--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:05:27 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2428A/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -135.55 -143.43
2 -135.58 -139.85
--------------------------------------
TOTAL -135.56 -142.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892291 0.090372 0.378814 1.517238 0.861251 1363.36 1415.26 1.000
r(A<->C){all} 0.169384 0.019246 0.000065 0.439712 0.136756 247.32 258.60 1.005
r(A<->G){all} 0.165264 0.018731 0.000172 0.436430 0.131361 264.88 279.14 1.008
r(A<->T){all} 0.171391 0.019880 0.000058 0.451779 0.134850 167.78 169.24 1.002
r(C<->G){all} 0.158052 0.019419 0.000034 0.435484 0.115805 163.68 262.88 1.001
r(C<->T){all} 0.171656 0.022464 0.000030 0.481276 0.131444 133.23 156.60 1.006
r(G<->T){all} 0.164252 0.019284 0.000053 0.438871 0.128499 268.47 290.91 1.000
pi(A){all} 0.319793 0.002090 0.231743 0.409893 0.317760 1313.47 1321.49 1.000
pi(C){all} 0.242472 0.001729 0.161970 0.321794 0.240618 967.81 1097.91 1.000
pi(G){all} 0.280605 0.001918 0.196452 0.365995 0.279664 1143.78 1176.27 1.000
pi(T){all} 0.157130 0.001222 0.090783 0.224252 0.155541 1200.26 1300.58 1.000
alpha{1,2} 0.403241 0.217820 0.000104 1.353412 0.236805 1439.20 1454.50 1.000
alpha{3} 0.465495 0.271934 0.000179 1.480327 0.293446 1321.21 1374.46 1.000
pinvar{all} 0.980683 0.000592 0.934655 0.999996 0.988726 1036.23 1250.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -125.202773
Model 2: PositiveSelection -125.20278
Model 0: one-ratio -125.202783
Model 7: beta -125.202778
Model 8: beta&w>1 -125.202749
Model 0 vs 1 2.0000000006348273E-5
Model 2 vs 1 1.4000000021496817E-5
Model 8 vs 7 5.7999999995672624E-5
>C1
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C2
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C3
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C4
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C5
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C6
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=33
C1 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C2 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C3 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C4 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C5 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C6 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
*********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 33 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 33 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [990]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [990]--->[990]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.436 Mb, Max= 30.545 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C2 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C3 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C4 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C5 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
C6 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
*********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
C2 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
C3 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
C4 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
C5 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
C6 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
**************************************************
C1 GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
C2 GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
C3 GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
C4 GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
C5 GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
C6 GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
*************************************************
>C1
GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>C2
GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>C3
GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>C4
GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>C5
GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>C6
GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC
GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>C1
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C2
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C3
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C4
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C5
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
>C6
GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 99 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856655
Setting output file names to "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 538207499
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5982560740
Seed = 1604671471
Swapseed = 1579856655
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -221.566713 -- -24.965149
Chain 2 -- -221.566747 -- -24.965149
Chain 3 -- -221.566747 -- -24.965149
Chain 4 -- -221.566735 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -221.566735 -- -24.965149
Chain 2 -- -221.566713 -- -24.965149
Chain 3 -- -221.566747 -- -24.965149
Chain 4 -- -221.566735 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-221.567] (-221.567) (-221.567) (-221.567) * [-221.567] (-221.567) (-221.567) (-221.567)
500 -- (-151.729) (-145.438) (-142.568) [-144.618] * [-143.171] (-148.957) (-146.716) (-146.239) -- 0:00:00
1000 -- [-144.305] (-145.462) (-140.316) (-149.932) * (-142.722) (-154.410) (-144.941) [-145.811] -- 0:00:00
1500 -- [-139.962] (-143.933) (-143.877) (-145.243) * (-154.245) (-148.754) (-148.834) [-149.139] -- 0:00:00
2000 -- (-147.533) (-148.410) [-138.453] (-141.276) * (-151.667) [-141.196] (-146.165) (-145.372) -- 0:08:19
2500 -- (-143.398) (-149.079) (-144.035) [-141.826] * (-155.215) [-143.457] (-146.783) (-145.745) -- 0:06:39
3000 -- (-146.000) (-143.734) [-143.847] (-147.410) * (-154.534) [-140.834] (-150.534) (-147.188) -- 0:05:32
3500 -- (-145.334) (-140.267) [-141.871] (-140.688) * [-147.148] (-144.180) (-151.307) (-146.068) -- 0:04:44
4000 -- (-140.545) (-144.014) [-137.113] (-149.972) * (-144.898) [-147.921] (-140.157) (-138.683) -- 0:04:09
4500 -- (-136.291) (-145.706) (-153.856) [-143.066] * [-145.725] (-153.682) (-147.541) (-145.602) -- 0:03:41
5000 -- (-140.986) (-150.823) (-149.270) [-147.076] * [-143.676] (-153.953) (-146.111) (-146.397) -- 0:03:19
Average standard deviation of split frequencies: 0.068319
5500 -- (-138.520) [-146.265] (-148.475) (-144.089) * (-147.700) (-146.477) (-150.877) [-143.693] -- 0:03:00
6000 -- (-135.171) (-144.683) [-144.023] (-146.151) * (-144.092) (-145.992) [-143.360] (-144.521) -- 0:02:45
6500 -- [-137.401] (-149.240) (-149.214) (-144.880) * (-143.945) (-147.494) [-143.342] (-151.711) -- 0:02:32
7000 -- (-137.404) (-144.978) (-143.977) [-148.713] * (-142.427) [-148.466] (-154.306) (-150.553) -- 0:02:21
7500 -- [-135.108] (-144.712) (-150.045) (-140.911) * (-151.568) (-153.173) [-148.458] (-161.005) -- 0:02:12
8000 -- [-134.712] (-140.032) (-147.088) (-141.242) * (-157.483) [-150.369] (-144.316) (-151.057) -- 0:02:04
8500 -- (-135.081) (-145.155) (-158.285) [-136.941] * [-143.893] (-150.955) (-142.804) (-153.386) -- 0:01:56
9000 -- (-135.778) (-147.855) [-143.830] (-147.069) * (-152.287) (-149.268) (-150.052) [-143.470] -- 0:01:50
9500 -- (-137.752) (-148.367) (-147.292) [-148.628] * [-149.643] (-151.828) (-149.495) (-144.979) -- 0:01:44
10000 -- [-135.530] (-144.110) (-151.038) (-147.693) * (-149.046) [-149.270] (-145.201) (-140.707) -- 0:01:39
Average standard deviation of split frequencies: 0.071202
10500 -- (-137.096) (-144.519) [-151.633] (-145.538) * [-144.290] (-146.309) (-139.188) (-135.391) -- 0:01:34
11000 -- (-138.828) (-148.616) (-144.690) [-148.896] * (-152.434) (-145.147) (-141.962) [-135.149] -- 0:01:29
11500 -- (-137.055) [-146.654] (-136.923) (-143.265) * [-147.403] (-144.630) (-140.635) (-136.678) -- 0:01:25
12000 -- (-135.763) (-146.388) [-137.814] (-151.256) * (-147.608) (-139.338) (-138.035) [-138.938] -- 0:01:22
12500 -- (-135.262) [-144.434] (-138.271) (-144.309) * (-144.144) (-139.166) (-137.752) [-135.409] -- 0:01:19
13000 -- (-135.511) [-142.255] (-138.215) (-143.154) * (-139.208) (-136.584) [-134.745] (-136.162) -- 0:01:15
13500 -- (-136.579) (-158.375) [-137.964] (-138.889) * (-134.520) (-135.481) [-136.486] (-136.731) -- 0:01:13
14000 -- (-137.378) [-141.750] (-136.035) (-136.951) * (-138.034) [-136.159] (-135.055) (-137.622) -- 0:01:10
14500 -- [-137.687] (-146.169) (-136.458) (-135.617) * [-134.496] (-135.023) (-135.116) (-134.890) -- 0:01:07
15000 -- (-138.757) (-141.171) (-138.076) [-135.390] * (-134.892) (-136.129) [-134.748] (-137.781) -- 0:01:05
Average standard deviation of split frequencies: 0.057375
15500 -- (-137.224) [-136.020] (-138.697) (-136.735) * [-135.647] (-140.309) (-135.234) (-139.554) -- 0:01:03
16000 -- [-135.039] (-137.154) (-136.360) (-141.227) * [-135.323] (-141.349) (-135.072) (-136.457) -- 0:01:01
16500 -- [-134.823] (-135.004) (-136.487) (-139.988) * [-141.724] (-136.737) (-136.743) (-135.960) -- 0:00:59
17000 -- (-137.358) [-135.008] (-138.488) (-137.675) * [-140.365] (-134.206) (-136.466) (-137.916) -- 0:00:57
17500 -- (-137.302) [-135.531] (-137.664) (-139.553) * (-136.121) [-135.219] (-136.272) (-138.384) -- 0:00:56
18000 -- [-134.023] (-134.729) (-138.057) (-137.279) * (-136.835) [-135.292] (-135.488) (-135.061) -- 0:00:54
18500 -- (-135.570) (-136.824) [-139.762] (-137.460) * (-137.460) [-138.022] (-136.168) (-139.345) -- 0:00:53
19000 -- (-139.970) [-136.050] (-142.511) (-134.686) * [-138.338] (-138.216) (-135.137) (-136.788) -- 0:00:51
19500 -- (-141.844) [-136.392] (-136.474) (-135.235) * (-138.259) (-136.624) (-135.273) [-135.839] -- 0:01:40
20000 -- (-139.291) [-134.396] (-135.812) (-140.349) * (-134.480) (-136.770) [-135.205] (-135.908) -- 0:01:38
Average standard deviation of split frequencies: 0.062094
20500 -- (-134.419) (-135.689) [-136.025] (-136.708) * [-134.070] (-134.737) (-138.322) (-134.908) -- 0:01:35
21000 -- [-134.676] (-134.446) (-136.473) (-136.476) * (-135.778) [-134.593] (-136.397) (-135.804) -- 0:01:33
21500 -- (-136.559) [-136.065] (-136.006) (-134.756) * (-138.790) (-137.103) [-136.148] (-138.937) -- 0:01:31
22000 -- [-135.295] (-135.640) (-135.206) (-137.032) * (-138.015) [-135.557] (-135.968) (-140.697) -- 0:01:28
22500 -- (-135.971) (-135.172) [-135.116] (-134.864) * (-136.949) (-135.333) [-136.154] (-135.782) -- 0:01:26
23000 -- (-139.655) (-136.162) (-134.943) [-136.123] * (-135.512) (-135.099) [-138.147] (-136.485) -- 0:01:24
23500 -- [-136.424] (-134.237) (-134.543) (-135.975) * (-136.366) (-134.654) [-135.318] (-139.824) -- 0:01:23
24000 -- (-134.959) [-136.449] (-141.377) (-135.037) * [-136.257] (-137.454) (-134.710) (-140.192) -- 0:01:21
24500 -- (-136.215) [-137.903] (-137.716) (-134.762) * (-137.500) [-135.283] (-135.633) (-136.782) -- 0:01:19
25000 -- [-135.923] (-135.806) (-136.628) (-136.100) * (-135.522) (-134.487) (-137.913) [-136.799] -- 0:01:18
Average standard deviation of split frequencies: 0.039715
25500 -- (-135.547) [-135.782] (-136.004) (-134.947) * (-135.573) [-135.831] (-137.404) (-136.897) -- 0:01:16
26000 -- [-134.789] (-134.251) (-135.342) (-139.276) * (-135.850) [-134.484] (-142.028) (-142.421) -- 0:01:14
26500 -- (-135.789) [-135.099] (-135.482) (-136.293) * (-135.143) (-134.752) [-135.561] (-137.340) -- 0:01:13
27000 -- (-137.271) [-135.754] (-134.521) (-135.332) * (-136.043) [-134.697] (-135.852) (-137.673) -- 0:01:12
27500 -- (-134.045) [-137.023] (-138.505) (-140.670) * [-136.144] (-135.800) (-138.041) (-137.413) -- 0:01:10
28000 -- (-135.902) [-136.622] (-136.197) (-134.665) * (-138.492) [-134.904] (-135.224) (-135.376) -- 0:01:09
28500 -- [-136.950] (-135.960) (-136.595) (-136.312) * [-140.313] (-135.027) (-138.232) (-134.930) -- 0:01:08
29000 -- [-134.585] (-137.498) (-135.345) (-137.615) * (-136.793) [-135.806] (-138.215) (-139.746) -- 0:01:06
29500 -- [-137.323] (-137.278) (-136.998) (-136.195) * (-133.955) [-141.181] (-134.586) (-136.714) -- 0:01:05
30000 -- (-136.948) [-137.725] (-137.001) (-136.013) * [-135.086] (-143.223) (-134.592) (-137.318) -- 0:01:04
Average standard deviation of split frequencies: 0.035136
30500 -- (-136.574) [-135.568] (-134.359) (-136.991) * [-136.526] (-138.641) (-136.447) (-135.912) -- 0:01:03
31000 -- (-137.573) [-135.994] (-134.792) (-136.379) * [-136.889] (-138.385) (-137.172) (-135.747) -- 0:01:02
31500 -- [-135.451] (-134.897) (-139.334) (-137.461) * (-134.146) [-138.074] (-138.966) (-134.519) -- 0:01:01
32000 -- (-137.521) (-135.397) [-138.868] (-135.693) * (-135.600) (-134.707) [-135.860] (-137.218) -- 0:01:00
32500 -- (-135.672) (-135.804) (-140.275) [-136.527] * [-136.612] (-136.681) (-139.699) (-142.125) -- 0:00:59
33000 -- [-137.557] (-136.723) (-135.110) (-134.757) * (-135.498) [-136.149] (-139.948) (-142.791) -- 0:00:58
33500 -- (-137.887) (-134.655) [-134.981] (-136.555) * (-138.495) (-135.859) [-137.944] (-138.330) -- 0:00:57
34000 -- (-141.967) [-135.524] (-137.980) (-135.191) * (-137.683) (-135.507) (-141.898) [-140.136] -- 0:00:56
34500 -- (-136.107) (-139.912) (-136.872) [-136.147] * (-136.441) [-135.904] (-137.392) (-138.714) -- 0:00:55
35000 -- [-136.255] (-140.765) (-136.711) (-139.783) * (-138.958) [-135.710] (-137.743) (-135.167) -- 0:00:55
Average standard deviation of split frequencies: 0.039938
35500 -- (-139.007) (-136.035) (-137.614) [-136.701] * (-135.069) (-138.965) (-137.101) [-135.590] -- 0:00:54
36000 -- (-136.825) [-135.030] (-135.770) (-134.105) * [-134.171] (-140.366) (-139.060) (-135.530) -- 0:00:53
36500 -- [-134.439] (-139.900) (-134.958) (-139.549) * (-135.259) (-137.582) (-143.648) [-139.296] -- 0:00:52
37000 -- (-135.124) (-136.931) [-137.986] (-138.746) * (-135.822) [-134.236] (-140.199) (-135.998) -- 0:01:18
37500 -- (-137.420) [-134.901] (-136.221) (-144.374) * [-136.006] (-135.450) (-136.227) (-135.566) -- 0:01:17
38000 -- (-136.419) (-140.159) (-136.223) [-137.467] * (-136.284) (-139.730) (-135.630) [-135.181] -- 0:01:15
38500 -- (-141.004) (-135.255) [-136.252] (-138.774) * (-139.095) (-138.405) (-141.855) [-135.732] -- 0:01:14
39000 -- (-135.985) (-135.146) [-134.741] (-137.240) * [-135.251] (-140.020) (-142.259) (-136.523) -- 0:01:13
39500 -- (-134.684) [-134.688] (-140.669) (-136.230) * (-136.131) [-136.938] (-137.972) (-135.589) -- 0:01:12
40000 -- (-134.354) [-135.643] (-137.114) (-134.857) * (-136.842) (-143.341) (-137.939) [-135.240] -- 0:01:12
Average standard deviation of split frequencies: 0.043792
40500 -- (-137.369) [-134.449] (-138.130) (-136.910) * [-135.162] (-145.664) (-136.749) (-137.600) -- 0:01:11
41000 -- (-136.453) (-137.296) (-138.408) [-140.638] * [-136.447] (-135.667) (-136.278) (-135.247) -- 0:01:10
41500 -- (-137.688) [-137.203] (-134.299) (-135.344) * (-140.838) [-135.303] (-137.879) (-135.443) -- 0:01:09
42000 -- (-137.966) [-135.289] (-136.576) (-136.694) * (-138.770) [-134.739] (-138.120) (-134.214) -- 0:01:08
42500 -- (-134.385) (-135.298) (-136.838) [-139.351] * (-134.124) [-135.518] (-135.366) (-134.621) -- 0:01:07
43000 -- (-137.441) (-133.951) [-134.511] (-135.386) * (-136.292) (-136.022) (-138.028) [-136.863] -- 0:01:06
43500 -- (-137.253) [-135.628] (-133.923) (-135.457) * [-138.243] (-136.504) (-135.070) (-135.369) -- 0:01:05
44000 -- (-134.779) (-135.076) [-135.409] (-134.410) * (-135.739) [-136.560] (-137.754) (-135.347) -- 0:01:05
44500 -- [-135.072] (-134.888) (-134.561) (-137.690) * (-135.098) (-136.453) (-136.502) [-135.007] -- 0:01:04
45000 -- [-134.712] (-135.574) (-134.795) (-142.628) * (-139.214) (-135.912) [-138.523] (-137.170) -- 0:01:03
Average standard deviation of split frequencies: 0.033441
45500 -- [-136.184] (-137.292) (-135.520) (-135.458) * (-135.031) (-134.442) [-134.839] (-135.632) -- 0:01:02
46000 -- (-136.299) (-142.328) (-136.140) [-135.330] * (-137.030) [-136.280] (-135.772) (-136.359) -- 0:01:02
46500 -- (-136.629) (-135.446) [-135.162] (-134.710) * (-134.043) (-136.454) [-135.368] (-139.779) -- 0:01:01
47000 -- [-134.489] (-136.863) (-135.332) (-138.049) * [-135.988] (-137.913) (-135.716) (-137.759) -- 0:01:00
47500 -- (-134.719) (-134.730) (-139.934) [-135.397] * [-134.571] (-134.456) (-137.158) (-136.711) -- 0:01:00
48000 -- (-137.240) (-135.433) [-135.666] (-139.561) * (-134.740) (-136.139) (-143.681) [-141.317] -- 0:00:59
48500 -- (-139.602) (-134.532) (-134.982) [-137.049] * [-134.863] (-134.076) (-139.161) (-139.924) -- 0:00:58
49000 -- [-135.008] (-136.744) (-137.505) (-137.039) * (-137.116) (-137.660) [-141.509] (-150.204) -- 0:00:58
49500 -- (-135.631) (-136.708) [-136.148] (-135.015) * (-136.821) (-139.556) [-137.120] (-140.189) -- 0:00:57
50000 -- (-142.882) (-135.738) (-136.141) [-136.924] * (-139.541) (-136.006) [-135.224] (-136.496) -- 0:00:57
Average standard deviation of split frequencies: 0.027912
50500 -- (-141.799) [-137.347] (-134.676) (-140.539) * (-136.302) (-135.598) [-134.968] (-135.611) -- 0:00:56
51000 -- (-140.899) (-136.609) (-138.135) [-136.152] * [-135.720] (-136.392) (-134.812) (-135.294) -- 0:00:55
51500 -- (-135.992) [-139.657] (-136.917) (-135.434) * [-135.036] (-140.613) (-136.555) (-135.782) -- 0:00:55
52000 -- (-136.988) [-136.052] (-137.883) (-137.762) * (-134.052) [-137.533] (-135.363) (-139.975) -- 0:00:54
52500 -- (-136.306) (-134.367) (-137.837) [-134.915] * (-134.393) [-138.051] (-135.235) (-137.456) -- 0:00:54
53000 -- (-135.968) (-138.623) [-138.340] (-135.293) * (-135.224) (-134.157) (-139.531) [-138.920] -- 0:00:53
53500 -- (-134.512) (-135.870) [-135.903] (-136.288) * (-137.803) (-134.025) [-142.498] (-135.344) -- 0:00:53
54000 -- (-134.961) (-136.352) (-137.095) [-135.250] * (-136.732) [-135.554] (-136.438) (-137.117) -- 0:01:10
54500 -- (-135.557) [-134.401] (-135.593) (-139.004) * [-135.509] (-139.501) (-136.042) (-140.199) -- 0:01:09
55000 -- [-135.045] (-135.293) (-138.385) (-134.549) * [-135.993] (-135.602) (-135.837) (-136.345) -- 0:01:08
Average standard deviation of split frequencies: 0.031567
