.531 3.451 +- 3.410 247 A 0.531 3.451 +- 3.410 248 I 0.531 3.453 +- 3.410 249 N 0.531 3.452 +- 3.410 250 P 0.531 3.454 +- 3.410 251 D 0.530 3.447 +- 3.408 252 A 0.531 3.451 +- 3.410 253 Q 0.531 3.451 +- 3.410 254 L 0.532 3.457 +- 3.411 255 R 0.531 3.452 +- 3.410 256 S 0.532 3.457 +- 3.411 257 L 0.531 3.454 +- 3.410 258 A 0.531 3.451 +- 3.410 259 R 0.532 3.457 +- 3.411 260 E 0.531 3.452 +- 3.410 261 R 0.532 3.455 +- 3.411 262 G 0.531 3.451 +- 3.410 263 W 0.531 3.455 +- 3.411 264 E 0.531 3.449 +- 3.409 265 I 0.531 3.453 +- 3.410 266 R 0.531 3.452 +- 3.410 267 D 0.530 3.447 +- 3.408 268 F 0.532 3.456 +- 3.411 269 R 0.532 3.457 +- 3.411 270 T 0.531 3.454 +- 3.410 271 A 0.532 3.457 +- 3.411 272 R 0.531 3.452 +- 3.410 273 K 0.531 3.454 +- 3.410 274 A 0.532 3.457 +- 3.411 275 A 0.531 3.451 +- 3.410 276 R 0.532 3.455 +- 3.411 277 I 0.531 3.453 +- 3.410 278 G 0.531 3.453 +- 3.410 279 V 0.531 3.453 +- 3.410 280 P 0.531 3.454 +- 3.410 281 S 0.532 3.456 +- 3.411 282 A 0.531 3.451 +- 3.410 283 L 0.531 3.454 +- 3.411 284 A 0.531 3.453 +- 3.410 285 L 0.531 3.454 +- 3.411 286 G 0.531 3.451 +- 3.410 287 G 0.531 3.451 +- 3.410 288 A 0.531 3.453 +- 3.410 289 L 0.531 3.454 +- 3.411 290 A 0.532 3.456 +- 3.411 291 A 0.531 3.453 +- 3.410 292 A 0.531 3.451 +- 3.410 293 V 0.531 3.453 +- 3.410 294 S 0.532 3.456 +- 3.411 295 R 0.532 3.457 +- 3.411 296 R 0.531 3.452 +- 3.410 297 R 0.531 3.452 +- 3.410 298 D 0.530 3.447 +- 3.408 299 R 0.531 3.452 +- 3.410 300 E 0.531 3.452 +- 3.410 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.102 0.106 0.110 0.112 0.113 0.112 0.108 0.098 0.082 0.057 p : 0.095 0.097 0.099 0.100 0.100 0.101 0.101 0.102 0.102 0.103 q : 0.104 0.103 0.101 0.101 0.100 0.099 0.099 0.098 0.098 0.097 ws: 0.069 0.088 0.100 0.106 0.110 0.110 0.109 0.106 0.103 0.099 Time used: 0:17
Model 1: NearlyNeutral -1191.696841 Model 2: PositiveSelection -1191.374602 Model 0: one-ratio -1191.448531 Model 7: beta -1191.69684 Model 8: beta&w>1 -1191.374602 Model 0 vs 1 0.4966199999998935 Model 2 vs 1 0.6444779999997081 Model 8 vs 7 0.6444759999999405