55500 -- (-139.415) (-137.082) [-135.066] (-137.930) * (-138.979) [-137.979] (-137.865) (-138.507) -- 0:01:08
56000 -- [-136.760] (-136.019) (-141.821) (-135.411) * (-135.936) (-138.887) (-139.923) [-136.066] -- 0:01:07
56500 -- (-140.130) (-137.721) (-137.470) [-136.568] * (-138.641) [-134.756] (-137.771) (-134.309) -- 0:01:06
57000 -- (-136.088) (-138.570) (-135.334) [-135.539] * [-137.588] (-135.852) (-138.054) (-134.196) -- 0:01:06
57500 -- (-140.966) (-136.978) (-134.855) [-135.325] * [-136.260] (-136.604) (-137.203) (-137.183) -- 0:01:05
58000 -- [-135.949] (-135.340) (-140.862) (-138.812) * (-135.085) (-137.721) [-134.566] (-134.523) -- 0:01:04
58500 -- [-138.220] (-134.827) (-134.194) (-136.162) * (-136.771) [-137.252] (-137.403) (-135.157) -- 0:01:04
59000 -- [-137.155] (-135.316) (-134.519) (-135.405) * (-136.491) [-134.849] (-136.759) (-136.998) -- 0:01:03
59500 -- (-135.468) [-135.969] (-135.107) (-134.718) * [-137.854] (-135.571) (-137.000) (-134.490) -- 0:01:03
60000 -- (-134.369) (-134.295) (-137.476) [-135.715] * (-139.477) [-134.405] (-136.582) (-135.302) -- 0:01:02
Average standard deviation of split frequencies: 0.030673
60500 -- (-135.876) (-137.725) (-136.549) [-135.210] * (-140.947) [-135.565] (-134.787) (-136.997) -- 0:01:02
61000 -- (-135.750) (-138.880) (-136.120) [-138.525] * [-137.152] (-135.823) (-137.115) (-136.514) -- 0:01:01
61500 -- (-135.177) (-134.419) (-134.072) [-140.642] * (-135.706) [-135.919] (-134.339) (-135.383) -- 0:01:01
62000 -- (-135.605) [-135.947] (-135.959) (-139.624) * (-135.056) [-135.759] (-135.415) (-139.818) -- 0:01:00
62500 -- (-135.519) (-135.174) (-135.456) [-136.880] * (-136.745) (-136.681) (-136.456) [-137.732] -- 0:01:00
63000 -- [-136.409] (-134.456) (-136.585) (-136.200) * [-135.938] (-136.896) (-135.556) (-137.341) -- 0:00:59
63500 -- (-136.224) [-135.420] (-136.701) (-136.052) * (-138.136) [-135.426] (-135.901) (-135.724) -- 0:00:58
64000 -- (-138.171) [-135.946] (-137.583) (-134.481) * [-135.549] (-134.519) (-135.301) (-136.503) -- 0:00:58
64500 -- (-138.485) (-140.732) (-140.100) [-135.931] * (-136.776) (-134.597) [-137.271] (-138.769) -- 0:00:58
65000 -- [-138.311] (-136.623) (-137.815) (-135.230) * [-135.459] (-137.716) (-139.153) (-135.442) -- 0:00:57
Average standard deviation of split frequencies: 0.024829
65500 -- [-142.100] (-143.418) (-135.948) (-140.396) * [-134.494] (-141.445) (-140.297) (-137.266) -- 0:00:57
66000 -- (-142.883) (-140.595) [-135.498] (-137.440) * (-135.762) [-139.126] (-136.403) (-134.627) -- 0:00:56
66500 -- (-137.076) (-135.559) [-135.445] (-135.049) * (-134.417) (-138.344) (-134.926) [-136.047] -- 0:00:56
67000 -- (-137.432) (-135.555) (-136.026) [-135.064] * (-134.542) (-135.985) [-135.451] (-137.626) -- 0:00:55
67500 -- (-139.363) (-136.150) (-136.197) [-136.878] * (-136.426) (-136.408) (-135.607) [-137.357] -- 0:00:55
68000 -- (-135.598) (-137.710) (-137.096) [-138.801] * (-137.369) [-140.118] (-134.540) (-138.226) -- 0:00:54
68500 -- (-136.722) (-138.403) [-135.624] (-136.871) * (-135.189) [-137.034] (-135.302) (-136.632) -- 0:00:54
69000 -- [-135.845] (-135.433) (-135.848) (-135.484) * (-134.519) (-135.621) [-137.252] (-137.889) -- 0:00:53
69500 -- (-134.404) [-134.827] (-135.676) (-136.403) * (-135.446) [-137.179] (-137.752) (-136.852) -- 0:00:53
70000 -- (-134.492) [-135.097] (-134.583) (-136.341) * (-139.023) (-134.413) (-137.352) [-136.179] -- 0:00:53
Average standard deviation of split frequencies: 0.022554
70500 -- (-135.371) [-138.426] (-144.613) (-139.370) * (-138.433) (-134.530) (-136.404) [-135.876] -- 0:00:52
71000 -- [-135.751] (-141.042) (-136.891) (-135.195) * (-141.703) [-134.743] (-138.084) (-138.381) -- 0:00:52
71500 -- (-137.187) (-147.596) [-136.125] (-135.315) * [-137.372] (-138.035) (-137.640) (-137.117) -- 0:01:04
72000 -- (-134.798) [-143.111] (-138.955) (-137.131) * (-136.907) (-135.079) (-142.174) [-139.772] -- 0:01:04
72500 -- [-135.710] (-139.796) (-142.440) (-135.458) * [-136.615] (-138.264) (-140.469) (-138.344) -- 0:01:03
73000 -- (-135.834) (-136.890) [-134.915] (-134.306) * (-134.934) (-135.410) (-139.829) [-139.040] -- 0:01:03
73500 -- (-137.666) (-135.759) [-135.711] (-136.959) * (-137.274) [-136.322] (-137.268) (-136.054) -- 0:01:03
74000 -- (-137.686) (-134.339) [-137.257] (-135.516) * [-136.947] (-137.750) (-140.789) (-138.228) -- 0:01:02
74500 -- [-137.410] (-137.311) (-136.416) (-134.630) * (-136.599) [-136.295] (-136.275) (-136.384) -- 0:01:02
75000 -- (-138.480) [-134.880] (-134.370) (-134.348) * (-135.031) (-138.125) (-136.482) [-136.372] -- 0:01:01
Average standard deviation of split frequencies: 0.021562
75500 -- (-138.262) [-135.991] (-135.694) (-135.103) * (-136.157) (-137.273) [-135.945] (-136.788) -- 0:01:01
76000 -- (-138.950) (-134.180) [-135.757] (-135.295) * [-135.085] (-135.336) (-135.955) (-136.236) -- 0:01:00
76500 -- (-135.642) [-135.298] (-135.218) (-138.623) * [-135.396] (-136.982) (-136.842) (-134.858) -- 0:01:00
77000 -- (-134.649) [-138.411] (-134.324) (-140.578) * [-137.167] (-136.160) (-135.454) (-135.099) -- 0:00:59
77500 -- [-135.440] (-139.284) (-136.454) (-139.255) * (-135.285) (-140.193) (-136.946) [-135.244] -- 0:00:59
78000 -- (-136.615) (-135.448) [-136.362] (-141.761) * (-134.774) [-137.182] (-137.692) (-135.719) -- 0:00:59
78500 -- [-134.697] (-135.114) (-136.700) (-136.220) * [-134.677] (-137.427) (-138.505) (-135.041) -- 0:00:58
79000 -- (-134.653) (-138.586) (-137.168) [-135.609] * (-137.659) (-134.944) [-137.362] (-143.839) -- 0:00:58
79500 -- (-137.503) (-134.823) (-136.440) [-137.362] * [-136.246] (-135.938) (-135.309) (-136.225) -- 0:00:57
80000 -- (-134.618) (-137.397) (-135.910) [-137.196] * (-137.530) (-135.852) (-135.507) [-137.706] -- 0:00:57
Average standard deviation of split frequencies: 0.020607
80500 -- (-135.897) [-134.584] (-134.711) (-136.021) * (-138.874) [-137.039] (-136.412) (-138.864) -- 0:00:57
81000 -- (-135.463) (-134.770) (-136.517) [-136.453] * [-136.567] (-136.091) (-139.269) (-136.290) -- 0:00:56
81500 -- (-135.348) [-135.963] (-137.697) (-135.848) * (-135.333) (-135.870) (-138.560) [-136.241] -- 0:00:56
82000 -- (-137.285) (-135.908) [-136.791] (-136.212) * (-135.087) [-144.209] (-136.379) (-136.423) -- 0:00:55
82500 -- (-137.593) [-135.760] (-134.172) (-138.195) * (-134.002) (-143.367) (-136.332) [-134.696] -- 0:00:55
83000 -- (-135.778) [-135.315] (-134.546) (-136.991) * (-137.356) (-141.576) (-137.790) [-138.566] -- 0:00:55
83500 -- (-135.879) (-136.449) (-135.549) [-134.955] * (-137.616) (-137.923) (-137.214) [-134.425] -- 0:00:54
84000 -- [-135.872] (-141.185) (-137.145) (-137.948) * [-136.296] (-134.994) (-137.383) (-134.167) -- 0:00:54
84500 -- (-136.276) (-137.970) (-134.841) [-135.146] * (-135.151) [-135.426] (-137.073) (-137.090) -- 0:00:54
85000 -- (-135.070) (-136.694) [-136.677] (-136.186) * (-136.547) [-137.212] (-135.879) (-135.427) -- 0:00:53
Average standard deviation of split frequencies: 0.020007
85500 -- [-136.482] (-135.630) (-135.477) (-135.805) * (-135.644) [-136.362] (-136.090) (-135.335) -- 0:00:53
86000 -- (-136.469) [-135.711] (-136.790) (-136.254) * (-135.992) (-136.565) [-137.799] (-134.961) -- 0:00:53
86500 -- (-135.198) [-136.391] (-136.652) (-135.938) * (-136.156) [-134.414] (-139.238) (-134.884) -- 0:00:52
87000 -- [-134.666] (-137.108) (-136.613) (-135.567) * (-135.191) (-135.097) [-135.611] (-135.393) -- 0:00:52
87500 -- [-134.335] (-135.071) (-136.659) (-140.690) * (-134.412) (-138.149) (-136.651) [-137.016] -- 0:00:52
88000 -- [-135.774] (-136.800) (-135.096) (-137.647) * (-135.051) [-138.494] (-136.313) (-135.516) -- 0:00:51
88500 -- (-137.094) [-136.885] (-139.100) (-137.163) * (-137.348) [-136.814] (-135.345) (-134.883) -- 0:01:01
89000 -- (-138.407) (-139.828) [-136.701] (-137.581) * (-135.890) (-135.444) (-134.928) [-136.484] -- 0:01:01
89500 -- [-136.097] (-136.690) (-134.169) (-137.316) * (-136.170) (-136.352) (-136.122) [-135.568] -- 0:01:01
90000 -- (-135.852) (-136.988) (-135.898) [-135.393] * (-135.300) (-138.814) [-135.537] (-140.052) -- 0:01:00
Average standard deviation of split frequencies: 0.018198
90500 -- (-135.240) (-139.072) (-136.181) [-135.964] * [-136.301] (-135.664) (-137.160) (-138.065) -- 0:01:00
91000 -- [-135.822] (-136.414) (-135.186) (-136.710) * (-137.495) (-136.406) [-136.630] (-141.830) -- 0:00:59
91500 -- (-134.717) [-136.739] (-137.660) (-135.318) * (-134.137) [-134.396] (-137.616) (-142.506) -- 0:00:59
92000 -- (-139.936) (-139.053) [-137.443] (-136.411) * (-136.771) (-135.644) [-134.652] (-138.475) -- 0:00:59
92500 -- (-139.106) (-136.308) (-140.945) [-136.568] * (-137.575) [-135.457] (-136.857) (-138.042) -- 0:00:58
93000 -- (-136.773) (-136.310) (-136.750) [-135.711] * (-138.647) [-136.890] (-136.388) (-138.349) -- 0:00:58
93500 -- (-139.777) [-135.326] (-136.641) (-137.424) * [-136.324] (-134.965) (-135.084) (-138.198) -- 0:00:58
94000 -- (-136.704) (-135.781) (-135.648) [-138.687] * (-136.286) (-136.527) (-135.256) [-135.881] -- 0:00:57
94500 -- (-135.305) (-135.200) (-141.777) [-136.063] * (-137.410) (-135.590) [-136.295] (-134.502) -- 0:00:57
95000 -- (-137.051) [-135.091] (-136.669) (-137.159) * (-135.894) (-134.665) (-136.230) [-135.895] -- 0:00:57
Average standard deviation of split frequencies: 0.021193
95500 -- (-136.814) [-137.092] (-139.566) (-135.757) * [-136.702] (-137.651) (-135.228) (-135.361) -- 0:00:56
96000 -- [-137.536] (-135.362) (-136.071) (-135.400) * (-135.992) (-136.896) (-134.554) [-135.774] -- 0:00:56
96500 -- (-139.504) [-137.810] (-134.947) (-134.994) * [-136.773] (-135.657) (-135.606) (-134.870) -- 0:00:56
97000 -- (-135.410) (-136.733) (-134.874) [-135.927] * (-134.655) (-138.077) [-134.232] (-137.908) -- 0:00:55
97500 -- (-134.755) (-136.826) (-137.763) [-138.159] * (-138.997) (-135.058) [-136.929] (-134.942) -- 0:00:55
98000 -- (-135.014) (-134.996) (-136.991) [-138.356] * (-135.560) (-136.313) [-136.239] (-136.908) -- 0:00:55
98500 -- (-133.937) (-134.752) [-138.000] (-141.382) * [-135.376] (-137.643) (-138.654) (-135.827) -- 0:00:54
99000 -- (-136.739) (-140.057) [-135.696] (-135.677) * [-135.161] (-140.845) (-140.289) (-138.949) -- 0:00:54
99500 -- (-137.468) (-138.698) (-136.365) [-138.793] * (-134.507) [-139.125] (-134.412) (-145.331) -- 0:00:54
100000 -- (-139.027) (-136.750) (-135.883) [-139.524] * (-135.682) (-137.187) [-136.406] (-138.939) -- 0:00:54
Average standard deviation of split frequencies: 0.022675
100500 -- [-136.320] (-134.357) (-136.583) (-136.777) * (-134.517) (-136.762) [-135.124] (-135.504) -- 0:00:53
101000 -- (-135.553) (-134.416) (-139.615) [-138.582] * (-134.914) [-135.322] (-140.129) (-137.312) -- 0:00:53
101500 -- (-136.147) [-135.140] (-137.725) (-136.752) * (-135.247) [-138.603] (-137.087) (-135.133) -- 0:00:53
102000 -- [-136.296] (-134.537) (-137.923) (-135.405) * [-135.949] (-134.610) (-135.098) (-135.903) -- 0:00:52
102500 -- [-134.465] (-137.142) (-134.826) (-135.596) * (-137.705) (-138.912) [-137.505] (-137.088) -- 0:00:52
103000 -- [-134.197] (-138.214) (-134.669) (-135.303) * (-136.955) (-136.732) (-136.684) [-135.287] -- 0:00:52
103500 -- (-140.852) (-139.192) [-137.402] (-135.361) * (-137.913) (-135.657) (-138.045) [-136.390] -- 0:00:51
104000 -- (-136.809) (-135.219) [-135.950] (-135.046) * (-138.193) (-136.061) (-139.117) [-135.325] -- 0:00:51
104500 -- (-135.209) (-137.346) (-139.778) [-136.757] * (-136.174) [-134.189] (-135.758) (-137.068) -- 0:00:51
105000 -- (-136.289) (-140.138) (-135.540) [-134.754] * (-134.611) [-138.468] (-136.430) (-134.740) -- 0:00:51
Average standard deviation of split frequencies: 0.020457
105500 -- [-136.036] (-135.376) (-137.621) (-136.958) * (-135.305) (-135.837) (-136.856) [-137.513] -- 0:00:59
106000 -- (-134.949) (-136.476) (-135.625) [-135.181] * (-135.419) (-134.983) (-134.443) [-139.720] -- 0:00:59
106500 -- (-135.360) [-137.413] (-138.438) (-136.880) * (-135.520) (-137.790) [-136.707] (-135.117) -- 0:00:58
107000 -- [-137.011] (-138.801) (-138.813) (-135.923) * [-141.651] (-135.676) (-138.375) (-135.976) -- 0:00:58
107500 -- (-137.618) [-136.594] (-135.305) (-137.323) * (-135.200) (-139.093) (-137.761) [-135.395] -- 0:00:58
108000 -- [-135.382] (-138.983) (-135.949) (-133.877) * (-136.264) [-138.436] (-138.087) (-136.818) -- 0:00:57
108500 -- [-136.962] (-139.811) (-135.036) (-139.512) * (-135.652) (-137.156) [-137.308] (-137.131) -- 0:00:57
109000 -- (-137.770) (-135.944) [-134.494] (-136.836) * (-135.423) (-140.149) (-135.680) [-135.635] -- 0:00:57
109500 -- (-136.629) (-137.519) [-135.232] (-135.433) * (-136.243) (-138.021) (-135.635) [-140.172] -- 0:00:56
110000 -- (-138.524) (-135.559) [-136.207] (-136.128) * [-134.866] (-136.836) (-137.265) (-138.802) -- 0:00:56
Average standard deviation of split frequencies: 0.021511
110500 -- (-137.736) (-137.001) (-134.632) [-136.538] * [-134.741] (-140.724) (-135.290) (-136.033) -- 0:00:56
111000 -- [-136.737] (-138.835) (-136.441) (-135.466) * (-134.473) (-136.898) [-137.916] (-138.311) -- 0:00:56
111500 -- (-135.942) (-135.349) (-138.360) [-134.642] * [-142.426] (-135.565) (-135.359) (-141.142) -- 0:00:55
112000 -- [-134.932] (-134.835) (-141.735) (-135.034) * (-135.851) (-135.975) [-135.414] (-140.142) -- 0:00:55
112500 -- (-137.521) (-135.653) (-137.100) [-134.825] * (-136.756) (-137.512) (-136.081) [-134.065] -- 0:00:55
113000 -- (-135.710) (-134.150) (-135.654) [-138.262] * (-134.812) (-136.171) [-135.709] (-136.216) -- 0:00:54
113500 -- (-134.153) (-137.954) (-136.853) [-138.320] * [-138.503] (-138.476) (-135.207) (-134.532) -- 0:00:54
114000 -- (-134.916) (-135.942) (-134.271) [-136.299] * (-137.080) [-136.094] (-139.915) (-135.681) -- 0:00:54
114500 -- (-135.822) (-135.970) [-137.534] (-135.817) * (-134.404) (-135.009) [-134.647] (-134.242) -- 0:00:54
115000 -- (-139.958) [-136.374] (-134.660) (-134.934) * (-134.872) (-134.421) (-138.079) [-134.963] -- 0:00:53
Average standard deviation of split frequencies: 0.019036
115500 -- (-146.151) (-135.887) (-134.245) [-135.960] * [-135.939] (-136.594) (-136.716) (-139.800) -- 0:00:53
116000 -- [-139.710] (-135.965) (-137.064) (-134.992) * (-139.482) [-135.535] (-136.270) (-136.049) -- 0:00:53
116500 -- [-137.194] (-137.331) (-134.096) (-138.409) * (-139.140) (-136.018) (-138.477) [-134.582] -- 0:00:53
117000 -- [-136.291] (-136.494) (-135.261) (-136.282) * [-137.705] (-136.586) (-138.429) (-134.946) -- 0:00:52
117500 -- [-137.931] (-137.363) (-136.119) (-135.720) * (-138.148) (-136.063) [-137.986] (-136.178) -- 0:00:52
118000 -- [-135.756] (-135.970) (-136.452) (-135.726) * (-135.667) [-140.866] (-136.196) (-136.735) -- 0:00:52
118500 -- (-135.837) (-134.691) (-134.054) [-136.629] * (-136.625) (-137.099) [-135.331] (-136.628) -- 0:00:52
119000 -- (-135.645) [-136.462] (-140.370) (-135.238) * (-135.282) (-137.210) (-136.217) [-135.893] -- 0:00:51
119500 -- (-135.430) (-134.884) [-134.068] (-134.982) * (-136.773) [-140.342] (-138.819) (-136.219) -- 0:00:51
120000 -- [-137.704] (-134.941) (-137.178) (-135.198) * [-134.725] (-134.983) (-136.776) (-136.402) -- 0:00:51
Average standard deviation of split frequencies: 0.020401
120500 -- (-139.214) (-134.886) (-134.549) [-134.500] * [-134.408] (-134.765) (-134.336) (-134.789) -- 0:00:51
121000 -- (-139.984) [-138.218] (-134.839) (-138.948) * (-134.250) (-135.678) (-135.527) [-138.999] -- 0:00:50
121500 -- (-137.444) (-134.627) [-135.459] (-140.611) * [-135.386] (-136.468) (-135.795) (-138.073) -- 0:00:50
122000 -- (-134.554) (-136.191) (-135.719) [-135.623] * [-135.798] (-135.801) (-135.682) (-141.678) -- 0:00:50
122500 -- (-137.945) [-135.351] (-140.022) (-134.698) * (-135.774) [-136.359] (-135.668) (-136.837) -- 0:00:57
123000 -- (-136.394) [-139.018] (-137.002) (-135.074) * (-136.233) [-134.882] (-134.708) (-137.086) -- 0:00:57
123500 -- [-136.899] (-140.153) (-135.316) (-138.055) * (-135.697) (-138.899) (-135.386) [-134.087] -- 0:00:56
124000 -- [-135.487] (-135.219) (-137.303) (-136.694) * (-135.490) (-136.717) (-135.438) [-136.318] -- 0:00:56
124500 -- [-140.877] (-134.891) (-137.924) (-137.309) * (-135.662) (-136.022) [-136.338] (-134.771) -- 0:00:56
125000 -- (-135.720) (-135.826) (-140.282) [-136.142] * (-134.478) [-138.055] (-134.647) (-134.836) -- 0:00:56
Average standard deviation of split frequencies: 0.019268
125500 -- (-134.826) [-137.535] (-137.604) (-136.435) * (-138.349) [-138.787] (-135.539) (-136.698) -- 0:00:55
126000 -- (-136.352) [-134.115] (-137.043) (-134.775) * [-134.982] (-136.351) (-141.229) (-136.816) -- 0:00:55
126500 -- (-136.908) (-134.400) (-135.629) [-134.613] * [-135.317] (-134.276) (-136.685) (-136.629) -- 0:00:55
127000 -- (-137.182) [-135.716] (-137.529) (-134.298) * [-138.198] (-138.183) (-138.036) (-135.049) -- 0:00:54
127500 -- (-138.081) [-137.120] (-137.564) (-137.177) * (-139.716) (-136.990) (-135.798) [-136.695] -- 0:00:54
128000 -- [-145.548] (-137.660) (-135.037) (-138.928) * (-140.134) [-138.472] (-138.385) (-135.558) -- 0:00:54
128500 -- (-144.783) (-137.311) [-138.627] (-134.946) * [-136.425] (-134.319) (-135.404) (-137.783) -- 0:00:54
129000 -- (-135.252) (-139.426) (-137.086) [-138.657] * [-136.534] (-134.095) (-134.469) (-137.847) -- 0:00:54
129500 -- (-136.251) [-136.161] (-138.286) (-136.370) * [-134.937] (-135.032) (-136.372) (-138.826) -- 0:00:53
130000 -- (-137.078) (-137.583) [-137.222] (-134.540) * [-135.725] (-134.634) (-138.414) (-135.512) -- 0:00:53
Average standard deviation of split frequencies: 0.020844
130500 -- [-137.783] (-138.416) (-135.982) (-135.146) * [-136.876] (-136.520) (-141.205) (-136.504) -- 0:00:53
131000 -- (-134.790) (-138.859) (-135.476) [-135.840] * (-136.681) [-136.903] (-138.101) (-137.225) -- 0:00:53
131500 -- (-136.103) (-135.973) [-134.768] (-135.984) * (-135.791) (-137.125) (-139.364) [-135.080] -- 0:00:52
132000 -- (-137.295) [-136.559] (-138.069) (-140.395) * [-136.424] (-134.877) (-135.288) (-137.237) -- 0:00:52
132500 -- (-138.699) (-137.138) [-137.010] (-138.727) * [-134.929] (-136.581) (-138.466) (-135.929) -- 0:00:52
133000 -- [-135.175] (-136.086) (-138.544) (-141.655) * [-135.510] (-136.556) (-137.239) (-137.521) -- 0:00:52
133500 -- [-134.236] (-136.261) (-138.649) (-137.152) * (-135.793) [-136.618] (-136.465) (-136.495) -- 0:00:51
134000 -- (-135.443) (-134.373) (-136.245) [-137.880] * (-137.216) (-134.485) [-139.286] (-135.745) -- 0:00:51
134500 -- (-134.393) (-137.781) [-134.624] (-136.797) * [-136.020] (-137.470) (-136.805) (-139.971) -- 0:00:51
135000 -- (-135.262) [-135.615] (-134.121) (-139.158) * (-134.652) [-136.206] (-136.158) (-137.147) -- 0:00:51
Average standard deviation of split frequencies: 0.020990
135500 -- [-135.540] (-136.700) (-136.854) (-136.236) * (-136.000) (-135.834) [-135.883] (-134.484) -- 0:00:51
136000 -- (-136.898) (-135.888) (-135.032) [-137.145] * (-135.326) (-136.647) (-137.213) [-135.197] -- 0:00:50
136500 -- (-135.956) [-137.534] (-137.323) (-137.501) * (-134.895) (-136.140) (-134.602) [-136.403] -- 0:00:50
137000 -- (-134.614) (-139.114) [-136.042] (-137.185) * (-134.433) (-135.634) [-135.304] (-139.091) -- 0:00:50
137500 -- (-137.951) (-135.322) [-135.922] (-135.346) * (-136.500) (-136.318) (-134.988) [-134.529] -- 0:00:50
138000 -- (-136.805) (-137.179) [-135.697] (-135.439) * (-135.018) (-135.341) [-134.577] (-136.336) -- 0:00:49
138500 -- (-135.052) (-138.221) (-138.422) [-134.893] * [-135.030] (-137.758) (-136.619) (-135.490) -- 0:00:49
139000 -- (-136.851) [-140.700] (-135.276) (-137.030) * [-138.709] (-135.888) (-135.445) (-137.652) -- 0:00:49
139500 -- (-138.142) (-140.270) [-137.840] (-136.172) * (-137.723) (-138.888) (-134.787) [-135.394] -- 0:00:55
140000 -- (-135.032) [-137.048] (-137.721) (-137.525) * (-136.477) [-136.839] (-134.541) (-136.798) -- 0:00:55
Average standard deviation of split frequencies: 0.020107
140500 -- (-135.410) [-142.661] (-140.826) (-141.199) * (-136.564) [-136.728] (-137.090) (-137.409) -- 0:00:55
141000 -- [-135.115] (-134.406) (-142.122) (-141.273) * (-139.941) (-135.807) (-136.340) [-136.794] -- 0:00:54
141500 -- (-134.974) (-136.911) (-137.045) [-139.529] * (-135.222) [-134.506] (-135.369) (-135.259) -- 0:00:54
142000 -- (-137.634) (-136.194) (-138.269) [-138.353] * (-137.033) (-137.763) [-135.033] (-136.032) -- 0:00:54
142500 -- (-134.764) [-136.022] (-135.212) (-139.998) * (-136.435) (-136.394) [-136.365] (-136.521) -- 0:00:54
143000 -- [-134.695] (-136.605) (-140.040) (-137.766) * (-138.944) [-136.092] (-135.392) (-135.664) -- 0:00:53
143500 -- (-134.998) [-134.808] (-134.793) (-138.484) * (-135.775) (-134.880) (-135.215) [-136.754] -- 0:00:53
144000 -- (-136.897) [-135.826] (-136.726) (-137.861) * [-135.756] (-142.655) (-134.389) (-135.059) -- 0:00:53
144500 -- (-138.479) [-134.667] (-137.192) (-135.894) * (-134.974) (-137.264) (-136.179) [-136.393] -- 0:00:53
145000 -- (-137.436) (-134.894) [-136.179] (-137.462) * [-137.986] (-135.369) (-134.999) (-137.915) -- 0:00:53
Average standard deviation of split frequencies: 0.018013
145500 -- (-134.519) (-135.266) (-137.064) [-134.270] * (-139.422) (-135.508) (-135.679) [-135.347] -- 0:00:52
146000 -- (-136.216) [-136.714] (-134.791) (-136.087) * (-137.007) (-135.716) (-135.179) [-138.403] -- 0:00:52
146500 -- (-135.387) [-134.541] (-135.666) (-134.647) * (-136.194) [-135.126] (-136.096) (-138.259) -- 0:00:52
147000 -- [-135.095] (-135.035) (-134.642) (-136.704) * [-138.409] (-139.029) (-134.515) (-135.745) -- 0:00:52
147500 -- (-136.920) (-136.481) (-134.715) [-136.871] * (-136.206) [-136.996] (-135.099) (-141.744) -- 0:00:52
148000 -- (-136.717) (-138.334) [-134.970] (-140.065) * (-135.902) (-139.503) (-136.218) [-140.432] -- 0:00:51
148500 -- (-138.727) (-138.109) [-135.750] (-135.774) * [-135.945] (-139.943) (-139.703) (-135.417) -- 0:00:51
149000 -- (-138.484) [-135.541] (-134.574) (-134.801) * (-134.536) (-138.237) (-135.752) [-134.676] -- 0:00:51
149500 -- (-137.655) (-140.052) [-135.318] (-133.954) * (-137.065) (-136.276) [-136.694] (-135.800) -- 0:00:51
150000 -- [-136.194] (-137.985) (-134.886) (-139.892) * (-136.009) (-134.362) (-135.135) [-142.054] -- 0:00:51
Average standard deviation of split frequencies: 0.018114
150500 -- (-136.345) (-137.446) [-134.976] (-140.178) * [-136.332] (-134.924) (-135.302) (-135.570) -- 0:00:50
151000 -- (-135.267) [-134.814] (-135.743) (-136.539) * [-138.410] (-137.319) (-136.172) (-136.845) -- 0:00:50
151500 -- (-135.830) [-135.842] (-134.478) (-139.733) * [-136.692] (-136.946) (-137.937) (-137.606) -- 0:00:50
152000 -- [-137.092] (-135.745) (-135.782) (-139.827) * (-135.196) (-137.089) [-135.741] (-136.457) -- 0:00:50
152500 -- (-136.068) (-134.553) [-135.054] (-137.466) * (-136.118) (-138.742) (-136.332) [-138.478] -- 0:00:50
153000 -- (-134.293) [-135.881] (-136.568) (-140.533) * (-135.713) (-137.379) (-137.740) [-136.664] -- 0:00:49
153500 -- (-134.724) [-136.091] (-135.872) (-137.695) * (-137.309) (-140.530) (-138.022) [-134.237] -- 0:00:49
154000 -- [-136.435] (-136.683) (-135.229) (-135.551) * (-135.934) (-137.919) (-136.477) [-136.551] -- 0:00:49
154500 -- (-137.270) (-136.842) [-136.896] (-135.709) * (-136.276) (-136.930) (-135.573) [-136.131] -- 0:00:49
155000 -- (-138.483) [-136.356] (-133.933) (-135.467) * [-137.204] (-134.775) (-136.299) (-136.680) -- 0:00:49
Average standard deviation of split frequencies: 0.016284
155500 -- (-135.585) [-138.977] (-135.100) (-140.966) * (-141.469) (-136.909) (-135.948) [-138.953] -- 0:00:48
156000 -- (-136.223) [-139.472] (-139.795) (-138.668) * (-149.117) (-135.782) (-141.924) [-134.251] -- 0:00:48
156500 -- (-136.993) (-134.919) (-134.918) [-138.886] * (-141.916) (-135.856) (-137.057) [-134.621] -- 0:00:53
157000 -- (-135.495) (-136.092) [-140.580] (-138.260) * (-139.200) (-134.545) (-135.258) [-135.697] -- 0:00:53
157500 -- [-136.017] (-136.803) (-141.478) (-135.408) * [-137.682] (-136.367) (-136.771) (-136.332) -- 0:00:53
158000 -- (-136.391) (-138.379) (-135.394) [-136.641] * (-134.655) [-135.323] (-136.232) (-140.167) -- 0:00:53
158500 -- (-135.593) (-137.162) (-136.328) [-135.427] * [-136.108] (-136.913) (-139.694) (-135.041) -- 0:00:53
159000 -- [-134.915] (-137.634) (-137.722) (-135.111) * (-135.315) (-135.566) [-137.205] (-136.761) -- 0:00:52
159500 -- [-134.648] (-135.671) (-137.847) (-135.666) * (-134.920) (-134.692) [-136.444] (-135.836) -- 0:00:52
160000 -- (-134.036) (-134.958) (-135.381) [-134.757] * (-136.134) [-135.145] (-137.799) (-137.213) -- 0:00:52
Average standard deviation of split frequencies: 0.015322
160500 -- (-134.897) (-137.305) (-135.364) [-137.163] * [-134.637] (-135.643) (-137.318) (-134.552) -- 0:00:52
161000 -- (-134.650) (-136.123) (-134.496) [-136.677] * [-135.869] (-135.701) (-137.003) (-135.088) -- 0:00:52
161500 -- (-135.462) (-137.730) (-135.584) [-135.819] * [-135.260] (-137.795) (-138.556) (-135.865) -- 0:00:51
162000 -- (-138.617) [-136.283] (-135.014) (-137.657) * (-134.907) (-135.149) [-138.229] (-135.796) -- 0:00:51
162500 -- (-136.579) (-140.136) (-134.432) [-139.469] * (-135.319) (-136.280) (-138.262) [-135.399] -- 0:00:51
163000 -- (-134.406) (-137.980) [-135.772] (-136.630) * [-137.121] (-136.526) (-137.964) (-136.529) -- 0:00:51
163500 -- (-134.906) [-137.852] (-135.550) (-135.238) * (-137.547) (-136.891) (-137.226) [-135.938] -- 0:00:51
164000 -- [-135.406] (-135.034) (-136.335) (-137.460) * (-136.259) (-138.849) [-134.247] (-134.939) -- 0:00:50
164500 -- (-134.400) (-137.256) (-145.137) [-134.705] * (-136.690) (-136.452) (-134.965) [-135.080] -- 0:00:50
165000 -- [-134.655] (-136.791) (-141.016) (-136.537) * (-137.767) (-144.799) [-139.298] (-136.391) -- 0:00:50
Average standard deviation of split frequencies: 0.015686
165500 -- [-137.072] (-136.998) (-136.922) (-135.329) * (-136.975) (-137.615) (-136.435) [-140.395] -- 0:00:50
166000 -- (-135.869) [-135.874] (-136.422) (-136.934) * [-136.532] (-140.215) (-136.898) (-137.882) -- 0:00:50
166500 -- (-138.815) [-136.268] (-135.181) (-136.026) * (-136.078) (-135.396) [-138.204] (-135.369) -- 0:00:50
167000 -- (-140.950) [-136.371] (-135.187) (-137.825) * (-138.632) (-135.141) (-135.262) [-137.017] -- 0:00:49
167500 -- (-136.121) (-134.492) [-135.822] (-137.133) * [-134.661] (-134.987) (-137.045) (-134.886) -- 0:00:49
168000 -- (-135.292) (-136.025) [-135.022] (-134.337) * (-134.717) (-136.576) [-134.290] (-139.692) -- 0:00:49
168500 -- (-139.234) (-139.257) (-136.481) [-136.321] * (-134.962) [-135.224] (-135.007) (-137.686) -- 0:00:49
169000 -- (-138.099) [-137.026] (-140.432) (-135.278) * (-136.638) (-134.982) [-139.768] (-138.183) -- 0:00:49
169500 -- (-136.893) [-135.835] (-137.857) (-137.446) * (-137.862) (-136.308) [-138.346] (-134.663) -- 0:00:48
170000 -- (-135.310) [-134.983] (-134.963) (-135.861) * [-134.951] (-139.706) (-136.470) (-137.023) -- 0:00:48
Average standard deviation of split frequencies: 0.014828
170500 -- [-136.607] (-137.902) (-139.455) (-134.498) * (-137.625) (-142.231) [-135.875] (-134.917) -- 0:00:48
171000 -- (-135.594) [-136.559] (-135.640) (-135.908) * (-137.828) (-139.413) [-135.422] (-134.804) -- 0:00:48
171500 -- (-135.990) (-135.969) [-135.995] (-137.884) * [-137.211] (-137.004) (-134.646) (-136.163) -- 0:00:48
172000 -- [-135.658] (-134.416) (-140.634) (-136.162) * (-136.181) [-138.630] (-136.068) (-141.357) -- 0:00:48
172500 -- [-137.238] (-135.613) (-140.666) (-136.392) * (-136.576) (-136.598) [-136.686] (-134.837) -- 0:00:47
173000 -- (-139.142) (-139.277) [-135.886] (-136.507) * (-136.376) (-137.009) (-137.820) [-135.643] -- 0:00:47
173500 -- (-135.830) (-137.174) (-134.916) [-139.027] * (-136.760) [-135.138] (-139.437) (-135.919) -- 0:00:52
174000 -- (-136.000) (-135.801) (-134.061) [-138.883] * [-138.360] (-136.635) (-136.578) (-140.886) -- 0:00:52
174500 -- [-137.965] (-135.589) (-134.352) (-136.572) * (-137.191) (-134.686) (-135.011) [-138.468] -- 0:00:52
175000 -- [-141.699] (-137.314) (-135.005) (-136.128) * (-136.214) (-134.004) (-135.921) [-138.968] -- 0:00:51
Average standard deviation of split frequencies: 0.016815
175500 -- (-137.145) [-135.781] (-136.378) (-138.468) * (-137.923) [-135.572] (-136.081) (-136.168) -- 0:00:51
176000 -- [-134.774] (-135.723) (-138.247) (-138.205) * (-135.285) [-136.033] (-139.798) (-136.664) -- 0:00:51
176500 -- (-136.921) [-136.600] (-134.913) (-136.538) * (-142.301) (-135.677) [-136.902] (-135.237) -- 0:00:51
177000 -- (-134.778) (-136.455) [-138.189] (-135.492) * (-137.140) (-138.224) [-135.123] (-137.507) -- 0:00:51
177500 -- (-135.574) [-135.292] (-137.358) (-135.935) * (-136.210) [-135.335] (-134.371) (-140.505) -- 0:00:50
178000 -- [-135.385] (-135.612) (-137.131) (-135.053) * (-137.446) (-138.838) [-135.092] (-135.917) -- 0:00:50
178500 -- [-134.467] (-139.425) (-137.244) (-137.467) * (-136.904) [-136.568] (-136.838) (-138.404) -- 0:00:50
179000 -- [-136.898] (-136.897) (-134.137) (-136.003) * (-136.813) (-136.198) (-138.180) [-136.360] -- 0:00:50
179500 -- (-135.971) (-134.495) [-134.785] (-139.722) * (-136.349) (-137.240) (-135.507) [-135.598] -- 0:00:50
180000 -- (-138.745) [-135.488] (-134.332) (-142.338) * [-134.839] (-137.258) (-135.514) (-135.373) -- 0:00:50
Average standard deviation of split frequencies: 0.017685
180500 -- (-137.932) [-135.142] (-138.061) (-140.303) * (-135.198) [-135.378] (-137.084) (-135.877) -- 0:00:49
181000 -- [-139.860] (-135.994) (-134.684) (-141.676) * (-137.089) [-134.387] (-140.877) (-135.923) -- 0:00:49
181500 -- (-138.844) [-135.590] (-138.398) (-144.706) * (-137.026) [-136.773] (-141.366) (-134.784) -- 0:00:49
182000 -- (-135.338) (-136.794) [-136.370] (-139.702) * (-140.543) [-136.663] (-139.826) (-134.607) -- 0:00:49
182500 -- (-136.545) (-136.114) (-138.494) [-140.364] * (-138.151) (-134.143) (-135.157) [-138.505] -- 0:00:49
183000 -- (-137.085) (-135.799) [-136.935] (-139.316) * (-138.472) (-137.689) [-134.476] (-144.472) -- 0:00:49
183500 -- (-134.947) (-136.390) (-134.290) [-133.927] * [-135.664] (-135.870) (-136.002) (-146.120) -- 0:00:48
184000 -- (-135.824) (-138.920) [-135.600] (-137.758) * (-138.117) [-137.436] (-134.352) (-139.526) -- 0:00:48
184500 -- (-137.383) (-137.257) [-134.139] (-139.371) * (-135.626) (-137.033) [-135.991] (-136.462) -- 0:00:48
185000 -- (-135.419) [-137.027] (-136.207) (-136.387) * (-138.939) [-135.459] (-134.371) (-135.130) -- 0:00:48
Average standard deviation of split frequencies: 0.017474
185500 -- (-135.678) (-134.839) [-136.791] (-134.977) * [-136.508] (-134.240) (-134.955) (-137.262) -- 0:00:48
186000 -- (-135.648) (-134.375) [-136.104] (-137.788) * (-135.364) [-140.759] (-135.345) (-135.267) -- 0:00:48
186500 -- (-135.915) (-135.031) (-134.947) [-134.678] * (-136.690) [-135.812] (-137.278) (-136.747) -- 0:00:47
187000 -- (-134.729) (-135.884) (-137.770) [-134.577] * (-134.517) (-137.211) (-138.411) [-135.642] -- 0:00:47
187500 -- (-135.607) (-136.658) [-135.679] (-134.424) * (-135.371) (-136.711) (-139.004) [-136.764] -- 0:00:47
188000 -- [-137.259] (-138.446) (-135.552) (-137.023) * [-134.642] (-135.740) (-134.995) (-137.604) -- 0:00:47
188500 -- (-135.342) (-136.992) [-134.109] (-138.429) * [-137.042] (-136.302) (-134.204) (-137.662) -- 0:00:47
189000 -- (-136.690) (-136.577) [-134.323] (-135.570) * (-134.279) (-135.220) [-135.074] (-135.197) -- 0:00:47
189500 -- (-139.604) (-135.939) (-136.121) [-135.481] * (-137.207) [-137.655] (-137.517) (-135.436) -- 0:00:47
190000 -- (-135.395) (-136.366) [-135.725] (-136.601) * (-136.284) (-137.111) (-135.032) [-135.329] -- 0:00:46
Average standard deviation of split frequencies: 0.016620
190500 -- (-137.634) [-134.418] (-137.252) (-136.510) * (-137.449) (-135.107) (-137.197) [-135.562] -- 0:00:50
191000 -- (-137.951) (-141.943) (-136.922) [-136.650] * (-135.153) (-134.888) (-135.680) [-137.195] -- 0:00:50
191500 -- (-139.383) (-140.084) [-135.222] (-136.628) * [-135.196] (-136.042) (-140.135) (-134.722) -- 0:00:50
192000 -- [-134.792] (-139.085) (-135.452) (-134.991) * [-134.536] (-137.487) (-144.372) (-136.820) -- 0:00:50
192500 -- (-135.210) [-134.456] (-134.810) (-135.876) * [-137.437] (-137.207) (-135.826) (-140.903) -- 0:00:50
193000 -- (-135.532) [-135.941] (-134.852) (-134.637) * (-137.211) [-138.290] (-134.511) (-135.299) -- 0:00:50
193500 -- (-137.106) [-137.040] (-135.055) (-134.650) * (-135.629) (-140.386) (-136.244) [-134.975] -- 0:00:50
194000 -- [-137.237] (-136.061) (-134.768) (-136.829) * [-134.773] (-135.882) (-136.500) (-137.724) -- 0:00:49
194500 -- (-138.682) [-136.587] (-135.891) (-139.351) * [-135.252] (-134.857) (-134.483) (-140.666) -- 0:00:49
195000 -- (-134.927) [-135.243] (-135.315) (-138.469) * (-135.604) (-138.461) (-136.170) [-137.950] -- 0:00:49
Average standard deviation of split frequencies: 0.016969
195500 -- (-134.505) (-138.381) (-137.194) [-136.252] * (-141.897) (-140.562) [-135.762] (-135.355) -- 0:00:49
196000 -- [-135.258] (-135.493) (-135.567) (-138.627) * [-137.564] (-138.538) (-136.331) (-137.728) -- 0:00:49
196500 -- (-134.515) (-134.406) (-137.349) [-135.449] * (-136.706) (-135.052) (-136.280) [-134.847] -- 0:00:49
197000 -- (-135.941) (-137.284) [-135.933] (-140.993) * (-135.172) (-134.081) (-138.037) [-136.373] -- 0:00:48
197500 -- [-135.284] (-136.977) (-139.365) (-137.265) * [-136.185] (-135.270) (-134.407) (-137.118) -- 0:00:48
198000 -- (-136.374) (-135.603) (-136.463) [-137.072] * (-135.190) (-135.697) [-134.867] (-134.471) -- 0:00:48
198500 -- (-135.536) (-139.589) (-134.745) [-135.811] * (-136.731) [-134.442] (-134.265) (-134.914) -- 0:00:48
199000 -- (-136.026) (-137.106) (-134.657) [-138.441] * (-138.827) (-136.086) (-139.852) [-137.717] -- 0:00:48
199500 -- (-138.531) (-134.350) [-136.011] (-138.091) * (-136.263) (-138.571) (-140.668) [-136.829] -- 0:00:48
200000 -- (-140.705) (-135.468) [-137.869] (-136.787) * (-137.051) (-135.295) (-135.244) [-137.187] -- 0:00:48
Average standard deviation of split frequencies: 0.016859
200500 -- (-134.971) (-134.991) [-136.705] (-135.265) * [-136.705] (-135.922) (-135.963) (-138.825) -- 0:00:47
201000 -- [-135.721] (-136.127) (-139.355) (-134.662) * (-135.540) (-135.247) [-135.937] (-135.985) -- 0:00:47
201500 -- (-134.301) (-136.204) (-137.199) [-136.356] * (-134.992) [-137.923] (-135.551) (-136.072) -- 0:00:47
202000 -- [-137.057] (-137.999) (-143.517) (-136.328) * (-138.212) [-137.654] (-135.114) (-137.355) -- 0:00:47
202500 -- (-136.853) (-134.116) (-142.781) [-138.820] * [-136.620] (-136.257) (-134.439) (-134.586) -- 0:00:47
203000 -- (-135.905) (-137.110) (-138.017) [-136.658] * (-137.124) [-136.260] (-138.384) (-140.276) -- 0:00:47
203500 -- [-137.373] (-138.149) (-137.047) (-136.206) * (-136.294) (-134.735) [-138.175] (-138.808) -- 0:00:46
204000 -- [-136.397] (-134.546) (-135.239) (-134.663) * [-135.005] (-135.280) (-135.232) (-139.710) -- 0:00:46
204500 -- (-134.875) [-137.592] (-134.465) (-134.790) * [-135.131] (-135.256) (-136.752) (-136.566) -- 0:00:46
205000 -- (-134.217) (-136.943) (-137.647) [-136.410] * [-135.956] (-136.473) (-135.654) (-137.314) -- 0:00:46
Average standard deviation of split frequencies: 0.015480
205500 -- (-136.523) (-136.666) (-137.958) [-139.422] * (-136.559) (-135.542) [-139.432] (-137.387) -- 0:00:46
206000 -- (-134.718) [-136.066] (-138.021) (-135.631) * [-134.803] (-135.360) (-138.218) (-137.510) -- 0:00:46
206500 -- (-135.663) (-137.985) (-135.168) [-135.554] * [-134.483] (-135.285) (-139.043) (-134.050) -- 0:00:46
207000 -- [-134.478] (-134.871) (-135.412) (-136.033) * (-135.861) (-134.511) (-139.638) [-136.986] -- 0:00:49
207500 -- (-136.779) (-139.005) (-136.060) [-134.569] * [-135.606] (-134.059) (-138.135) (-136.802) -- 0:00:49
208000 -- (-137.219) [-135.465] (-134.902) (-136.658) * (-135.993) (-135.875) (-140.407) [-137.023] -- 0:00:49
208500 -- (-140.148) [-135.256] (-136.795) (-141.504) * (-140.667) (-134.438) (-135.597) [-135.314] -- 0:00:49
209000 -- (-134.481) (-138.979) [-135.763] (-138.351) * (-136.328) (-135.626) [-137.547] (-137.233) -- 0:00:49
209500 -- (-137.300) [-137.437] (-135.531) (-142.934) * (-139.178) (-137.150) (-140.743) [-136.200] -- 0:00:49
210000 -- (-138.213) [-136.928] (-135.401) (-141.131) * (-137.207) [-134.887] (-134.597) (-139.614) -- 0:00:48
Average standard deviation of split frequencies: 0.016190
210500 -- [-137.117] (-135.872) (-135.865) (-138.129) * (-136.923) (-140.390) (-135.998) [-139.164] -- 0:00:48
211000 -- (-138.468) (-141.371) [-140.778] (-140.083) * [-135.690] (-136.979) (-135.733) (-135.152) -- 0:00:48
211500 -- (-134.451) [-136.947] (-136.000) (-139.828) * (-134.417) (-136.539) (-135.849) [-134.839] -- 0:00:48
212000 -- (-138.431) (-138.027) [-136.112] (-135.364) * (-136.794) (-139.197) (-138.313) [-139.584] -- 0:00:48
212500 -- (-137.173) [-138.241] (-135.179) (-136.034) * [-136.013] (-135.336) (-137.353) (-137.128) -- 0:00:48
213000 -- [-135.053] (-139.834) (-135.867) (-138.011) * [-137.408] (-136.123) (-139.150) (-134.823) -- 0:00:48
213500 -- (-134.668) (-142.047) [-136.134] (-135.990) * (-136.382) [-135.335] (-135.593) (-135.310) -- 0:00:47
214000 -- [-136.078] (-137.793) (-135.564) (-134.299) * (-134.004) (-136.778) (-136.708) [-134.656] -- 0:00:47
214500 -- (-134.999) (-138.227) (-137.399) [-134.447] * (-139.172) [-134.046] (-135.482) (-134.915) -- 0:00:47
215000 -- (-136.384) (-139.684) (-134.821) [-141.461] * (-137.413) (-135.910) (-135.589) [-135.927] -- 0:00:47
Average standard deviation of split frequencies: 0.015791
215500 -- [-137.176] (-141.402) (-135.599) (-134.519) * (-135.963) (-137.261) [-134.503] (-142.440) -- 0:00:47
216000 -- (-136.043) [-134.853] (-136.713) (-136.417) * [-136.207] (-135.640) (-138.342) (-137.533) -- 0:00:47
216500 -- (-139.220) (-135.785) [-135.121] (-135.697) * [-136.602] (-139.189) (-138.860) (-137.398) -- 0:00:47
217000 -- (-139.886) [-137.401] (-135.012) (-135.954) * (-134.949) [-138.652] (-137.552) (-140.442) -- 0:00:46
217500 -- (-136.598) (-134.658) [-136.368] (-133.882) * (-139.523) [-136.521] (-141.366) (-137.473) -- 0:00:46
218000 -- (-136.161) (-137.345) [-136.688] (-134.379) * [-136.523] (-136.872) (-134.383) (-135.829) -- 0:00:46
218500 -- (-139.834) (-136.284) [-137.184] (-138.300) * (-136.896) (-137.934) (-136.797) [-136.703] -- 0:00:46
219000 -- (-136.377) (-139.331) (-138.466) [-139.646] * [-136.515] (-139.629) (-139.583) (-142.093) -- 0:00:46
219500 -- (-135.739) (-135.690) (-139.353) [-135.534] * (-137.810) (-136.412) [-134.224] (-142.536) -- 0:00:46
220000 -- (-137.039) (-136.006) [-137.025] (-136.382) * (-137.280) (-135.410) (-135.270) [-135.859] -- 0:00:46
Average standard deviation of split frequencies: 0.015331
220500 -- (-139.249) (-135.031) (-136.864) [-137.418] * (-137.512) (-136.601) [-138.689] (-137.146) -- 0:00:45
221000 -- (-134.854) (-138.502) [-136.402] (-141.090) * (-134.988) (-136.470) (-136.179) [-138.635] -- 0:00:45
221500 -- (-134.916) (-137.466) (-134.182) [-136.852] * [-135.377] (-135.058) (-139.617) (-135.763) -- 0:00:45
222000 -- (-137.049) (-139.075) [-135.671] (-138.345) * [-135.837] (-137.088) (-136.454) (-135.321) -- 0:00:45
222500 -- (-136.487) [-136.188] (-135.165) (-137.294) * (-135.734) (-135.838) (-135.719) [-136.185] -- 0:00:45
223000 -- (-137.195) [-135.346] (-135.295) (-138.845) * [-134.896] (-137.950) (-140.817) (-135.001) -- 0:00:45
223500 -- [-136.718] (-136.281) (-135.640) (-136.706) * (-134.306) [-136.138] (-135.326) (-135.406) -- 0:00:45
224000 -- (-136.082) (-139.016) (-134.941) [-135.317] * (-135.061) [-134.413] (-135.361) (-136.332) -- 0:00:45
224500 -- (-137.547) (-136.817) [-135.012] (-135.763) * (-138.225) [-136.580] (-134.927) (-139.075) -- 0:00:48
225000 -- [-140.209] (-136.406) (-137.197) (-137.239) * (-135.660) [-137.221] (-135.626) (-142.250) -- 0:00:48
Average standard deviation of split frequencies: 0.015092
225500 -- (-139.163) [-138.780] (-140.053) (-140.856) * [-137.942] (-136.220) (-135.141) (-137.493) -- 0:00:48
226000 -- (-134.369) [-140.449] (-138.224) (-141.041) * (-135.361) [-135.420] (-138.152) (-135.109) -- 0:00:47
226500 -- (-138.497) [-136.817] (-136.572) (-139.118) * [-136.262] (-136.100) (-136.625) (-135.972) -- 0:00:47
227000 -- (-137.509) (-137.750) [-137.943] (-135.765) * (-136.734) [-137.246] (-135.894) (-135.052) -- 0:00:47
227500 -- (-138.858) (-140.494) [-135.535] (-135.050) * (-136.785) [-138.741] (-138.049) (-136.242) -- 0:00:47
228000 -- [-137.016] (-140.208) (-138.551) (-134.391) * [-135.462] (-134.739) (-137.090) (-140.175) -- 0:00:47
228500 -- (-134.750) (-138.132) [-134.807] (-135.891) * [-137.648] (-137.604) (-134.122) (-138.197) -- 0:00:47
229000 -- (-136.492) (-140.369) (-135.168) [-134.939] * (-137.364) (-135.500) (-140.095) [-135.179] -- 0:00:47
229500 -- (-138.365) (-138.285) [-135.702] (-134.528) * (-136.180) (-140.750) (-139.486) [-137.331] -- 0:00:47
230000 -- (-138.236) [-134.259] (-135.369) (-135.329) * (-136.865) (-135.475) (-135.331) [-135.684] -- 0:00:46
Average standard deviation of split frequencies: 0.014646
230500 -- (-136.512) (-136.312) (-136.408) [-135.697] * (-136.771) (-134.488) (-136.802) [-136.281] -- 0:00:46
231000 -- (-137.512) (-137.533) [-135.098] (-135.867) * (-134.144) (-136.144) [-136.871] (-138.425) -- 0:00:46
231500 -- (-136.300) (-135.630) [-139.497] (-139.890) * (-139.483) (-139.977) [-137.029] (-135.590) -- 0:00:46
232000 -- (-138.362) [-138.119] (-139.349) (-136.566) * [-136.226] (-135.723) (-137.711) (-135.955) -- 0:00:46
232500 -- (-138.468) (-135.589) [-136.438] (-135.136) * (-134.875) [-135.717] (-139.533) (-135.147) -- 0:00:46
233000 -- (-138.627) [-136.456] (-136.806) (-134.068) * (-137.275) [-136.515] (-135.314) (-138.161) -- 0:00:46
233500 -- (-136.091) (-134.044) (-134.131) [-136.227] * (-142.046) (-137.493) [-134.242] (-135.538) -- 0:00:45
234000 -- (-135.036) (-134.800) [-137.592] (-139.353) * [-140.234] (-136.750) (-136.218) (-134.756) -- 0:00:45
234500 -- [-135.824] (-137.782) (-136.063) (-142.006) * (-137.598) (-135.870) (-136.457) [-134.664] -- 0:00:45
235000 -- (-135.366) (-137.214) (-137.091) [-139.236] * (-138.766) [-133.893] (-137.205) (-137.766) -- 0:00:45
Average standard deviation of split frequencies: 0.014204
235500 -- (-137.135) (-136.949) (-138.807) [-134.820] * (-135.962) (-136.171) [-134.492] (-135.844) -- 0:00:45
236000 -- (-136.402) (-136.362) [-137.176] (-136.359) * (-135.491) (-136.192) [-137.376] (-139.134) -- 0:00:45
236500 -- (-141.745) (-138.333) (-136.888) [-135.438] * (-134.698) (-136.913) (-134.834) [-140.932] -- 0:00:45
237000 -- [-142.964] (-134.271) (-137.344) (-134.950) * [-144.482] (-134.570) (-137.188) (-135.241) -- 0:00:45
237500 -- [-141.082] (-136.229) (-141.925) (-134.903) * [-141.317] (-136.021) (-134.668) (-137.973) -- 0:00:44
238000 -- (-138.380) (-135.249) (-146.168) [-134.952] * (-140.404) (-136.203) [-134.670] (-136.957) -- 0:00:44
238500 -- (-135.918) [-136.136] (-136.853) (-135.516) * (-141.917) (-136.761) (-134.672) [-136.601] -- 0:00:44
239000 -- (-137.488) (-134.945) (-136.867) [-135.130] * (-136.235) [-135.781] (-134.768) (-136.086) -- 0:00:44
239500 -- (-135.276) (-137.955) (-136.423) [-136.266] * (-135.508) (-135.085) [-134.535] (-136.319) -- 0:00:44
240000 -- (-136.152) [-137.505] (-134.638) (-135.626) * (-134.878) [-135.350] (-135.632) (-134.633) -- 0:00:44
Average standard deviation of split frequencies: 0.015779
240500 -- (-136.037) (-135.828) (-135.573) [-134.902] * (-135.518) (-136.139) [-135.627] (-134.864) -- 0:00:44
241000 -- (-135.299) (-136.171) (-143.222) [-134.192] * (-143.980) [-137.850] (-141.706) (-138.087) -- 0:00:44
241500 -- (-142.612) (-134.888) (-141.960) [-139.238] * (-137.549) (-139.796) (-136.850) [-137.499] -- 0:00:47
242000 -- (-141.133) (-139.260) (-140.198) [-145.135] * (-136.202) [-137.120] (-135.869) (-135.788) -- 0:00:46
242500 -- [-135.656] (-134.544) (-136.438) (-145.312) * (-134.123) (-134.246) [-134.747] (-134.538) -- 0:00:46
243000 -- (-134.782) (-135.010) (-135.198) [-142.404] * (-137.714) (-143.689) (-137.092) [-135.484] -- 0:00:46
243500 -- [-136.383] (-139.115) (-134.993) (-144.739) * (-138.051) (-140.632) (-137.822) [-135.470] -- 0:00:46
244000 -- [-139.975] (-139.171) (-135.016) (-144.563) * (-137.799) [-134.841] (-135.645) (-136.678) -- 0:00:46
244500 -- (-137.033) (-135.612) [-134.744] (-140.702) * [-134.225] (-136.153) (-135.720) (-136.762) -- 0:00:46
245000 -- (-137.733) (-134.939) [-134.419] (-136.726) * [-135.216] (-135.685) (-141.655) (-134.397) -- 0:00:46
Average standard deviation of split frequencies: 0.015437
245500 -- (-136.388) (-134.231) [-137.183] (-137.905) * (-135.750) (-140.006) (-140.404) [-135.251] -- 0:00:46
246000 -- (-136.936) (-135.859) (-136.040) [-136.089] * [-135.456] (-136.303) (-137.640) (-138.080) -- 0:00:45
246500 -- [-135.888] (-138.656) (-135.901) (-136.505) * (-136.922) (-138.364) (-138.107) [-135.200] -- 0:00:45
247000 -- (-138.667) [-136.583] (-135.883) (-136.316) * [-136.518] (-136.242) (-138.653) (-136.109) -- 0:00:45
247500 -- (-136.635) (-137.506) [-138.057] (-134.861) * [-136.679] (-135.399) (-137.231) (-137.316) -- 0:00:45
248000 -- (-136.969) (-137.313) [-136.229] (-136.197) * (-136.657) (-137.802) (-134.726) [-135.463] -- 0:00:45
248500 -- (-136.985) [-136.766] (-136.889) (-136.797) * [-134.910] (-137.641) (-135.123) (-140.403) -- 0:00:45
249000 -- (-136.917) (-138.064) [-134.781] (-139.649) * (-134.636) [-134.354] (-135.592) (-138.942) -- 0:00:45
249500 -- (-135.192) [-134.638] (-135.483) (-135.832) * [-135.964] (-136.134) (-137.567) (-137.268) -- 0:00:45
250000 -- (-136.202) [-136.679] (-135.894) (-135.951) * (-135.815) (-135.293) (-136.942) [-136.976] -- 0:00:45
Average standard deviation of split frequencies: 0.016716
250500 -- (-137.398) [-139.224] (-135.784) (-137.456) * (-134.398) (-138.691) (-135.901) [-136.013] -- 0:00:44
251000 -- [-135.615] (-135.392) (-136.202) (-135.304) * (-137.851) (-137.306) [-136.600] (-138.090) -- 0:00:44
251500 -- (-134.347) (-138.261) (-136.596) [-134.908] * [-136.107] (-136.221) (-137.353) (-135.542) -- 0:00:44
252000 -- [-137.510] (-140.166) (-137.453) (-138.806) * (-135.329) (-135.081) (-138.687) [-135.984] -- 0:00:44
252500 -- (-135.524) (-135.734) [-134.814] (-135.957) * (-140.570) [-134.737] (-137.510) (-136.184) -- 0:00:44
253000 -- (-135.831) (-138.312) [-138.507] (-134.360) * [-135.777] (-135.615) (-135.487) (-135.114) -- 0:00:44
253500 -- (-136.668) (-139.604) [-138.197] (-135.636) * [-136.252] (-138.416) (-138.258) (-134.707) -- 0:00:44
254000 -- [-137.590] (-138.357) (-140.330) (-134.992) * (-134.892) (-137.016) (-135.639) [-135.213] -- 0:00:44
254500 -- (-137.811) (-139.496) (-138.238) [-139.741] * (-135.599) (-136.729) [-136.838] (-137.826) -- 0:00:43
255000 -- (-137.747) (-142.026) (-136.086) [-135.276] * (-137.546) (-136.578) (-143.200) [-135.793] -- 0:00:43
Average standard deviation of split frequencies: 0.015754
255500 -- [-135.796] (-140.131) (-135.943) (-135.380) * (-137.539) [-135.038] (-139.556) (-136.422) -- 0:00:43
256000 -- [-137.904] (-148.524) (-136.298) (-136.353) * (-135.214) [-136.685] (-140.336) (-135.970) -- 0:00:43
256500 -- (-137.939) [-144.734] (-140.694) (-137.022) * (-135.285) (-135.280) (-138.866) [-138.792] -- 0:00:43
257000 -- (-136.972) (-151.225) (-135.087) [-135.800] * (-137.575) [-135.353] (-136.067) (-137.311) -- 0:00:43
257500 -- (-136.670) [-150.726] (-139.380) (-135.413) * (-137.393) (-135.053) [-136.930] (-135.111) -- 0:00:43
258000 -- (-134.949) [-135.657] (-136.819) (-136.636) * (-137.328) [-135.148] (-136.996) (-136.835) -- 0:00:46
258500 -- (-137.648) (-136.334) [-135.015] (-135.749) * (-137.739) [-134.792] (-136.503) (-137.803) -- 0:00:45
259000 -- (-138.244) [-135.734] (-134.839) (-139.715) * (-137.550) (-137.243) (-135.831) [-137.321] -- 0:00:45
259500 -- (-135.954) [-138.407] (-135.818) (-140.806) * (-136.171) (-138.717) [-135.328] (-136.015) -- 0:00:45
260000 -- (-135.158) (-135.351) [-136.575] (-137.039) * (-136.901) [-136.316] (-135.059) (-134.864) -- 0:00:45
Average standard deviation of split frequencies: 0.013563
260500 -- (-135.247) (-136.105) [-136.049] (-135.555) * (-135.276) (-139.931) (-135.564) [-138.979] -- 0:00:45
261000 -- [-135.645] (-135.709) (-136.493) (-135.751) * (-136.133) [-140.206] (-136.157) (-135.269) -- 0:00:45
261500 -- [-137.581] (-135.396) (-136.031) (-137.314) * (-136.584) (-136.724) [-135.291] (-136.783) -- 0:00:45
262000 -- (-135.042) (-136.076) (-135.434) [-138.576] * (-142.360) (-136.864) (-135.066) [-136.680] -- 0:00:45
262500 -- (-135.946) [-138.071] (-142.702) (-137.276) * [-137.174] (-137.585) (-134.488) (-136.943) -- 0:00:44
263000 -- [-135.656] (-137.249) (-140.388) (-137.108) * (-142.101) (-136.002) [-136.892] (-141.104) -- 0:00:44
263500 -- (-136.817) [-134.912] (-138.895) (-135.114) * (-135.981) (-135.455) (-143.826) [-134.550] -- 0:00:44
264000 -- (-137.357) (-141.658) [-136.892] (-136.879) * [-134.409] (-135.085) (-142.055) (-137.006) -- 0:00:44
264500 -- (-136.500) [-134.426] (-134.623) (-139.232) * [-135.975] (-134.271) (-136.914) (-139.058) -- 0:00:44
265000 -- (-140.002) [-135.473] (-136.681) (-134.228) * [-136.921] (-137.307) (-135.860) (-136.891) -- 0:00:44
Average standard deviation of split frequencies: 0.015457
265500 -- (-137.876) [-134.858] (-136.255) (-138.773) * (-135.086) [-137.512] (-136.070) (-135.170) -- 0:00:44
266000 -- [-138.076] (-135.052) (-136.168) (-136.382) * (-136.973) (-138.089) [-134.155] (-135.383) -- 0:00:44
266500 -- [-136.563] (-135.582) (-138.642) (-136.069) * [-139.842] (-138.050) (-134.942) (-136.203) -- 0:00:44
267000 -- (-137.405) [-135.307] (-136.305) (-134.586) * (-137.520) (-139.103) (-136.506) [-135.842] -- 0:00:43
267500 -- (-134.981) (-134.901) (-137.186) [-135.078] * (-139.345) (-138.476) (-134.856) [-135.472] -- 0:00:43
268000 -- (-136.594) [-135.431] (-136.525) (-139.789) * (-139.845) (-136.958) [-135.017] (-135.787) -- 0:00:43
268500 -- [-135.441] (-135.053) (-134.580) (-138.526) * (-137.930) (-134.828) [-134.536] (-137.506) -- 0:00:43
269000 -- (-134.742) (-134.642) [-137.599] (-137.646) * (-134.969) [-136.631] (-134.454) (-138.672) -- 0:00:43
269500 -- (-136.013) [-136.694] (-135.477) (-135.401) * (-134.221) (-140.060) [-137.015] (-140.266) -- 0:00:43
270000 -- (-139.018) (-134.275) (-136.094) [-135.914] * (-134.905) (-134.089) (-137.108) [-137.551] -- 0:00:43
Average standard deviation of split frequencies: 0.015385
270500 -- (-137.299) (-135.322) [-139.328] (-135.202) * (-134.892) (-137.460) (-134.485) [-135.657] -- 0:00:43
271000 -- (-138.580) (-136.560) (-138.561) [-134.662] * (-139.370) [-135.849] (-134.908) (-135.775) -- 0:00:43
271500 -- (-135.853) (-136.715) (-137.725) [-137.639] * (-140.569) [-134.294] (-135.161) (-137.493) -- 0:00:42
272000 -- (-136.858) [-136.777] (-139.224) (-135.141) * (-136.060) [-137.104] (-138.065) (-136.601) -- 0:00:42
272500 -- (-136.634) (-135.002) (-136.543) [-139.846] * (-138.709) [-135.914] (-141.249) (-136.191) -- 0:00:42
273000 -- [-135.476] (-135.741) (-137.177) (-138.336) * (-137.296) [-135.325] (-135.719) (-136.295) -- 0:00:42
273500 -- [-139.818] (-134.236) (-135.762) (-138.689) * (-137.682) (-140.123) (-136.288) [-140.303] -- 0:00:42
274000 -- [-135.462] (-134.483) (-135.118) (-138.594) * (-135.414) [-135.121] (-134.654) (-137.983) -- 0:00:42
274500 -- (-136.435) [-134.014] (-135.776) (-134.035) * [-137.211] (-137.262) (-137.307) (-138.937) -- 0:00:44
275000 -- (-136.262) (-136.336) (-134.153) [-134.791] * (-137.565) [-134.363] (-134.717) (-135.054) -- 0:00:44
Average standard deviation of split frequencies: 0.016226
275500 -- (-141.083) (-137.736) [-135.137] (-136.458) * [-135.292] (-134.375) (-134.995) (-136.274) -- 0:00:44
276000 -- [-135.889] (-135.996) (-137.311) (-136.290) * [-142.889] (-136.557) (-134.356) (-137.063) -- 0:00:44
276500 -- (-136.099) (-137.661) [-140.216] (-134.758) * (-141.590) (-134.899) (-139.649) [-134.196] -- 0:00:44
277000 -- (-137.050) (-139.107) [-135.527] (-136.822) * (-139.761) (-136.132) [-135.409] (-134.914) -- 0:00:44
277500 -- (-135.279) (-134.806) (-137.767) [-136.595] * (-137.085) (-136.589) [-138.592] (-135.058) -- 0:00:44
278000 -- (-137.438) [-135.038] (-134.612) (-135.860) * (-136.377) (-139.519) (-135.964) [-136.433] -- 0:00:44
278500 -- [-135.500] (-135.339) (-135.352) (-135.812) * (-135.474) (-136.441) [-135.477] (-137.861) -- 0:00:44
279000 -- (-137.038) (-136.507) [-135.775] (-136.636) * (-134.669) (-134.998) (-134.774) [-134.053] -- 0:00:43
279500 -- [-138.537] (-139.193) (-137.047) (-143.243) * (-135.768) (-134.973) [-135.427] (-135.052) -- 0:00:43
280000 -- (-134.085) (-136.400) [-138.822] (-138.904) * (-137.640) (-134.639) (-137.726) [-135.571] -- 0:00:43
Average standard deviation of split frequencies: 0.015676
280500 -- (-135.418) (-138.329) [-135.729] (-139.361) * (-136.296) (-137.479) [-138.091] (-134.629) -- 0:00:43
281000 -- (-135.436) (-140.057) [-136.389] (-135.051) * (-137.391) [-136.405] (-138.702) (-136.529) -- 0:00:43
281500 -- (-136.251) (-140.363) (-138.402) [-134.926] * (-134.412) [-140.242] (-135.999) (-134.924) -- 0:00:43
282000 -- (-134.539) (-135.516) [-138.499] (-134.494) * (-136.768) [-135.947] (-136.350) (-135.559) -- 0:00:43
282500 -- [-134.251] (-136.370) (-136.727) (-135.232) * (-139.158) (-135.214) (-137.352) [-136.826] -- 0:00:43
283000 -- [-134.685] (-138.022) (-134.731) (-135.653) * (-135.321) (-139.099) [-135.932] (-138.751) -- 0:00:43
283500 -- [-135.108] (-136.119) (-135.654) (-138.377) * (-137.456) [-139.178] (-137.291) (-137.111) -- 0:00:42
284000 -- (-135.945) [-135.381] (-136.289) (-136.444) * (-136.813) (-134.614) (-137.690) [-137.127] -- 0:00:42
284500 -- (-136.691) [-136.494] (-137.691) (-138.477) * (-138.129) (-136.373) (-140.320) [-136.110] -- 0:00:42
285000 -- (-134.879) (-134.793) [-137.642] (-134.847) * [-139.907] (-136.041) (-135.135) (-134.691) -- 0:00:42
Average standard deviation of split frequencies: 0.014926
285500 -- (-135.967) [-135.579] (-135.915) (-137.262) * (-140.512) (-138.175) (-136.790) [-134.902] -- 0:00:42
286000 -- (-135.972) (-137.860) (-138.539) [-135.197] * (-139.429) [-135.869] (-139.776) (-136.761) -- 0:00:42
286500 -- (-134.940) (-137.571) (-137.502) [-135.823] * (-138.733) (-138.863) (-137.460) [-137.358] -- 0:00:42
287000 -- (-137.454) [-135.763] (-142.901) (-134.902) * (-136.223) [-135.575] (-137.916) (-138.100) -- 0:00:42
287500 -- (-136.632) (-137.566) [-137.886] (-136.719) * (-136.500) (-135.320) (-135.695) [-138.160] -- 0:00:42
288000 -- [-141.784] (-136.435) (-137.580) (-135.319) * [-138.908] (-135.132) (-137.967) (-137.404) -- 0:00:42
288500 -- (-138.354) [-140.334] (-136.285) (-136.902) * (-138.325) (-134.529) [-137.615] (-135.930) -- 0:00:41
289000 -- [-137.897] (-137.277) (-136.794) (-136.314) * (-137.696) (-136.149) [-135.670] (-134.291) -- 0:00:41
289500 -- (-137.477) (-136.701) [-135.443] (-136.602) * [-135.468] (-135.064) (-134.843) (-134.410) -- 0:00:41
290000 -- (-136.935) (-138.957) (-134.241) [-135.808] * (-139.200) (-136.701) (-135.155) [-134.751] -- 0:00:41
Average standard deviation of split frequencies: 0.015227
290500 -- (-136.071) [-137.420] (-137.604) (-137.693) * (-137.276) (-138.398) (-136.013) [-134.635] -- 0:00:41
291000 -- (-137.681) (-136.857) (-138.316) [-137.023] * (-134.559) [-134.927] (-136.604) (-135.211) -- 0:00:41
291500 -- (-138.215) [-134.729] (-138.125) (-136.242) * (-136.115) (-134.998) (-138.216) [-136.401] -- 0:00:43
292000 -- (-138.663) (-135.510) (-138.052) [-137.668] * (-137.124) (-140.544) (-141.080) [-138.263] -- 0:00:43
292500 -- (-137.258) [-137.301] (-139.258) (-136.464) * (-137.896) [-135.923] (-139.038) (-137.963) -- 0:00:43
293000 -- [-135.199] (-134.849) (-136.375) (-138.909) * (-134.103) (-134.761) (-137.989) [-145.743] -- 0:00:43
293500 -- (-137.006) (-137.282) [-135.965] (-135.985) * (-139.189) (-135.638) [-135.441] (-135.280) -- 0:00:43
294000 -- (-135.581) (-138.247) (-136.911) [-140.182] * (-138.161) [-139.803] (-135.788) (-139.252) -- 0:00:43
294500 -- (-135.391) (-136.109) (-135.943) [-136.019] * (-136.369) (-136.145) (-137.556) [-136.939] -- 0:00:43
295000 -- [-135.250] (-134.720) (-136.202) (-137.409) * (-134.894) (-137.036) (-134.517) [-141.557] -- 0:00:43
Average standard deviation of split frequencies: 0.015926
295500 -- [-134.269] (-137.758) (-138.651) (-136.652) * (-135.349) (-135.946) (-137.041) [-136.810] -- 0:00:42
296000 -- (-138.715) (-138.394) [-137.208] (-136.409) * (-134.433) (-135.412) (-135.758) [-135.375] -- 0:00:42
296500 -- (-137.762) (-137.015) (-136.774) [-140.662] * (-134.445) [-134.683] (-140.148) (-138.674) -- 0:00:42
297000 -- [-137.214] (-141.035) (-142.943) (-136.190) * (-135.203) (-135.933) (-134.424) [-135.978] -- 0:00:42
297500 -- (-135.189) [-136.473] (-139.104) (-136.544) * (-134.056) (-140.754) [-136.955] (-137.588) -- 0:00:42
298000 -- (-136.407) (-135.427) (-139.120) [-135.274] * (-134.729) (-134.667) (-136.826) [-135.353] -- 0:00:42
298500 -- [-136.686] (-143.153) (-138.196) (-135.989) * (-139.417) (-135.788) [-136.176] (-138.713) -- 0:00:42
299000 -- (-136.433) (-140.625) (-135.533) [-134.416] * (-137.118) (-141.622) [-139.405] (-135.742) -- 0:00:42
299500 -- (-138.409) [-138.087] (-141.732) (-135.464) * (-135.132) (-135.245) [-134.158] (-137.432) -- 0:00:42
300000 -- (-137.672) (-135.444) [-141.002] (-136.597) * (-137.029) (-135.372) [-135.264] (-136.666) -- 0:00:42
Average standard deviation of split frequencies: 0.016232
300500 -- (-135.843) (-134.964) [-136.935] (-137.467) * (-138.681) (-137.670) [-138.482] (-136.211) -- 0:00:41
301000 -- (-135.724) [-137.163] (-137.581) (-146.919) * (-138.661) [-138.377] (-138.296) (-136.189) -- 0:00:41
301500 -- (-136.670) (-137.328) [-136.472] (-135.697) * (-135.847) (-134.451) [-134.346] (-134.850) -- 0:00:41
302000 -- (-136.991) (-136.161) (-137.507) [-134.558] * (-136.604) (-134.623) [-138.017] (-137.140) -- 0:00:41
302500 -- (-136.893) (-135.742) (-136.545) [-135.262] * (-138.606) (-136.112) (-136.778) [-135.115] -- 0:00:41
303000 -- (-137.660) (-138.622) [-136.735] (-135.971) * (-136.398) (-137.418) [-136.179] (-135.260) -- 0:00:41
303500 -- [-138.364] (-140.195) (-135.094) (-135.378) * (-135.128) [-136.042] (-138.959) (-135.658) -- 0:00:41
304000 -- [-134.910] (-135.202) (-135.204) (-134.732) * (-135.680) (-135.380) [-141.519] (-135.607) -- 0:00:41
304500 -- [-134.951] (-136.527) (-135.482) (-135.863) * (-139.310) [-134.566] (-135.273) (-135.068) -- 0:00:41
305000 -- (-136.941) (-137.432) [-140.807] (-136.050) * (-136.615) (-137.321) [-134.687] (-135.719) -- 0:00:41
Average standard deviation of split frequencies: 0.015587
305500 -- (-136.526) (-139.559) [-137.602] (-136.132) * (-135.198) [-135.946] (-135.508) (-135.194) -- 0:00:40
306000 -- (-135.323) (-135.373) (-137.263) [-136.045] * (-135.859) (-135.286) [-134.792] (-136.495) -- 0:00:40
306500 -- (-136.519) (-136.305) [-138.120] (-136.726) * [-135.393] (-138.561) (-135.670) (-134.749) -- 0:00:40
307000 -- (-134.441) (-136.340) (-138.215) [-134.753] * (-136.429) [-135.029] (-136.210) (-140.508) -- 0:00:40
307500 -- [-137.126] (-136.909) (-136.131) (-137.628) * (-135.135) [-134.959] (-138.705) (-138.651) -- 0:00:40
308000 -- [-135.393] (-137.682) (-139.915) (-136.677) * (-135.157) (-137.837) [-137.058] (-138.112) -- 0:00:40
308500 -- (-138.925) (-134.216) (-137.683) [-135.706] * (-136.206) (-135.030) (-135.207) [-135.348] -- 0:00:42
309000 -- (-135.565) (-134.800) [-138.158] (-135.382) * (-136.134) [-135.189] (-134.074) (-140.154) -- 0:00:42
309500 -- [-138.561] (-135.576) (-138.405) (-135.953) * [-137.851] (-136.490) (-136.549) (-135.766) -- 0:00:42
310000 -- (-138.145) (-135.567) [-140.304] (-134.898) * (-137.581) (-134.850) (-136.134) [-134.790] -- 0:00:42
Average standard deviation of split frequencies: 0.014728
310500 -- (-134.894) (-136.569) (-138.428) [-134.547] * (-136.073) (-135.679) (-135.446) [-140.784] -- 0:00:42
311000 -- (-136.933) [-136.027] (-141.875) (-134.917) * [-136.744] (-135.333) (-135.909) (-138.613) -- 0:00:42
311500 -- (-136.843) [-135.239] (-134.462) (-137.347) * [-134.592] (-137.971) (-136.555) (-136.014) -- 0:00:41
312000 -- [-139.451] (-134.774) (-135.584) (-136.375) * (-135.030) (-138.078) (-135.826) [-135.173] -- 0:00:41
312500 -- (-135.875) (-134.830) (-137.533) [-136.905] * (-134.824) (-135.848) (-138.232) [-135.224] -- 0:00:41
313000 -- (-134.507) [-137.013] (-135.599) (-143.831) * [-135.148] (-135.375) (-134.533) (-136.288) -- 0:00:41
313500 -- (-138.230) [-134.301] (-136.929) (-137.227) * (-136.628) (-135.324) (-135.406) [-138.043] -- 0:00:41
314000 -- (-135.176) (-136.566) (-136.833) [-136.745] * (-135.196) [-136.838] (-136.692) (-138.308) -- 0:00:41
314500 -- (-135.142) (-134.878) (-135.352) [-134.989] * [-135.815] (-138.345) (-136.752) (-141.036) -- 0:00:41
315000 -- [-137.282] (-134.848) (-134.209) (-137.169) * [-135.939] (-137.661) (-135.885) (-140.625) -- 0:00:41
Average standard deviation of split frequencies: 0.013602
315500 -- (-138.015) (-136.499) (-136.330) [-136.749] * [-135.583] (-137.724) (-136.351) (-137.336) -- 0:00:41
316000 -- [-136.929] (-135.239) (-134.462) (-138.458) * [-136.677] (-135.418) (-136.570) (-135.267) -- 0:00:41
316500 -- (-136.041) (-135.781) (-134.731) [-134.272] * (-137.766) (-135.115) (-135.653) [-134.265] -- 0:00:41
317000 -- (-137.159) (-135.590) (-135.942) [-135.449] * (-135.601) (-134.424) [-135.768] (-139.371) -- 0:00:40
317500 -- (-135.232) (-136.975) (-143.146) [-137.884] * (-136.106) (-138.918) (-135.489) [-135.252] -- 0:00:40
318000 -- (-136.849) (-136.868) (-136.971) [-135.204] * [-137.911] (-138.556) (-136.136) (-135.869) -- 0:00:40
318500 -- (-135.268) (-134.682) (-136.274) [-137.234] * (-134.601) [-137.523] (-134.623) (-134.421) -- 0:00:40
319000 -- (-137.500) (-136.432) [-140.256] (-137.170) * (-138.305) (-141.068) (-138.459) [-136.151] -- 0:00:40
319500 -- (-137.113) (-135.490) (-138.007) [-137.537] * [-136.368] (-149.361) (-140.706) (-136.120) -- 0:00:40
320000 -- [-136.994] (-136.107) (-135.515) (-135.132) * [-135.802] (-136.436) (-135.970) (-136.381) -- 0:00:40
Average standard deviation of split frequencies: 0.014355
320500 -- (-140.930) (-135.166) [-134.969] (-135.869) * (-135.911) (-140.869) (-136.492) [-135.097] -- 0:00:40
321000 -- [-137.516] (-137.781) (-134.996) (-136.197) * (-134.866) (-140.327) [-135.569] (-136.523) -- 0:00:40
321500 -- (-135.941) [-136.018] (-138.288) (-134.840) * [-136.411] (-135.502) (-135.732) (-135.952) -- 0:00:40
322000 -- (-138.871) [-137.929] (-138.158) (-136.783) * (-138.908) [-135.766] (-136.541) (-136.274) -- 0:00:40
322500 -- (-140.308) [-137.551] (-134.392) (-142.813) * (-140.457) (-137.609) [-136.000] (-135.663) -- 0:00:39
323000 -- (-137.476) [-137.403] (-134.039) (-139.643) * (-138.014) [-135.454] (-134.872) (-134.999) -- 0:00:39
323500 -- (-138.051) [-136.558] (-137.438) (-134.483) * (-136.614) (-139.007) [-136.026] (-138.813) -- 0:00:39
324000 -- (-135.247) (-134.715) (-134.988) [-134.976] * (-135.677) (-142.801) [-138.143] (-141.202) -- 0:00:39
324500 -- (-136.258) [-134.667] (-137.173) (-138.276) * (-135.455) [-138.328] (-138.919) (-138.719) -- 0:00:39
325000 -- (-134.662) [-135.725] (-135.227) (-135.358) * [-133.899] (-134.531) (-136.995) (-134.668) -- 0:00:39
Average standard deviation of split frequencies: 0.015481
325500 -- (-136.452) [-134.968] (-136.286) (-139.225) * (-138.260) [-136.897] (-137.647) (-135.722) -- 0:00:39
326000 -- [-134.902] (-135.243) (-136.221) (-139.114) * [-135.679] (-136.396) (-136.956) (-135.533) -- 0:00:41
326500 -- (-135.018) (-134.637) (-135.606) [-136.850] * [-136.176] (-139.240) (-135.627) (-135.879) -- 0:00:41
327000 -- [-135.534] (-134.540) (-137.622) (-136.295) * (-139.673) (-143.106) [-135.262] (-135.073) -- 0:00:41
327500 -- (-135.139) (-136.398) (-139.428) [-134.985] * (-138.306) (-137.026) [-136.567] (-134.879) -- 0:00:41
328000 -- (-134.614) (-134.937) (-139.636) [-135.592] * (-136.998) (-138.165) [-138.952] (-134.052) -- 0:00:40
328500 -- (-138.848) (-137.985) (-141.021) [-135.724] * (-138.683) [-137.749] (-137.578) (-134.722) -- 0:00:40
329000 -- [-137.681] (-135.806) (-137.918) (-135.970) * (-138.589) (-137.459) (-135.718) [-135.098] -- 0:00:40
329500 -- (-134.345) (-135.925) (-135.417) [-134.606] * (-135.035) (-135.921) [-136.499] (-135.180) -- 0:00:40
330000 -- (-134.895) [-134.689] (-135.839) (-135.762) * [-137.227] (-139.243) (-136.291) (-136.423) -- 0:00:40
Average standard deviation of split frequencies: 0.015346
330500 -- [-134.218] (-136.172) (-134.956) (-136.628) * (-134.216) [-138.078] (-134.803) (-136.628) -- 0:00:40
331000 -- (-135.677) [-135.249] (-138.017) (-138.628) * (-138.508) (-134.100) [-134.481] (-135.211) -- 0:00:40
331500 -- [-135.851] (-138.294) (-137.047) (-139.151) * (-135.744) (-135.060) (-135.437) [-136.870] -- 0:00:40
332000 -- (-136.118) [-135.973] (-137.895) (-140.900) * (-135.421) (-135.503) [-135.062] (-136.713) -- 0:00:40
332500 -- (-138.734) [-135.160] (-134.601) (-138.647) * (-138.700) (-138.175) [-135.166] (-134.279) -- 0:00:40
333000 -- (-135.982) [-135.894] (-136.409) (-137.097) * [-135.682] (-135.984) (-137.000) (-134.197) -- 0:00:40
333500 -- [-135.811] (-135.192) (-136.663) (-136.927) * [-135.104] (-141.326) (-141.739) (-135.202) -- 0:00:39
334000 -- [-135.489] (-135.789) (-139.510) (-136.485) * (-135.750) [-137.927] (-135.766) (-136.130) -- 0:00:39
334500 -- (-136.829) [-135.353] (-137.344) (-135.004) * (-136.939) (-136.073) (-137.815) [-135.714] -- 0:00:39
335000 -- (-136.380) (-137.936) [-138.737] (-135.822) * (-136.562) (-135.492) (-136.309) [-134.878] -- 0:00:39
Average standard deviation of split frequencies: 0.013947
335500 -- [-134.743] (-138.757) (-135.486) (-139.028) * [-135.524] (-136.059) (-135.536) (-137.622) -- 0:00:39
336000 -- [-135.433] (-135.268) (-136.740) (-136.387) * (-137.158) [-136.579] (-136.589) (-138.582) -- 0:00:39
336500 -- (-135.108) (-136.735) (-137.148) [-135.386] * (-135.473) [-137.998] (-134.161) (-137.071) -- 0:00:39
337000 -- [-135.768] (-135.556) (-138.004) (-136.702) * [-135.594] (-135.801) (-137.956) (-136.570) -- 0:00:39
337500 -- (-135.848) [-136.752] (-135.802) (-138.886) * (-134.512) [-135.094] (-135.145) (-137.537) -- 0:00:39
338000 -- (-135.439) (-135.561) (-139.713) [-134.307] * (-134.610) (-136.122) [-135.923] (-135.463) -- 0:00:39
338500 -- [-138.799] (-134.691) (-139.014) (-138.167) * (-137.021) [-139.106] (-136.676) (-135.448) -- 0:00:39
339000 -- (-138.751) (-137.403) [-137.855] (-138.643) * (-135.879) [-134.882] (-135.051) (-135.398) -- 0:00:38
339500 -- (-136.280) [-136.934] (-137.250) (-134.678) * (-138.065) [-137.192] (-134.794) (-135.680) -- 0:00:38
340000 -- (-137.842) (-136.877) (-135.558) [-136.572] * (-141.400) (-137.540) [-135.402] (-138.390) -- 0:00:38
Average standard deviation of split frequencies: 0.014733
340500 -- (-137.136) [-136.605] (-135.445) (-138.675) * (-137.492) (-135.149) [-137.021] (-137.193) -- 0:00:38
341000 -- (-137.531) (-139.117) (-135.820) [-136.845] * [-137.765] (-136.181) (-139.582) (-134.961) -- 0:00:38
341500 -- [-136.495] (-138.539) (-135.411) (-135.400) * (-136.762) (-140.864) (-138.922) [-137.052] -- 0:00:38
342000 -- (-136.958) (-140.133) [-134.632] (-142.576) * [-135.637] (-136.050) (-138.395) (-138.563) -- 0:00:38
342500 -- (-137.955) [-137.275] (-136.301) (-135.489) * [-134.934] (-135.562) (-137.112) (-136.565) -- 0:00:38
343000 -- (-136.426) (-136.513) (-137.519) [-134.907] * [-135.495] (-134.195) (-135.103) (-135.151) -- 0:00:38
343500 -- [-135.102] (-134.864) (-135.804) (-135.738) * [-136.398] (-135.865) (-136.753) (-134.676) -- 0:00:40
344000 -- (-135.522) [-135.445] (-137.259) (-136.238) * [-137.476] (-142.997) (-136.639) (-136.286) -- 0:00:40
344500 -- (-135.721) (-135.685) (-136.948) [-134.875] * (-136.595) (-138.928) (-137.426) [-135.878] -- 0:00:39
345000 -- [-136.261] (-135.487) (-134.826) (-134.729) * [-137.135] (-135.304) (-139.682) (-135.825) -- 0:00:39
Average standard deviation of split frequencies: 0.014827
345500 -- (-134.486) [-136.749] (-135.847) (-134.844) * (-135.464) (-137.857) (-136.453) [-136.406] -- 0:00:39
346000 -- (-135.726) (-134.253) [-135.081] (-135.289) * (-143.286) [-136.386] (-137.885) (-135.157) -- 0:00:39
346500 -- [-136.401] (-140.779) (-135.110) (-137.600) * (-142.797) (-137.271) (-135.440) [-136.910] -- 0:00:39
347000 -- (-136.590) [-136.223] (-134.394) (-136.013) * (-138.904) [-135.001] (-135.585) (-135.767) -- 0:00:39
347500 -- (-138.838) (-135.498) [-134.316] (-137.644) * (-138.862) (-146.963) (-136.327) [-137.252] -- 0:00:39
348000 -- (-140.378) (-134.761) (-134.876) [-135.862] * (-135.410) (-137.945) [-134.949] (-135.639) -- 0:00:39
348500 -- [-137.381] (-134.711) (-135.075) (-134.332) * (-137.262) [-135.228] (-136.264) (-135.590) -- 0:00:39
349000 -- [-135.467] (-135.301) (-136.973) (-137.871) * (-134.518) [-135.549] (-136.286) (-134.852) -- 0:00:39
349500 -- (-135.543) (-134.780) [-136.403] (-134.803) * (-137.930) (-136.087) (-136.542) [-135.701] -- 0:00:39
350000 -- (-134.506) [-139.334] (-137.768) (-134.683) * (-134.425) (-136.793) (-139.072) [-134.523] -- 0:00:39
Average standard deviation of split frequencies: 0.015025
350500 -- (-141.315) [-135.656] (-136.798) (-136.025) * [-137.593] (-137.857) (-140.317) (-136.344) -- 0:00:38
351000 -- (-139.362) [-136.853] (-136.165) (-139.616) * (-138.090) (-135.447) [-136.584] (-136.024) -- 0:00:38
351500 -- [-134.617] (-137.238) (-136.500) (-135.504) * (-138.614) (-135.835) [-135.144] (-134.033) -- 0:00:38
352000 -- (-138.725) (-141.076) [-137.645] (-136.123) * (-133.957) (-136.066) (-135.642) [-135.661] -- 0:00:38
352500 -- (-136.530) (-138.781) [-135.674] (-140.611) * (-137.474) (-136.613) (-137.475) [-136.720] -- 0:00:38
353000 -- (-136.191) [-137.296] (-139.984) (-138.066) * (-138.309) (-136.830) (-134.847) [-135.566] -- 0:00:38
353500 -- (-145.166) (-135.970) [-139.852] (-138.341) * [-138.150] (-134.545) (-138.205) (-135.345) -- 0:00:38
354000 -- (-140.131) (-135.903) (-142.411) [-135.708] * (-134.857) (-135.419) (-138.572) [-134.264] -- 0:00:38
354500 -- [-134.932] (-136.040) (-139.247) (-138.242) * (-134.280) (-136.275) (-137.240) [-135.635] -- 0:00:38
355000 -- (-134.416) (-135.781) (-138.235) [-135.187] * (-134.846) [-136.747] (-138.222) (-136.260) -- 0:00:38
Average standard deviation of split frequencies: 0.014800
355500 -- (-135.960) (-138.371) (-136.290) [-134.488] * (-136.032) (-135.472) [-139.288] (-136.404) -- 0:00:38
356000 -- (-135.092) (-135.731) (-136.034) [-134.244] * (-135.789) [-136.483] (-137.753) (-135.738) -- 0:00:37
356500 -- [-135.713] (-139.075) (-140.126) (-136.294) * [-135.948] (-135.542) (-136.923) (-134.318) -- 0:00:37
357000 -- (-137.156) [-138.330] (-139.289) (-135.307) * [-141.017] (-135.006) (-136.270) (-134.357) -- 0:00:37
357500 -- [-136.559] (-140.235) (-135.297) (-134.443) * [-133.999] (-135.734) (-135.494) (-134.572) -- 0:00:37
358000 -- (-135.211) (-137.938) [-136.685] (-139.461) * (-135.291) (-136.030) [-134.491] (-138.027) -- 0:00:37
358500 -- (-137.164) (-134.626) [-139.145] (-141.063) * (-136.337) (-139.469) [-138.245] (-136.376) -- 0:00:37
359000 -- [-138.232] (-135.412) (-140.424) (-142.335) * (-134.903) (-138.423) (-136.031) [-134.603] -- 0:00:37
359500 -- (-138.672) [-135.010] (-135.028) (-135.730) * [-136.868] (-137.146) (-134.312) (-134.225) -- 0:00:37
360000 -- (-134.401) (-135.220) (-134.628) [-137.784] * [-134.401] (-136.643) (-137.123) (-134.947) -- 0:00:37
Average standard deviation of split frequencies: 0.014916
360500 -- [-135.549] (-138.180) (-134.970) (-135.314) * (-137.440) [-135.964] (-138.587) (-135.037) -- 0:00:39
361000 -- [-137.680] (-134.527) (-136.666) (-138.019) * (-138.932) (-136.751) [-136.063] (-135.491) -- 0:00:38
361500 -- (-137.296) (-136.979) (-135.329) [-138.290] * (-135.998) (-136.070) (-136.367) [-134.354] -- 0:00:38
362000 -- (-135.906) (-138.460) [-135.248] (-142.859) * (-134.946) [-135.008] (-138.354) (-135.682) -- 0:00:38
362500 -- (-134.858) [-135.976] (-135.832) (-136.249) * (-134.986) (-136.188) (-134.675) [-136.067] -- 0:00:38
363000 -- [-135.598] (-136.811) (-136.768) (-134.685) * [-134.313] (-135.772) (-136.006) (-136.464) -- 0:00:38
363500 -- [-135.910] (-134.134) (-139.548) (-134.436) * (-138.193) (-135.603) (-137.630) [-134.524] -- 0:00:38
364000 -- [-134.657] (-136.220) (-138.723) (-136.638) * (-137.503) [-134.968] (-138.252) (-136.549) -- 0:00:38
364500 -- (-135.111) [-136.534] (-137.339) (-135.304) * [-135.080] (-137.491) (-136.394) (-139.452) -- 0:00:38
365000 -- (-135.746) (-136.720) (-139.173) [-134.278] * (-136.209) (-136.747) (-140.862) [-137.068] -- 0:00:38
Average standard deviation of split frequencies: 0.015229
365500 -- [-139.305] (-135.828) (-135.908) (-135.407) * (-135.359) (-140.368) [-137.024] (-137.622) -- 0:00:38
366000 -- (-136.072) (-134.238) [-136.230] (-135.282) * [-135.242] (-139.618) (-136.457) (-135.963) -- 0:00:38
366500 -- (-137.604) (-137.131) [-136.887] (-138.153) * [-135.181] (-139.083) (-134.186) (-135.623) -- 0:00:38
367000 -- (-135.010) (-135.888) [-136.594] (-133.962) * [-139.380] (-138.906) (-136.873) (-136.018) -- 0:00:37
367500 -- (-134.869) (-137.698) (-139.118) [-134.808] * (-138.157) (-138.780) [-138.230] (-134.976) -- 0:00:37
368000 -- (-136.577) (-136.713) (-136.819) [-134.281] * (-136.363) (-137.538) (-135.878) [-143.089] -- 0:00:37
368500 -- (-135.041) (-136.693) (-142.113) [-135.185] * [-140.331] (-137.066) (-134.657) (-137.022) -- 0:00:37
369000 -- (-135.933) (-138.247) (-135.521) [-134.553] * (-136.711) (-136.360) (-136.323) [-135.277] -- 0:00:37
369500 -- (-138.686) (-136.961) [-138.173] (-135.398) * (-138.784) (-135.053) [-139.499] (-136.850) -- 0:00:37
370000 -- (-137.468) (-136.708) (-137.263) [-135.035] * (-138.842) (-134.879) [-137.026] (-138.282) -- 0:00:37
Average standard deviation of split frequencies: 0.014289
370500 -- (-140.629) [-136.260] (-138.860) (-137.226) * (-135.045) (-136.935) (-137.206) [-138.346] -- 0:00:37
371000 -- (-135.476) (-135.743) [-138.228] (-135.323) * [-135.084] (-135.968) (-134.997) (-142.363) -- 0:00:37
371500 -- (-134.871) (-134.943) [-135.142] (-136.645) * (-135.426) [-134.590] (-135.512) (-140.791) -- 0:00:37
372000 -- (-135.066) [-136.632] (-135.431) (-134.621) * (-136.039) (-137.995) [-135.810] (-137.243) -- 0:00:37
372500 -- (-136.435) (-135.767) (-135.240) [-134.821] * (-136.015) (-134.900) (-138.523) [-135.360] -- 0:00:37
373000 -- [-135.850] (-135.368) (-135.625) (-135.469) * (-138.129) [-135.100] (-136.876) (-135.279) -- 0:00:36
373500 -- (-135.229) (-137.436) [-140.280] (-134.691) * (-137.027) (-137.668) [-135.510] (-134.380) -- 0:00:36
374000 -- [-142.619] (-136.907) (-141.118) (-135.036) * (-137.149) (-134.890) [-139.373] (-135.369) -- 0:00:36
374500 -- [-139.345] (-134.878) (-141.549) (-138.910) * (-139.063) (-136.929) [-139.400] (-134.761) -- 0:00:36
375000 -- (-135.559) [-139.701] (-135.518) (-135.925) * (-134.827) (-141.081) [-138.270] (-135.065) -- 0:00:36
Average standard deviation of split frequencies: 0.013791
375500 -- (-136.325) [-137.308] (-136.750) (-140.143) * [-138.880] (-134.562) (-137.558) (-136.962) -- 0:00:36
376000 -- (-140.385) (-135.333) [-134.584] (-135.287) * (-135.476) (-134.981) [-138.798] (-136.454) -- 0:00:36
376500 -- [-136.283] (-136.543) (-134.977) (-136.999) * [-136.707] (-135.134) (-136.363) (-135.524) -- 0:00:36
377000 -- (-136.137) (-138.465) (-137.647) [-137.039] * [-136.351] (-135.801) (-135.664) (-143.875) -- 0:00:36
377500 -- [-134.866] (-135.295) (-135.354) (-135.436) * (-135.709) [-134.962] (-140.112) (-136.355) -- 0:00:36
378000 -- [-135.245] (-134.409) (-136.029) (-139.260) * (-134.879) (-135.023) (-140.866) [-138.406] -- 0:00:37
378500 -- (-137.191) (-134.980) [-135.923] (-136.700) * (-136.978) [-135.545] (-137.742) (-141.075) -- 0:00:37
379000 -- (-136.098) (-136.148) [-138.086] (-137.563) * (-136.988) (-136.805) (-137.895) [-139.531] -- 0:00:37
379500 -- (-138.629) (-135.846) [-135.685] (-139.705) * [-135.317] (-135.848) (-134.912) (-138.650) -- 0:00:37
380000 -- (-135.223) (-135.568) (-136.222) [-135.026] * (-136.415) [-137.863] (-137.788) (-137.796) -- 0:00:37
Average standard deviation of split frequencies: 0.013768
380500 -- (-136.123) (-134.153) (-137.767) [-134.258] * [-134.439] (-137.088) (-137.591) (-136.727) -- 0:00:37
381000 -- [-134.943] (-135.042) (-136.437) (-135.405) * (-137.007) (-134.943) [-134.907] (-134.917) -- 0:00:37
381500 -- (-139.684) [-137.209] (-136.253) (-134.769) * (-135.334) [-137.313] (-134.460) (-136.464) -- 0:00:37
382000 -- (-136.662) (-137.922) [-134.968] (-136.742) * (-134.613) (-135.429) (-134.080) [-134.462] -- 0:00:37
382500 -- (-136.038) (-139.287) [-134.959] (-136.417) * (-135.815) [-134.878] (-143.785) (-137.683) -- 0:00:37
383000 -- [-135.483] (-134.209) (-134.404) (-135.702) * [-135.647] (-135.637) (-138.211) (-134.640) -- 0:00:37
383500 -- [-136.520] (-134.500) (-136.791) (-137.464) * [-136.904] (-135.957) (-139.996) (-137.943) -- 0:00:36
384000 -- (-134.667) [-135.565] (-137.426) (-137.267) * [-134.888] (-137.469) (-138.799) (-136.840) -- 0:00:36
384500 -- (-136.905) (-134.462) [-136.670] (-136.445) * (-138.429) (-135.505) [-139.123] (-136.954) -- 0:00:36
385000 -- (-134.632) [-134.914] (-136.343) (-137.272) * [-134.518] (-134.857) (-135.452) (-135.570) -- 0:00:36
Average standard deviation of split frequencies: 0.013649
385500 -- (-133.908) (-137.117) (-135.640) [-135.937] * (-135.273) (-136.683) (-136.026) [-135.221] -- 0:00:36
386000 -- (-141.335) (-135.813) (-135.346) [-139.735] * [-134.775] (-134.766) (-137.692) (-135.500) -- 0:00:36
386500 -- [-135.782] (-135.620) (-138.222) (-135.451) * (-134.415) (-136.529) (-135.569) [-136.400] -- 0:00:36
387000 -- (-134.490) (-135.438) [-140.498] (-135.505) * [-136.860] (-136.592) (-134.518) (-134.178) -- 0:00:36
387500 -- (-139.657) (-135.570) (-141.116) [-137.028] * (-135.792) [-137.704] (-137.628) (-135.133) -- 0:00:36
388000 -- [-134.867] (-136.418) (-144.493) (-138.030) * (-136.380) (-140.328) [-135.780] (-136.024) -- 0:00:36
388500 -- (-135.330) [-134.337] (-136.005) (-134.841) * (-137.238) (-135.198) [-135.069] (-136.981) -- 0:00:36
389000 -- (-136.704) (-134.402) [-137.443] (-140.462) * (-136.037) (-136.725) [-134.609] (-136.695) -- 0:00:36
389500 -- [-135.782] (-136.712) (-137.364) (-135.439) * (-135.293) (-137.589) [-134.803] (-136.404) -- 0:00:36
390000 -- (-134.892) (-138.057) (-140.869) [-134.435] * [-133.913] (-137.209) (-135.936) (-137.865) -- 0:00:35
Average standard deviation of split frequencies: 0.013841
390500 -- (-136.312) [-136.616] (-137.541) (-134.855) * (-134.803) (-134.994) (-134.810) [-138.360] -- 0:00:35
391000 -- (-137.558) [-137.627] (-135.462) (-135.132) * (-134.450) (-135.709) (-136.243) [-140.513] -- 0:00:35
391500 -- (-141.357) [-135.461] (-135.392) (-134.640) * (-135.004) (-135.319) [-135.474] (-138.549) -- 0:00:35
392000 -- (-136.501) (-137.373) [-135.905] (-136.947) * (-136.634) [-134.304] (-137.216) (-141.360) -- 0:00:35
392500 -- [-136.039] (-134.258) (-137.084) (-134.863) * (-134.475) (-135.229) [-136.178] (-143.144) -- 0:00:35
393000 -- (-138.410) [-134.651] (-136.397) (-135.791) * [-135.660] (-136.252) (-138.271) (-140.181) -- 0:00:35
393500 -- (-135.385) [-136.271] (-139.855) (-137.146) * (-138.213) (-139.225) [-137.761] (-136.176) -- 0:00:35
394000 -- (-136.069) [-136.861] (-136.103) (-137.257) * (-134.760) [-138.964] (-136.777) (-136.231) -- 0:00:35
394500 -- (-137.705) (-136.845) [-136.137] (-134.347) * [-134.253] (-135.534) (-134.879) (-135.263) -- 0:00:35
395000 -- (-139.739) (-139.527) [-136.226] (-135.423) * (-134.631) [-137.481] (-136.612) (-137.227) -- 0:00:36
Average standard deviation of split frequencies: 0.013655
395500 -- (-135.105) (-135.298) (-139.095) [-136.824] * (-135.970) (-134.428) (-137.965) [-135.612] -- 0:00:36
396000 -- [-134.582] (-140.661) (-138.674) (-137.008) * [-135.268] (-135.555) (-135.514) (-135.126) -- 0:00:36
396500 -- [-139.861] (-137.958) (-135.583) (-136.924) * (-138.112) [-137.211] (-136.366) (-134.324) -- 0:00:36
397000 -- [-135.379] (-139.616) (-134.785) (-135.763) * (-136.750) (-136.119) (-139.157) [-140.072] -- 0:00:36
397500 -- (-136.673) (-140.887) (-140.256) [-135.125] * [-137.031] (-135.071) (-137.948) (-136.135) -- 0:00:36
398000 -- (-136.251) [-138.445] (-137.073) (-135.235) * (-134.728) (-138.046) [-136.274] (-138.161) -- 0:00:36
398500 -- (-136.546) [-135.274] (-137.691) (-138.242) * (-136.093) [-135.046] (-134.646) (-135.007) -- 0:00:36
399000 -- [-135.921] (-135.507) (-136.378) (-136.546) * (-133.864) [-138.173] (-141.259) (-135.336) -- 0:00:36
399500 -- (-135.974) [-138.217] (-137.290) (-142.719) * [-135.340] (-134.647) (-136.216) (-139.077) -- 0:00:36
400000 -- (-135.314) [-135.513] (-138.326) (-138.523) * (-134.622) (-134.762) [-137.569] (-135.261) -- 0:00:36
Average standard deviation of split frequencies: 0.013911
400500 -- [-135.474] (-135.840) (-138.270) (-135.572) * [-134.024] (-136.792) (-134.948) (-135.274) -- 0:00:35
401000 -- [-134.343] (-134.994) (-137.984) (-137.160) * (-136.995) (-138.729) [-136.059] (-135.705) -- 0:00:35
401500 -- (-135.570) (-134.900) [-135.107] (-135.860) * (-138.454) (-138.223) [-134.683] (-141.125) -- 0:00:35
402000 -- (-135.649) [-137.150] (-135.100) (-140.074) * (-139.970) [-136.372] (-138.586) (-135.320) -- 0:00:35
402500 -- (-136.759) (-134.820) [-136.322] (-135.838) * [-136.213] (-136.628) (-136.791) (-136.609) -- 0:00:35
403000 -- [-136.215] (-135.753) (-137.600) (-137.253) * (-138.664) (-134.667) [-134.079] (-135.578) -- 0:00:35
403500 -- (-136.065) (-138.530) [-137.176] (-141.289) * (-137.681) (-137.049) [-136.014] (-141.588) -- 0:00:35
404000 -- (-136.538) [-136.239] (-134.442) (-144.295) * [-134.190] (-136.103) (-139.765) (-135.081) -- 0:00:35
404500 -- (-134.994) (-136.295) (-134.984) [-138.034] * (-139.317) (-136.057) [-134.915] (-141.321) -- 0:00:35
405000 -- (-135.562) [-135.938] (-137.361) (-134.639) * (-138.915) (-135.963) (-138.762) [-137.151] -- 0:00:35
Average standard deviation of split frequencies: 0.013660
405500 -- (-136.373) (-137.970) (-134.499) [-135.223] * (-136.471) (-135.263) (-134.362) [-139.847] -- 0:00:35
406000 -- [-134.730] (-138.734) (-136.879) (-134.896) * [-135.542] (-136.642) (-137.742) (-139.299) -- 0:00:35
406500 -- (-134.281) (-137.236) (-135.005) [-136.687] * [-134.070] (-135.808) (-139.315) (-135.678) -- 0:00:35
407000 -- (-134.288) (-135.739) [-136.797] (-138.605) * (-138.706) [-136.926] (-136.868) (-134.981) -- 0:00:34
407500 -- (-136.636) [-135.434] (-135.272) (-138.707) * [-134.704] (-135.162) (-137.157) (-135.450) -- 0:00:34
408000 -- [-135.083] (-135.373) (-135.729) (-136.129) * (-137.134) (-138.409) [-135.156] (-136.457) -- 0:00:34
408500 -- (-135.669) (-135.343) [-135.562] (-140.169) * (-134.761) (-136.719) (-135.826) [-135.137] -- 0:00:34
409000 -- (-137.036) (-134.958) [-135.269] (-135.491) * [-136.501] (-138.986) (-140.779) (-136.274) -- 0:00:34
409500 -- [-135.705] (-137.527) (-136.678) (-136.331) * (-136.635) (-138.379) (-138.236) [-137.917] -- 0:00:34
410000 -- (-140.014) (-137.539) [-134.939] (-136.565) * (-136.411) [-136.316] (-144.755) (-135.985) -- 0:00:34
Average standard deviation of split frequencies: 0.013437
410500 -- [-136.873] (-136.891) (-137.316) (-134.271) * (-134.703) (-136.656) [-136.270] (-135.053) -- 0:00:34
411000 -- [-138.735] (-136.179) (-136.469) (-138.870) * (-135.586) [-135.300] (-135.551) (-136.835) -- 0:00:34
411500 -- (-139.981) (-136.136) (-137.271) [-140.405] * (-135.753) (-146.438) (-135.635) [-139.162] -- 0:00:34
412000 -- [-137.154] (-136.488) (-134.698) (-138.418) * (-136.180) [-140.051] (-134.992) (-136.450) -- 0:00:35
412500 -- (-137.082) (-138.877) [-134.640] (-134.309) * [-136.245] (-138.594) (-134.902) (-134.761) -- 0:00:35
413000 -- (-137.588) [-135.850] (-139.658) (-133.981) * (-139.794) [-135.606] (-137.158) (-134.748) -- 0:00:35
413500 -- (-138.623) [-134.821] (-135.448) (-141.288) * (-137.099) (-134.407) (-136.703) [-135.339] -- 0:00:35
414000 -- (-138.299) (-136.957) [-136.095] (-134.944) * (-140.129) [-137.795] (-139.624) (-137.160) -- 0:00:35
414500 -- (-136.411) (-135.064) [-136.912] (-140.298) * [-138.057] (-136.891) (-134.800) (-135.948) -- 0:00:35
415000 -- (-137.834) (-135.248) [-133.986] (-138.863) * (-135.989) (-136.351) (-135.010) [-137.441] -- 0:00:35
Average standard deviation of split frequencies: 0.014998
415500 -- (-134.605) (-137.443) [-135.628] (-138.727) * (-134.827) [-135.022] (-135.662) (-135.404) -- 0:00:35
416000 -- (-136.019) (-135.161) (-135.390) [-134.735] * (-136.760) (-139.347) (-137.123) [-136.981] -- 0:00:35
416500 -- (-135.023) (-135.230) (-135.975) [-135.055] * [-136.335] (-138.028) (-137.049) (-136.089) -- 0:00:35
417000 -- (-134.610) [-136.216] (-139.297) (-136.340) * [-135.881] (-137.916) (-135.086) (-137.326) -- 0:00:34
417500 -- (-134.885) (-135.398) (-137.458) [-137.195] * [-134.808] (-138.073) (-134.350) (-136.360) -- 0:00:34
418000 -- (-136.317) (-137.893) (-137.050) [-134.348] * (-134.309) [-136.242] (-138.291) (-135.356) -- 0:00:34
418500 -- (-136.108) (-134.253) (-135.197) [-139.948] * [-134.447] (-137.719) (-137.811) (-135.444) -- 0:00:34
419000 -- [-134.747] (-135.345) (-135.871) (-136.541) * (-135.902) (-136.371) [-135.228] (-137.174) -- 0:00:34
419500 -- (-134.864) [-134.817] (-139.194) (-135.235) * (-135.502) (-136.200) [-137.796] (-136.560) -- 0:00:34
420000 -- (-134.240) [-136.104] (-138.132) (-140.637) * (-137.173) (-136.515) [-137.327] (-140.449) -- 0:00:34
Average standard deviation of split frequencies: 0.014304
420500 -- (-137.838) (-135.692) [-136.614] (-138.023) * (-136.333) (-135.820) [-134.799] (-136.216) -- 0:00:34
421000 -- (-136.108) [-139.654] (-135.991) (-135.215) * (-135.848) [-135.431] (-136.328) (-137.068) -- 0:00:34
421500 -- (-135.647) (-135.066) (-134.346) [-136.769] * (-136.165) (-136.463) [-136.272] (-138.042) -- 0:00:34
422000 -- (-135.688) (-141.232) [-135.332] (-140.578) * (-135.861) (-136.993) [-135.816] (-135.310) -- 0:00:34
422500 -- (-137.977) [-136.851] (-137.094) (-138.958) * (-134.892) (-134.857) [-136.902] (-135.108) -- 0:00:34
423000 -- (-137.823) (-134.314) [-137.368] (-135.913) * [-135.483] (-134.996) (-137.681) (-139.386) -- 0:00:34
423500 -- [-139.122] (-134.748) (-135.704) (-135.944) * (-135.159) [-134.866] (-135.256) (-135.261) -- 0:00:34
424000 -- (-135.929) (-140.423) [-136.803] (-136.588) * (-137.155) (-136.127) (-135.845) [-137.598] -- 0:00:33
424500 -- [-134.472] (-137.239) (-137.544) (-142.462) * (-137.751) (-137.834) (-136.583) [-137.143] -- 0:00:33
425000 -- [-136.546] (-136.455) (-136.328) (-139.531) * (-135.930) (-138.241) (-136.327) [-134.344] -- 0:00:33
Average standard deviation of split frequencies: 0.014190
425500 -- (-135.704) (-135.605) [-138.725] (-135.612) * [-138.133] (-137.946) (-136.630) (-137.535) -- 0:00:33
426000 -- (-135.407) [-135.860] (-134.879) (-134.822) * [-135.262] (-136.051) (-137.742) (-137.287) -- 0:00:33
426500 -- [-137.199] (-134.932) (-135.544) (-136.085) * (-136.888) [-134.793] (-134.923) (-134.663) -- 0:00:33
427000 -- [-138.096] (-138.129) (-137.644) (-136.609) * (-134.250) (-136.253) [-134.781] (-135.621) -- 0:00:33
427500 -- (-138.922) (-138.083) [-137.274] (-135.530) * (-135.417) (-135.615) (-134.768) [-135.407] -- 0:00:33
428000 -- (-135.060) (-136.441) [-137.368] (-134.322) * (-139.195) (-134.699) (-138.697) [-134.879] -- 0:00:33
428500 -- [-137.550] (-138.482) (-135.468) (-135.590) * (-137.397) (-136.071) [-137.446] (-136.586) -- 0:00:33
429000 -- (-139.832) [-136.282] (-135.683) (-134.711) * (-137.192) (-135.198) [-137.070] (-136.061) -- 0:00:34
429500 -- (-138.452) [-136.275] (-136.397) (-138.418) * [-134.979] (-134.955) (-139.144) (-135.214) -- 0:00:34
430000 -- (-135.222) (-137.611) (-135.699) [-137.841] * (-136.428) [-139.482] (-136.591) (-135.562) -- 0:00:34
Average standard deviation of split frequencies: 0.014230
430500 -- [-139.088] (-136.015) (-136.621) (-141.900) * (-134.588) [-138.340] (-137.180) (-135.477) -- 0:00:34
431000 -- [-136.493] (-135.034) (-138.095) (-140.160) * (-139.861) (-134.384) [-138.829] (-135.522) -- 0:00:34
431500 -- (-137.382) [-135.619] (-139.472) (-135.548) * (-135.553) (-138.886) (-136.344) [-136.034] -- 0:00:34
432000 -- [-136.192] (-136.991) (-142.727) (-136.032) * [-135.378] (-136.977) (-137.762) (-137.961) -- 0:00:34
432500 -- [-135.554] (-137.597) (-135.092) (-137.083) * [-136.031] (-136.686) (-138.585) (-136.066) -- 0:00:34
433000 -- [-135.142] (-134.774) (-136.269) (-138.609) * (-139.863) [-136.985] (-136.107) (-137.335) -- 0:00:34
433500 -- (-134.350) [-134.268] (-135.541) (-137.224) * (-135.938) (-137.450) [-139.379] (-137.815) -- 0:00:33
434000 -- (-135.517) (-136.305) (-140.429) [-139.149] * (-136.732) (-135.475) [-140.691] (-137.760) -- 0:00:33
434500 -- (-143.395) [-136.729] (-142.104) (-135.050) * (-134.271) [-136.055] (-136.850) (-134.569) -- 0:00:33
435000 -- [-135.071] (-138.955) (-142.918) (-134.186) * (-136.125) [-134.895] (-134.399) (-137.864) -- 0:00:33
Average standard deviation of split frequencies: 0.014119
435500 -- [-137.709] (-144.470) (-140.514) (-135.708) * (-138.166) (-134.894) (-138.747) [-139.719] -- 0:00:33
436000 -- (-135.379) (-138.274) [-135.089] (-134.954) * (-139.693) (-136.050) (-136.264) [-137.012] -- 0:00:33
436500 -- (-135.213) (-134.996) [-136.380] (-140.641) * [-138.889] (-140.147) (-140.097) (-139.899) -- 0:00:33
437000 -- (-139.732) (-136.146) (-134.436) [-140.241] * (-138.542) [-135.636] (-136.222) (-143.012) -- 0:00:33
437500 -- (-136.919) (-137.606) [-137.942] (-134.985) * (-136.711) [-136.704] (-135.538) (-136.978) -- 0:00:33
438000 -- (-135.142) (-135.810) (-138.267) [-135.706] * (-135.162) (-136.840) [-135.373] (-135.236) -- 0:00:33
438500 -- (-136.840) (-138.232) [-135.667] (-138.705) * (-135.783) [-134.369] (-134.767) (-139.318) -- 0:00:33
439000 -- (-135.489) [-136.647] (-136.038) (-137.606) * [-135.781] (-138.254) (-137.875) (-139.722) -- 0:00:33
439500 -- [-136.425] (-136.655) (-136.421) (-135.228) * (-135.065) (-136.932) [-137.176] (-134.969) -- 0:00:33
440000 -- (-136.583) (-135.078) [-134.464] (-136.364) * (-136.925) (-137.567) [-135.803] (-136.368) -- 0:00:33
Average standard deviation of split frequencies: 0.013506
440500 -- [-135.336] (-138.204) (-134.400) (-135.636) * (-134.390) (-138.336) (-138.105) [-138.065] -- 0:00:33
441000 -- (-137.532) (-135.741) (-137.793) [-135.143] * (-136.450) (-142.039) [-136.781] (-141.220) -- 0:00:32
441500 -- (-139.507) (-135.911) [-135.069] (-138.908) * [-137.426] (-135.800) (-136.610) (-136.628) -- 0:00:32
442000 -- (-141.118) (-139.159) [-137.345] (-135.997) * [-135.392] (-134.620) (-134.461) (-137.893) -- 0:00:32
442500 -- (-137.684) (-139.179) [-134.350] (-137.052) * [-134.963] (-135.929) (-135.828) (-139.058) -- 0:00:32
443000 -- (-136.654) (-138.092) (-134.847) [-137.389] * (-135.171) [-136.810] (-134.708) (-140.331) -- 0:00:32
443500 -- [-135.260] (-137.591) (-141.020) (-137.721) * (-136.147) (-138.984) [-138.455] (-135.607) -- 0:00:32
444000 -- (-136.612) (-135.124) [-135.767] (-135.008) * (-135.723) (-135.226) (-138.509) [-136.513] -- 0:00:32
444500 -- (-134.537) (-134.524) [-135.029] (-135.416) * (-138.279) (-135.265) (-134.860) [-136.850] -- 0:00:32
445000 -- (-135.625) (-135.713) [-134.738] (-135.455) * (-136.182) [-135.042] (-134.908) (-135.172) -- 0:00:32
Average standard deviation of split frequencies: 0.013492
445500 -- [-135.652] (-134.995) (-138.727) (-136.046) * (-135.680) [-135.324] (-135.262) (-139.741) -- 0:00:33
446000 -- [-138.599] (-135.920) (-135.697) (-134.743) * (-138.603) [-135.244] (-136.745) (-135.763) -- 0:00:33
446500 -- [-135.192] (-137.021) (-139.480) (-136.304) * [-139.240] (-138.514) (-137.241) (-139.950) -- 0:00:33
447000 -- [-135.519] (-135.935) (-136.671) (-137.536) * (-137.314) (-138.774) (-136.955) [-136.799] -- 0:00:33
447500 -- [-135.305] (-137.617) (-134.083) (-140.005) * (-134.918) (-141.490) [-134.350] (-143.470) -- 0:00:33
448000 -- [-135.816] (-134.748) (-134.661) (-136.674) * (-138.026) (-137.349) (-134.671) [-143.306] -- 0:00:33
448500 -- (-135.362) (-136.709) [-134.412] (-134.635) * [-136.879] (-139.479) (-135.875) (-139.819) -- 0:00:33
449000 -- (-135.555) [-138.595] (-135.532) (-135.377) * (-139.167) (-135.367) (-135.692) [-135.704] -- 0:00:33
449500 -- (-137.258) (-139.144) [-135.714] (-136.639) * (-134.684) [-136.814] (-136.340) (-134.451) -- 0:00:33
450000 -- (-136.523) (-136.459) [-138.184] (-138.104) * (-135.710) (-137.202) [-134.623] (-136.932) -- 0:00:33
Average standard deviation of split frequencies: 0.012879
450500 -- (-135.368) (-136.777) (-135.276) [-138.387] * [-135.595] (-138.242) (-135.782) (-144.404) -- 0:00:32
451000 -- [-141.949] (-134.927) (-137.395) (-137.081) * (-135.853) (-137.432) (-137.180) [-137.803] -- 0:00:32
451500 -- (-136.198) (-136.579) [-136.108] (-134.569) * (-135.200) (-135.003) [-135.730] (-140.299) -- 0:00:32
452000 -- (-136.956) [-138.750] (-134.694) (-135.255) * (-138.235) [-135.131] (-134.638) (-135.943) -- 0:00:32
452500 -- [-134.936] (-134.723) (-136.224) (-136.924) * (-134.669) (-135.767) [-136.021] (-135.597) -- 0:00:32
453000 -- (-137.736) (-136.819) (-142.089) [-135.540] * (-138.279) (-136.233) (-139.896) [-136.882] -- 0:00:32
453500 -- (-135.684) (-137.126) (-136.933) [-134.467] * (-135.998) [-135.317] (-135.070) (-137.606) -- 0:00:32
454000 -- (-135.073) (-135.028) (-136.205) [-135.312] * (-135.917) (-139.075) [-137.760] (-138.902) -- 0:00:32
454500 -- [-135.177] (-134.871) (-137.636) (-135.931) * (-135.455) (-135.303) [-136.478] (-140.572) -- 0:00:32
455000 -- [-139.617] (-139.093) (-138.175) (-138.092) * [-137.946] (-134.691) (-136.133) (-136.820) -- 0:00:32
Average standard deviation of split frequencies: 0.012858
455500 -- (-138.460) (-135.450) [-137.991] (-135.465) * [-138.928] (-138.313) (-138.365) (-137.395) -- 0:00:32
456000 -- (-135.029) (-138.826) (-137.365) [-135.749] * (-140.717) (-137.690) [-138.683] (-135.893) -- 0:00:32
456500 -- [-136.072] (-138.826) (-135.903) (-135.127) * (-142.478) [-135.464] (-136.862) (-134.647) -- 0:00:32
457000 -- [-136.173] (-142.251) (-134.937) (-138.079) * (-136.968) (-135.880) (-134.360) [-135.532] -- 0:00:32
457500 -- [-136.572] (-139.197) (-138.993) (-135.325) * [-138.040] (-135.076) (-136.290) (-135.185) -- 0:00:32
458000 -- [-137.804] (-137.078) (-137.651) (-137.709) * (-138.175) [-135.527] (-141.267) (-134.588) -- 0:00:31
458500 -- [-135.614] (-138.744) (-134.654) (-138.254) * (-136.754) [-135.841] (-139.497) (-134.522) -- 0:00:31
459000 -- [-139.451] (-136.524) (-136.122) (-136.560) * (-138.604) (-134.162) (-134.893) [-135.384] -- 0:00:31
459500 -- (-136.326) (-139.868) [-136.051] (-137.916) * (-137.043) (-134.711) (-137.720) [-135.001] -- 0:00:31
460000 -- (-138.639) (-136.875) (-134.487) [-136.834] * (-139.895) (-135.082) [-136.657] (-138.968) -- 0:00:31
Average standard deviation of split frequencies: 0.012791
460500 -- (-136.306) (-136.320) (-136.872) [-140.568] * (-142.784) (-135.840) [-136.652] (-136.852) -- 0:00:32
461000 -- (-140.925) (-137.196) (-136.769) [-139.213] * (-141.318) [-136.582] (-134.539) (-137.614) -- 0:00:32
461500 -- [-135.379] (-135.430) (-136.046) (-138.122) * (-140.393) (-140.830) (-136.442) [-137.888] -- 0:00:32
462000 -- (-137.333) [-137.426] (-134.726) (-140.388) * (-135.895) [-135.343] (-135.508) (-134.601) -- 0:00:32
462500 -- (-135.862) [-136.193] (-137.882) (-134.995) * (-136.022) [-135.476] (-136.961) (-134.522) -- 0:00:32
463000 -- (-136.804) (-141.809) [-135.721] (-138.552) * [-138.210] (-135.857) (-137.545) (-134.824) -- 0:00:32
463500 -- (-135.789) (-136.444) [-135.972] (-135.051) * [-135.591] (-137.498) (-137.040) (-134.809) -- 0:00:32
464000 -- [-137.876] (-140.636) (-140.548) (-135.411) * (-134.454) (-140.400) (-135.410) [-135.386] -- 0:00:32
464500 -- (-137.627) (-135.422) [-135.379] (-137.258) * (-139.285) [-138.116] (-138.970) (-135.466) -- 0:00:32
465000 -- (-145.001) (-134.630) [-135.525] (-135.658) * [-137.546] (-135.731) (-136.037) (-137.010) -- 0:00:32
Average standard deviation of split frequencies: 0.013210
465500 -- (-135.714) (-136.010) (-136.886) [-140.259] * [-135.284] (-136.887) (-134.843) (-136.159) -- 0:00:32
466000 -- [-136.279] (-135.358) (-135.958) (-134.874) * [-135.691] (-137.135) (-136.535) (-135.301) -- 0:00:32
466500 -- [-136.035] (-139.130) (-136.283) (-134.126) * (-134.422) [-138.609] (-138.923) (-138.692) -- 0:00:32
467000 -- (-134.980) [-137.118] (-137.144) (-136.788) * (-135.635) [-135.120] (-137.032) (-135.964) -- 0:00:31
467500 -- (-137.916) (-138.477) (-134.897) [-136.397] * (-134.835) (-139.076) (-137.775) [-135.726] -- 0:00:31
468000 -- (-135.038) (-136.704) [-138.480] (-137.276) * (-136.277) [-136.753] (-136.843) (-135.439) -- 0:00:31
468500 -- (-139.070) [-135.789] (-141.216) (-134.713) * (-138.907) (-134.589) (-136.695) [-135.111] -- 0:00:31
469000 -- [-137.867] (-135.388) (-136.485) (-142.195) * (-135.784) (-134.554) (-138.221) [-137.911] -- 0:00:31
469500 -- (-136.457) [-134.449] (-135.118) (-141.742) * [-136.540] (-137.238) (-137.299) (-135.020) -- 0:00:31
470000 -- (-134.260) (-134.855) [-137.153] (-135.854) * (-134.111) (-135.485) (-135.859) [-137.419] -- 0:00:31
Average standard deviation of split frequencies: 0.014081
470500 -- (-138.681) (-136.044) (-136.457) [-135.481] * [-138.834] (-136.995) (-136.095) (-140.636) -- 0:00:31
471000 -- (-139.620) (-137.025) (-137.311) [-134.611] * [-135.834] (-137.194) (-136.431) (-138.572) -- 0:00:31
471500 -- (-136.542) (-134.390) (-137.345) [-136.140] * (-136.867) (-137.374) [-136.123] (-137.064) -- 0:00:31
472000 -- (-139.273) (-135.626) [-135.737] (-137.376) * (-135.987) [-136.725] (-134.364) (-135.111) -- 0:00:31
472500 -- (-137.504) (-137.397) (-134.038) [-135.702] * (-136.474) (-135.668) [-135.668] (-136.048) -- 0:00:31
473000 -- (-136.854) (-139.203) (-134.336) [-136.898] * (-136.272) [-138.352] (-138.381) (-137.476) -- 0:00:31
473500 -- (-142.487) (-135.560) (-139.108) [-136.512] * (-137.141) (-140.712) (-137.254) [-135.010] -- 0:00:31
474000 -- (-138.078) (-135.323) [-137.394] (-136.081) * [-135.273] (-142.782) (-137.628) (-137.590) -- 0:00:31
474500 -- (-137.102) (-135.445) [-136.780] (-136.736) * [-134.686] (-137.773) (-135.101) (-137.243) -- 0:00:31
475000 -- (-135.600) (-139.946) (-136.372) [-140.499] * (-134.163) (-138.956) [-136.022] (-135.390) -- 0:00:30
Average standard deviation of split frequencies: 0.014040
475500 -- [-137.256] (-136.253) (-134.932) (-137.150) * (-137.243) (-137.569) (-142.115) [-138.595] -- 0:00:30
476000 -- (-135.689) (-134.364) (-135.808) [-138.286] * [-137.978] (-135.817) (-139.053) (-137.497) -- 0:00:30
476500 -- (-137.642) (-136.084) (-135.096) [-134.948] * [-135.194] (-134.831) (-138.174) (-142.089) -- 0:00:30
477000 -- [-137.744] (-135.158) (-135.784) (-135.917) * (-137.021) (-135.447) [-135.939] (-137.264) -- 0:00:30
477500 -- (-137.326) (-138.510) (-135.695) [-137.014] * [-135.864] (-141.502) (-136.331) (-135.706) -- 0:00:31
478000 -- (-136.003) (-135.724) (-135.202) [-136.282] * [-137.095] (-135.963) (-137.598) (-135.478) -- 0:00:31
478500 -- (-136.418) (-137.294) (-141.067) [-134.829] * (-138.063) [-134.414] (-135.983) (-135.663) -- 0:00:31
479000 -- [-136.941] (-140.678) (-139.973) (-136.571) * (-135.418) (-135.131) (-135.932) [-134.889] -- 0:00:31
479500 -- (-135.771) [-136.687] (-137.686) (-135.711) * (-134.936) (-134.943) [-134.716] (-137.176) -- 0:00:31
480000 -- (-136.450) (-136.951) [-136.571] (-134.194) * (-135.090) [-136.849] (-134.762) (-137.063) -- 0:00:31
Average standard deviation of split frequencies: 0.014711
480500 -- [-135.350] (-140.239) (-134.707) (-136.213) * (-134.646) [-139.214] (-134.710) (-137.771) -- 0:00:31
481000 -- (-134.845) (-137.251) (-136.905) [-134.967] * (-138.207) [-136.675] (-136.521) (-136.632) -- 0:00:31
481500 -- (-134.450) [-134.796] (-138.076) (-137.424) * (-135.249) (-137.267) [-135.594] (-136.696) -- 0:00:31
482000 -- [-137.257] (-135.331) (-135.079) (-137.104) * (-137.872) (-136.125) (-135.471) [-135.027] -- 0:00:31
482500 -- [-135.606] (-135.024) (-138.614) (-136.889) * (-137.815) [-136.253] (-140.526) (-137.074) -- 0:00:31
483000 -- (-137.064) [-136.112] (-137.751) (-134.994) * (-135.520) (-135.168) [-135.742] (-136.480) -- 0:00:31
483500 -- (-136.995) (-139.378) [-137.782] (-135.531) * [-134.345] (-137.540) (-139.169) (-136.094) -- 0:00:30
484000 -- [-136.290] (-136.149) (-137.187) (-135.723) * [-136.854] (-137.631) (-137.222) (-135.287) -- 0:00:30
484500 -- (-139.423) (-134.534) [-136.542] (-136.436) * (-137.525) (-136.922) (-140.580) [-138.915] -- 0:00:30
485000 -- (-136.447) (-136.305) [-138.860] (-134.887) * [-137.164] (-140.218) (-139.254) (-135.293) -- 0:00:30
Average standard deviation of split frequencies: 0.014721
485500 -- (-135.785) (-141.270) (-137.076) [-135.220] * [-136.053] (-134.242) (-135.516) (-135.302) -- 0:00:30
486000 -- (-136.888) (-136.699) [-135.990] (-136.388) * (-135.460) [-134.588] (-137.821) (-134.112) -- 0:00:30
486500 -- (-136.756) (-138.517) (-136.763) [-135.963] * (-140.621) [-135.222] (-139.787) (-137.267) -- 0:00:30
487000 -- (-135.109) [-136.522] (-135.290) (-134.537) * [-135.893] (-134.998) (-137.739) (-138.781) -- 0:00:30
487500 -- (-135.294) [-136.448] (-135.157) (-137.981) * (-139.403) (-137.517) [-135.508] (-135.652) -- 0:00:30
488000 -- (-136.733) [-137.670] (-135.697) (-135.506) * (-137.464) (-137.283) (-137.056) [-135.450] -- 0:00:30
488500 -- (-134.601) [-135.077] (-135.641) (-135.474) * [-137.531] (-135.146) (-135.780) (-135.036) -- 0:00:30
489000 -- (-138.740) [-136.538] (-137.732) (-139.333) * [-137.086] (-137.911) (-136.834) (-136.957) -- 0:00:30
489500 -- (-137.597) (-134.570) [-136.511] (-134.849) * (-136.332) (-135.032) (-135.753) [-137.076] -- 0:00:30
490000 -- (-137.801) [-134.239] (-134.724) (-134.442) * (-136.623) (-135.971) [-137.581] (-139.990) -- 0:00:30
Average standard deviation of split frequencies: 0.014468
490500 -- [-135.800] (-134.314) (-135.740) (-135.864) * [-134.171] (-137.514) (-136.419) (-137.700) -- 0:00:30
491000 -- (-138.264) [-137.861] (-137.037) (-139.404) * (-134.399) [-135.599] (-138.156) (-135.597) -- 0:00:30
491500 -- [-135.237] (-134.748) (-137.548) (-136.629) * (-134.653) [-136.037] (-134.308) (-135.619) -- 0:00:30
492000 -- (-135.236) (-134.236) (-137.382) [-135.827] * (-136.595) [-134.324] (-134.894) (-137.883) -- 0:00:29
492500 -- (-136.159) (-134.264) [-135.489] (-138.439) * (-140.229) [-139.160] (-138.146) (-137.112) -- 0:00:29
493000 -- (-136.295) [-134.811] (-136.114) (-140.645) * (-137.766) (-135.708) (-135.538) [-135.696] -- 0:00:29
493500 -- (-137.331) (-136.455) [-135.759] (-147.678) * (-144.984) (-136.692) (-138.103) [-135.741] -- 0:00:29
494000 -- (-136.408) [-138.909] (-135.856) (-135.306) * (-140.560) [-138.743] (-135.231) (-135.780) -- 0:00:30
494500 -- (-136.081) (-136.411) (-138.887) [-134.300] * (-134.883) (-134.791) [-135.093] (-136.033) -- 0:00:30
495000 -- (-137.565) (-137.902) (-136.838) [-135.778] * (-137.205) (-135.476) [-137.430] (-136.901) -- 0:00:30
Average standard deviation of split frequencies: 0.014368
495500 -- (-139.560) (-136.551) (-137.992) [-138.939] * [-139.416] (-136.016) (-136.904) (-136.317) -- 0:00:30
496000 -- (-137.212) (-135.439) [-145.058] (-138.424) * (-138.511) (-135.102) [-139.511] (-136.081) -- 0:00:30
496500 -- (-136.516) (-137.303) (-138.804) [-135.942] * (-137.256) (-134.467) (-134.531) [-135.067] -- 0:00:30
497000 -- (-136.028) [-138.126] (-138.137) (-137.032) * [-139.457] (-135.223) (-134.497) (-135.511) -- 0:00:30
497500 -- (-138.027) [-135.481] (-135.930) (-135.093) * (-134.687) [-138.178] (-134.640) (-135.870) -- 0:00:30
498000 -- (-137.002) [-136.608] (-135.119) (-137.592) * [-135.757] (-137.619) (-134.420) (-139.714) -- 0:00:30
498500 -- [-134.587] (-136.763) (-137.646) (-135.359) * (-138.063) [-135.152] (-135.750) (-136.174) -- 0:00:30
499000 -- (-135.046) [-139.143] (-134.785) (-136.581) * [-138.276] (-136.933) (-136.755) (-137.007) -- 0:00:30
499500 -- (-135.197) (-139.082) (-134.396) [-137.093] * (-137.025) (-136.155) [-137.726] (-137.517) -- 0:00:30
500000 -- (-135.738) (-142.309) [-135.538] (-138.180) * (-138.142) [-135.870] (-135.716) (-134.834) -- 0:00:30
Average standard deviation of split frequencies: 0.014622
500500 -- [-134.492] (-136.912) (-136.487) (-135.704) * (-135.032) (-138.695) [-134.793] (-136.558) -- 0:00:29
501000 -- (-135.147) (-134.985) (-136.410) [-136.877] * [-136.182] (-139.133) (-135.541) (-138.614) -- 0:00:29
501500 -- (-134.457) (-138.144) (-138.399) [-135.242] * (-135.454) (-139.331) [-135.147] (-139.288) -- 0:00:29
502000 -- [-135.974] (-136.292) (-136.575) (-138.231) * (-138.785) (-136.755) [-137.452] (-141.997) -- 0:00:29
502500 -- (-135.035) (-140.254) (-135.754) [-134.741] * (-136.030) [-134.908] (-135.704) (-138.007) -- 0:00:29
503000 -- (-136.405) [-136.537] (-140.361) (-135.559) * (-135.625) (-135.081) [-135.526] (-137.411) -- 0:00:29
503500 -- [-137.284] (-136.977) (-136.683) (-136.288) * [-136.725] (-135.055) (-142.317) (-138.935) -- 0:00:29
504000 -- [-139.634] (-136.332) (-134.776) (-135.611) * (-135.992) (-136.899) (-137.095) [-137.056] -- 0:00:29
504500 -- (-137.669) (-137.221) [-134.574] (-134.566) * (-136.149) (-136.575) (-137.477) [-137.250] -- 0:00:29
505000 -- (-137.248) (-136.961) [-135.120] (-135.857) * (-136.654) [-136.432] (-137.106) (-137.851) -- 0:00:29
Average standard deviation of split frequencies: 0.014303
505500 -- (-136.949) (-136.509) [-134.551] (-136.347) * (-138.876) (-136.871) (-135.079) [-136.307] -- 0:00:29
506000 -- (-136.581) (-134.381) [-135.444] (-138.657) * (-137.898) [-137.290] (-134.814) (-135.650) -- 0:00:29
506500 -- [-133.937] (-136.113) (-135.524) (-136.707) * (-144.288) (-134.991) (-135.262) [-139.396] -- 0:00:29
507000 -- (-136.713) (-137.739) [-136.421] (-138.252) * (-136.446) (-134.933) (-136.101) [-135.988] -- 0:00:29
507500 -- (-137.429) (-135.708) (-134.393) [-135.786] * [-134.823] (-134.564) (-136.106) (-134.744) -- 0:00:29
508000 -- (-136.601) (-135.074) (-137.994) [-134.256] * (-136.708) (-136.447) (-135.610) [-135.427] -- 0:00:29
508500 -- (-135.798) (-136.525) [-137.531] (-135.358) * [-135.411] (-135.116) (-135.527) (-136.855) -- 0:00:28
509000 -- (-136.624) (-134.984) (-135.568) [-135.922] * (-134.439) [-137.406] (-135.316) (-141.933) -- 0:00:28
509500 -- (-134.551) [-135.112] (-135.097) (-136.047) * (-138.756) (-137.397) (-135.291) [-137.823] -- 0:00:28
510000 -- (-134.276) [-137.823] (-136.535) (-136.732) * (-135.726) [-134.780] (-136.442) (-135.288) -- 0:00:28
Average standard deviation of split frequencies: 0.013847
510500 -- (-140.827) (-135.045) [-136.117] (-136.593) * [-135.409] (-136.014) (-136.835) (-139.037) -- 0:00:28
511000 -- (-134.968) (-134.297) [-134.963] (-138.472) * (-137.133) (-139.489) [-139.473] (-136.834) -- 0:00:29
511500 -- (-136.832) [-135.048] (-135.404) (-136.175) * (-137.699) (-139.847) (-139.247) [-138.324] -- 0:00:29
512000 -- (-135.799) (-134.562) (-144.619) [-134.330] * (-139.012) [-137.836] (-136.026) (-135.305) -- 0:00:29
512500 -- (-135.969) (-135.996) [-137.853] (-134.855) * (-139.039) (-137.217) [-137.258] (-136.707) -- 0:00:29
513000 -- [-135.588] (-135.268) (-135.394) (-138.578) * [-135.539] (-136.042) (-138.967) (-135.880) -- 0:00:29
513500 -- (-135.187) (-137.316) [-138.529] (-136.593) * (-135.031) [-137.352] (-138.347) (-134.583) -- 0:00:29
514000 -- (-135.726) (-135.577) [-135.932] (-136.247) * [-135.970] (-136.063) (-135.244) (-135.976) -- 0:00:29
514500 -- (-134.409) [-134.497] (-136.596) (-135.745) * (-136.819) (-143.229) (-138.433) [-135.915] -- 0:00:29
515000 -- (-134.281) (-136.011) [-136.684] (-137.140) * [-137.613] (-137.477) (-136.941) (-135.689) -- 0:00:29
Average standard deviation of split frequencies: 0.014080
515500 -- (-137.350) (-135.344) (-136.333) [-136.815] * (-135.769) (-135.163) [-135.776] (-135.536) -- 0:00:29
516000 -- [-135.632] (-136.082) (-137.892) (-135.499) * (-135.322) [-137.003] (-138.237) (-135.440) -- 0:00:29
516500 -- (-136.795) (-136.404) [-135.995] (-136.677) * (-143.871) (-135.183) (-142.485) [-134.941] -- 0:00:29
517000 -- (-138.158) (-138.705) (-135.887) [-137.698] * (-142.131) (-136.930) (-141.805) [-138.664] -- 0:00:28
517500 -- (-135.203) (-136.046) [-135.897] (-139.013) * [-138.438] (-134.198) (-139.282) (-138.368) -- 0:00:28
518000 -- (-135.500) [-134.687] (-135.038) (-135.500) * (-135.714) [-134.077] (-140.383) (-139.842) -- 0:00:28
518500 -- (-145.951) (-142.318) (-136.796) [-134.345] * (-137.074) (-134.780) [-136.542] (-136.478) -- 0:00:28
519000 -- (-140.687) (-138.136) (-136.656) [-134.795] * (-134.572) [-134.125] (-140.287) (-135.566) -- 0:00:28
519500 -- [-138.476] (-134.294) (-135.348) (-138.091) * (-137.338) (-135.283) (-140.943) [-136.227] -- 0:00:28
520000 -- (-134.614) (-137.986) [-134.259] (-138.301) * (-138.607) (-141.298) [-137.130] (-136.276) -- 0:00:28
Average standard deviation of split frequencies: 0.013741
520500 -- (-141.861) [-135.541] (-135.307) (-135.729) * (-134.761) (-138.102) (-134.985) [-138.145] -- 0:00:28
521000 -- (-137.104) (-134.219) [-134.985] (-134.878) * (-135.908) [-137.360] (-137.688) (-136.486) -- 0:00:28
521500 -- [-136.641] (-136.094) (-135.864) (-135.780) * [-137.667] (-135.723) (-134.410) (-135.815) -- 0:00:28
522000 -- (-135.282) (-139.392) (-137.178) [-135.504] * (-135.718) (-134.244) [-135.647] (-136.160) -- 0:00:28
522500 -- (-135.816) [-136.149] (-134.801) (-135.697) * (-136.252) (-135.747) [-138.651] (-135.892) -- 0:00:28
523000 -- (-137.893) (-139.863) (-135.947) [-135.443] * (-136.563) (-136.581) [-136.450] (-137.083) -- 0:00:28
523500 -- (-135.890) (-140.046) (-135.273) [-135.304] * (-136.225) [-136.912] (-136.999) (-137.827) -- 0:00:28
524000 -- (-135.582) (-136.912) (-134.515) [-134.025] * (-136.319) (-136.041) [-134.555] (-137.477) -- 0:00:28
524500 -- (-136.126) (-134.369) (-137.246) [-136.364] * (-134.640) [-136.884] (-135.050) (-136.746) -- 0:00:28
525000 -- (-135.572) [-134.406] (-136.730) (-137.430) * (-135.209) [-136.522] (-137.203) (-138.006) -- 0:00:28
Average standard deviation of split frequencies: 0.012969
525500 -- (-134.773) (-134.340) [-134.802] (-135.884) * [-137.825] (-135.511) (-136.779) (-139.050) -- 0:00:27
526000 -- (-138.795) (-138.961) [-136.125] (-137.972) * (-137.350) (-135.678) (-138.236) [-136.085] -- 0:00:27
526500 -- (-138.334) (-136.134) (-134.879) [-135.582] * (-139.959) (-135.129) (-140.006) [-137.186] -- 0:00:27
527000 -- (-137.249) (-138.045) [-135.213] (-134.725) * (-136.045) [-137.502] (-136.987) (-137.014) -- 0:00:27
527500 -- (-140.766) (-137.430) [-137.783] (-135.644) * (-135.825) (-137.475) (-135.917) [-136.276] -- 0:00:27
528000 -- (-136.170) (-136.836) (-137.277) [-135.618] * (-134.457) (-135.866) [-136.084] (-135.753) -- 0:00:28
528500 -- (-134.739) [-136.929] (-138.884) (-137.576) * (-135.437) (-135.627) (-137.592) [-136.061] -- 0:00:28
529000 -- (-139.794) [-135.461] (-141.794) (-137.005) * (-136.048) [-138.618] (-139.558) (-133.956) -- 0:00:28
529500 -- (-137.174) (-135.168) [-134.856] (-137.478) * [-137.255] (-138.890) (-137.705) (-135.279) -- 0:00:28
530000 -- (-137.537) (-134.437) [-134.330] (-138.481) * (-139.415) (-136.272) (-135.033) [-134.660] -- 0:00:28
Average standard deviation of split frequencies: 0.012698
530500 -- [-140.534] (-134.113) (-137.749) (-135.480) * (-134.638) [-137.589] (-137.061) (-137.612) -- 0:00:28
531000 -- (-134.234) (-138.249) [-136.970] (-137.072) * (-134.327) [-136.349] (-137.483) (-134.701) -- 0:00:28
531500 -- (-135.136) (-142.084) (-135.587) [-136.028] * (-135.980) (-135.259) [-135.686] (-135.251) -- 0:00:28
532000 -- (-134.638) [-139.730] (-136.722) (-135.192) * (-134.964) [-134.469] (-143.395) (-136.787) -- 0:00:28
532500 -- [-134.772] (-135.252) (-134.769) (-135.605) * (-138.871) (-135.898) (-136.289) [-136.632] -- 0:00:28
533000 -- (-135.359) [-136.540] (-136.688) (-134.436) * (-139.729) (-135.752) (-138.845) [-141.992] -- 0:00:28
533500 -- (-136.445) (-139.666) (-135.373) [-137.901] * (-136.727) (-135.995) [-135.709] (-138.272) -- 0:00:27
534000 -- (-138.252) [-136.294] (-136.006) (-137.442) * (-136.464) (-137.613) [-134.302] (-137.608) -- 0:00:27
534500 -- (-135.289) (-135.754) [-136.776] (-136.140) * (-134.992) (-136.912) [-135.472] (-138.065) -- 0:00:27
535000 -- (-137.975) (-141.082) [-138.817] (-136.418) * [-136.408] (-137.147) (-136.884) (-138.076) -- 0:00:27
Average standard deviation of split frequencies: 0.012416
535500 -- (-134.991) [-137.309] (-141.556) (-135.730) * [-135.275] (-136.004) (-134.671) (-135.545) -- 0:00:27
536000 -- (-135.958) [-136.264] (-146.973) (-135.811) * [-134.459] (-137.280) (-134.486) (-137.931) -- 0:00:27
536500 -- (-138.158) (-137.001) (-139.722) [-136.693] * (-135.602) (-138.491) [-134.839] (-136.391) -- 0:00:27
537000 -- [-135.576] (-135.999) (-136.071) (-135.925) * (-135.788) [-136.882] (-139.849) (-137.074) -- 0:00:27
537500 -- (-135.920) (-134.540) [-136.386] (-138.120) * (-136.848) (-136.772) [-139.324] (-138.340) -- 0:00:27
538000 -- (-138.014) (-134.062) [-134.970] (-134.814) * (-135.545) [-138.672] (-136.748) (-136.698) -- 0:00:27
538500 -- (-137.148) (-134.359) (-135.350) [-136.078] * [-135.247] (-140.395) (-136.038) (-139.660) -- 0:00:27
539000 -- [-139.110] (-136.032) (-138.188) (-135.993) * (-136.953) (-139.060) (-135.873) [-135.043] -- 0:00:27
539500 -- (-135.759) (-136.677) [-138.362] (-137.414) * (-136.024) (-137.437) (-134.914) [-135.001] -- 0:00:27
540000 -- (-135.406) (-135.331) [-134.953] (-135.749) * (-138.952) (-135.720) [-134.434] (-135.497) -- 0:00:27
Average standard deviation of split frequencies: 0.012155
540500 -- (-135.710) [-137.613] (-137.133) (-141.171) * (-136.970) [-135.312] (-137.066) (-135.162) -- 0:00:27
541000 -- [-139.062] (-134.684) (-138.468) (-139.937) * (-136.963) [-134.473] (-136.894) (-134.628) -- 0:00:27
541500 -- [-136.560] (-135.404) (-138.285) (-144.241) * (-140.804) [-135.023] (-135.697) (-134.355) -- 0:00:27
542000 -- [-137.425] (-134.595) (-137.907) (-144.222) * (-137.254) [-136.086] (-135.305) (-136.696) -- 0:00:27
542500 -- [-136.718] (-136.912) (-135.310) (-140.630) * (-136.295) [-134.894] (-135.434) (-136.143) -- 0:00:26
543000 -- (-138.321) (-137.898) (-137.948) [-136.817] * (-136.004) (-139.209) (-139.737) [-134.793] -- 0:00:26
543500 -- (-134.527) [-137.141] (-136.298) (-137.435) * (-137.110) (-137.659) (-135.427) [-133.988] -- 0:00:26
544000 -- [-135.198] (-139.687) (-138.398) (-137.749) * (-137.006) [-135.191] (-136.914) (-133.977) -- 0:00:26
544500 -- [-135.404] (-138.221) (-141.091) (-134.481) * (-141.338) (-136.086) [-138.757] (-138.145) -- 0:00:26
545000 -- [-135.127] (-137.948) (-140.900) (-135.710) * (-138.930) (-135.814) [-137.696] (-140.245) -- 0:00:26
Average standard deviation of split frequencies: 0.011847
545500 -- (-134.255) (-141.527) [-135.526] (-139.305) * (-139.916) [-136.573] (-134.629) (-138.800) -- 0:00:27
546000 -- (-134.672) (-134.730) (-135.578) [-137.624] * [-135.679] (-136.053) (-134.024) (-136.018) -- 0:00:27
546500 -- (-138.414) [-135.153] (-136.355) (-137.653) * (-135.773) [-136.140] (-138.545) (-139.313) -- 0:00:27
547000 -- [-134.525] (-134.797) (-137.359) (-136.890) * [-133.881] (-137.438) (-138.494) (-136.094) -- 0:00:27
547500 -- (-136.257) (-136.088) [-135.026] (-135.011) * (-134.416) (-137.954) [-135.557] (-136.068) -- 0:00:27
548000 -- [-135.571] (-136.706) (-135.444) (-135.113) * [-136.829] (-138.533) (-134.792) (-137.409) -- 0:00:27
548500 -- (-135.349) (-136.648) (-134.644) [-136.692] * [-134.787] (-134.627) (-135.660) (-139.440) -- 0:00:27
549000 -- (-136.850) (-135.151) [-134.256] (-133.911) * (-136.814) [-134.544] (-138.434) (-136.138) -- 0:00:27
549500 -- (-137.110) (-137.924) [-134.329] (-136.140) * (-138.257) [-134.429] (-136.769) (-142.317) -- 0:00:27
550000 -- (-136.493) (-135.313) (-136.300) [-134.317] * (-135.901) (-134.626) [-136.607] (-136.374) -- 0:00:27
Average standard deviation of split frequencies: 0.012080
550500 -- [-134.759] (-136.600) (-137.602) (-136.393) * (-136.688) [-135.715] (-137.049) (-139.748) -- 0:00:26
551000 -- [-135.538] (-134.261) (-141.978) (-136.326) * [-137.054] (-135.315) (-137.348) (-138.291) -- 0:00:26
551500 -- (-135.622) (-136.174) (-138.358) [-134.352] * (-135.574) [-134.772] (-138.479) (-138.786) -- 0:00:26
552000 -- (-136.531) [-136.268] (-137.052) (-138.345) * [-135.005] (-136.463) (-135.557) (-137.330) -- 0:00:26
552500 -- (-134.813) (-136.838) [-138.545] (-137.488) * [-135.092] (-136.331) (-140.201) (-134.746) -- 0:00:26
553000 -- [-134.928] (-141.048) (-136.543) (-138.463) * [-134.366] (-134.854) (-138.048) (-136.129) -- 0:00:26
553500 -- (-135.308) [-134.587] (-136.109) (-138.445) * (-135.207) (-135.822) [-137.130] (-137.091) -- 0:00:26
554000 -- (-136.850) (-135.889) (-138.866) [-137.320] * [-138.916] (-135.728) (-134.488) (-137.839) -- 0:00:26
554500 -- (-136.595) [-136.496] (-135.943) (-136.435) * (-136.137) [-136.031] (-137.312) (-137.199) -- 0:00:26
555000 -- [-135.978] (-134.943) (-134.706) (-135.760) * (-136.179) (-136.890) (-138.748) [-137.871] -- 0:00:26
Average standard deviation of split frequencies: 0.011271
555500 -- (-134.931) (-136.766) (-138.894) [-136.909] * [-135.427] (-138.937) (-135.615) (-135.808) -- 0:00:26
556000 -- [-137.313] (-137.905) (-141.801) (-134.597) * [-136.464] (-138.233) (-135.727) (-136.186) -- 0:00:26
556500 -- (-137.358) [-136.622] (-135.469) (-134.463) * (-135.150) (-138.729) (-137.871) [-136.497] -- 0:00:26
557000 -- (-138.951) [-134.685] (-135.483) (-136.197) * (-137.521) (-136.194) [-137.390] (-136.186) -- 0:00:26
557500 -- (-136.132) (-135.117) [-134.032] (-137.998) * (-137.311) [-135.449] (-139.442) (-135.813) -- 0:00:26
558000 -- [-135.631] (-134.282) (-136.152) (-139.201) * [-138.361] (-138.054) (-135.339) (-134.855) -- 0:00:26
558500 -- (-136.842) (-135.092) (-134.916) [-135.268] * (-137.028) [-136.500] (-136.934) (-135.895) -- 0:00:26
559000 -- [-136.636] (-134.322) (-136.267) (-134.971) * (-138.323) [-137.122] (-134.649) (-142.227) -- 0:00:26
559500 -- (-137.166) (-135.289) [-135.537] (-135.393) * (-134.904) (-145.474) (-138.087) [-135.457] -- 0:00:25
560000 -- (-134.716) [-134.863] (-135.568) (-138.671) * (-139.837) (-138.707) [-139.519] (-137.122) -- 0:00:25
Average standard deviation of split frequencies: 0.011573
560500 -- (-137.059) (-141.289) [-138.798] (-139.122) * (-138.552) (-140.648) (-136.134) [-135.043] -- 0:00:25
561000 -- (-137.858) [-135.376] (-138.033) (-138.394) * (-136.327) [-140.973] (-138.619) (-138.545) -- 0:00:25
561500 -- [-137.061] (-137.513) (-138.291) (-138.986) * (-136.590) [-137.065] (-135.373) (-139.958) -- 0:00:25
562000 -- (-138.117) (-137.489) (-141.815) [-138.176] * [-135.478] (-134.643) (-143.042) (-136.540) -- 0:00:26
562500 -- (-135.907) (-137.680) (-136.183) [-134.986] * (-138.677) [-134.750] (-137.157) (-138.542) -- 0:00:26
563000 -- (-135.231) (-137.245) (-137.314) [-136.845] * (-135.285) [-137.740] (-135.209) (-136.310) -- 0:00:26
563500 -- (-136.271) [-137.886] (-138.650) (-134.649) * [-136.123] (-135.802) (-137.150) (-138.598) -- 0:00:26
564000 -- [-137.230] (-136.138) (-137.391) (-141.308) * (-138.772) [-135.218] (-136.900) (-140.377) -- 0:00:26
564500 -- (-141.036) (-136.456) [-134.763] (-139.085) * [-136.869] (-137.391) (-135.244) (-137.705) -- 0:00:26
565000 -- (-138.609) (-136.696) [-136.314] (-140.486) * (-139.768) (-138.612) [-137.833] (-134.798) -- 0:00:26
Average standard deviation of split frequencies: 0.011709
565500 -- [-135.867] (-134.807) (-139.260) (-135.925) * (-135.473) [-134.827] (-139.666) (-137.920) -- 0:00:26
566000 -- [-135.577] (-135.398) (-137.771) (-137.964) * (-136.755) (-137.303) [-136.727] (-137.187) -- 0:00:26
566500 -- [-136.660] (-136.881) (-136.158) (-137.602) * [-137.791] (-137.648) (-136.071) (-134.795) -- 0:00:26
567000 -- (-135.516) (-137.456) (-135.435) [-136.704] * [-135.144] (-136.554) (-134.938) (-135.138) -- 0:00:25
567500 -- (-140.871) [-134.592] (-136.375) (-139.668) * (-134.881) (-134.170) (-138.742) [-135.709] -- 0:00:25
568000 -- (-138.249) [-135.782] (-136.499) (-136.250) * (-137.262) (-136.140) [-135.080] (-135.037) -- 0:00:25
568500 -- [-138.297] (-134.831) (-134.811) (-141.543) * (-136.357) [-134.447] (-140.704) (-137.376) -- 0:00:25
569000 -- [-137.438] (-136.932) (-135.688) (-144.809) * [-134.951] (-137.487) (-134.880) (-137.036) -- 0:00:25
569500 -- [-135.514] (-138.107) (-139.712) (-144.745) * [-135.496] (-138.412) (-139.143) (-135.893) -- 0:00:25
570000 -- (-135.110) (-135.696) [-137.261] (-140.446) * (-135.630) [-134.366] (-135.731) (-137.499) -- 0:00:25
Average standard deviation of split frequencies: 0.011662
570500 -- [-136.158] (-135.454) (-140.369) (-139.068) * (-135.046) (-138.738) (-136.234) [-137.160] -- 0:00:25
571000 -- (-134.925) (-141.998) [-135.809] (-134.289) * (-134.848) (-135.724) (-138.963) [-138.080] -- 0:00:25
571500 -- (-138.996) (-141.739) (-136.131) [-137.850] * (-137.895) (-135.838) [-135.590] (-135.285) -- 0:00:25
572000 -- (-137.842) [-138.095] (-135.186) (-136.352) * [-135.575] (-134.504) (-136.734) (-135.986) -- 0:00:25
572500 -- (-135.123) (-137.730) [-137.739] (-135.601) * [-136.181] (-135.402) (-136.533) (-135.488) -- 0:00:25
573000 -- (-135.751) (-135.349) (-137.525) [-136.212] * [-137.888] (-138.883) (-137.746) (-137.349) -- 0:00:25
573500 -- (-135.638) [-135.673] (-138.075) (-139.021) * (-138.195) (-134.835) [-137.260] (-136.783) -- 0:00:25
574000 -- (-134.353) (-135.673) (-135.468) [-137.335] * (-135.273) (-137.017) [-137.646] (-135.202) -- 0:00:25
574500 -- (-136.092) (-141.824) (-135.222) [-134.783] * (-135.420) (-137.252) [-135.822] (-134.773) -- 0:00:25
575000 -- (-134.335) (-135.314) (-135.089) [-134.553] * (-142.692) (-135.053) [-135.033] (-138.999) -- 0:00:25
Average standard deviation of split frequencies: 0.010486
575500 -- [-134.030] (-135.259) (-135.872) (-136.021) * (-135.967) (-138.600) [-136.240] (-136.859) -- 0:00:25
576000 -- (-135.253) (-135.531) [-134.901] (-138.089) * (-138.301) [-138.049] (-135.177) (-140.761) -- 0:00:25
576500 -- [-135.026] (-140.309) (-134.426) (-137.057) * (-135.001) [-134.181] (-136.510) (-135.403) -- 0:00:24
577000 -- (-137.217) (-136.205) [-136.407] (-136.049) * (-136.989) (-136.565) [-134.557] (-135.594) -- 0:00:24
577500 -- [-134.991] (-135.797) (-138.254) (-137.244) * [-136.616] (-137.459) (-138.254) (-136.518) -- 0:00:24
578000 -- [-136.537] (-137.516) (-135.030) (-136.161) * (-136.443) [-143.480] (-140.158) (-135.152) -- 0:00:24
578500 -- (-134.584) (-135.608) [-137.081] (-135.794) * (-138.028) (-139.873) (-136.704) [-137.256] -- 0:00:25
579000 -- (-135.355) (-136.296) (-138.048) [-134.403] * (-140.279) (-135.430) (-134.514) [-135.700] -- 0:00:25
579500 -- (-134.924) [-142.596] (-135.688) (-135.024) * (-136.333) (-134.373) [-134.693] (-135.251) -- 0:00:25
580000 -- [-136.064] (-134.611) (-136.806) (-134.729) * [-134.931] (-136.889) (-134.922) (-135.677) -- 0:00:25
Average standard deviation of split frequencies: 0.010602
580500 -- [-137.990] (-136.181) (-141.466) (-141.525) * (-134.769) (-139.186) [-135.146] (-135.472) -- 0:00:25
581000 -- (-136.003) [-140.584] (-136.792) (-140.640) * (-140.748) (-136.554) [-134.397] (-136.762) -- 0:00:25
581500 -- [-135.728] (-135.817) (-135.533) (-135.244) * [-134.174] (-135.014) (-136.751) (-134.563) -- 0:00:25
582000 -- (-138.317) [-135.625] (-137.738) (-136.934) * (-135.194) (-136.005) (-135.656) [-137.943] -- 0:00:25
582500 -- (-136.381) [-134.497] (-134.963) (-134.391) * (-136.078) (-136.106) (-134.092) [-134.705] -- 0:00:25
583000 -- (-137.799) (-136.076) [-135.574] (-136.962) * (-134.687) (-134.619) [-134.599] (-135.779) -- 0:00:25
583500 -- (-140.062) (-136.390) [-137.474] (-141.559) * (-134.692) (-137.721) [-140.675] (-143.591) -- 0:00:24
584000 -- (-136.228) (-140.379) (-134.173) [-137.546] * (-137.778) [-138.001] (-135.791) (-138.314) -- 0:00:24
584500 -- (-136.619) (-134.618) [-134.439] (-138.380) * (-134.890) [-134.051] (-137.037) (-135.344) -- 0:00:24
585000 -- (-135.506) (-136.448) (-137.023) [-135.404] * (-135.205) [-135.531] (-135.105) (-137.805) -- 0:00:24
Average standard deviation of split frequencies: 0.010268
585500 -- (-134.797) (-135.721) (-135.362) [-135.173] * (-142.661) (-134.620) [-135.003] (-135.996) -- 0:00:24
586000 -- (-136.628) (-136.561) (-140.136) [-137.585] * (-139.500) (-136.134) (-133.970) [-135.306] -- 0:00:24
586500 -- (-137.567) (-136.253) [-135.191] (-135.672) * (-138.899) (-136.080) (-134.359) [-135.909] -- 0:00:24
587000 -- [-136.591] (-134.856) (-135.510) (-136.639) * (-135.269) (-135.577) [-139.409] (-135.470) -- 0:00:24
587500 -- (-140.434) (-134.862) (-138.645) [-134.470] * (-135.253) (-137.734) (-136.733) [-134.313] -- 0:00:24
588000 -- (-135.506) (-139.560) (-139.307) [-135.886] * (-140.070) (-137.078) (-137.468) [-136.857] -- 0:00:24
588500 -- (-139.486) [-135.725] (-137.305) (-135.978) * (-135.881) (-135.244) [-136.650] (-139.082) -- 0:00:24
589000 -- (-134.792) (-140.554) [-139.248] (-134.792) * [-134.600] (-136.399) (-137.286) (-135.724) -- 0:00:24
589500 -- (-135.357) [-135.419] (-135.352) (-135.679) * (-136.617) (-140.086) (-137.778) [-138.287] -- 0:00:24
590000 -- (-135.566) (-137.185) [-135.051] (-136.113) * (-135.184) [-134.386] (-136.536) (-137.325) -- 0:00:24
Average standard deviation of split frequencies: 0.010610
590500 -- (-138.961) (-134.899) [-135.986] (-135.583) * [-135.276] (-137.441) (-135.861) (-135.690) -- 0:00:24
591000 -- [-136.310] (-134.762) (-135.714) (-136.230) * (-134.473) [-135.571] (-137.938) (-134.449) -- 0:00:24
591500 -- (-135.083) (-134.572) (-136.037) [-137.557] * (-136.494) [-137.990] (-135.830) (-139.218) -- 0:00:24
592000 -- [-135.897] (-135.127) (-135.005) (-135.756) * (-135.501) [-138.037] (-137.600) (-136.266) -- 0:00:24
592500 -- (-140.426) [-135.011] (-136.040) (-135.041) * [-137.911] (-136.063) (-135.025) (-135.314) -- 0:00:24
593000 -- (-139.165) [-134.552] (-135.404) (-136.021) * (-135.382) (-134.520) (-136.646) [-136.488] -- 0:00:24
593500 -- (-134.268) [-136.601] (-137.048) (-137.996) * (-136.278) (-136.074) [-136.213] (-140.901) -- 0:00:23
594000 -- (-136.157) (-134.087) [-137.294] (-137.745) * (-135.232) (-136.289) [-136.111] (-137.964) -- 0:00:24
594500 -- (-141.253) [-137.326] (-137.205) (-136.169) * [-135.253] (-137.689) (-136.558) (-139.647) -- 0:00:24
595000 -- (-140.844) (-136.775) [-134.949] (-135.298) * [-135.735] (-138.089) (-135.167) (-136.662) -- 0:00:24
Average standard deviation of split frequencies: 0.009689
595500 -- (-140.925) (-135.029) [-136.290] (-135.353) * (-134.636) (-134.549) (-134.059) [-135.138] -- 0:00:24
596000 -- (-136.928) (-136.975) [-135.167] (-138.334) * (-135.847) (-135.296) [-134.383] (-135.998) -- 0:00:24
596500 -- [-138.095] (-134.452) (-136.176) (-136.732) * (-134.267) (-136.190) [-134.712] (-136.804) -- 0:00:24
597000 -- [-136.430] (-135.079) (-135.064) (-134.443) * (-134.476) (-136.596) [-136.516] (-134.496) -- 0:00:24
597500 -- (-137.062) (-134.551) [-137.328] (-135.174) * (-137.640) (-138.158) [-135.030] (-136.771) -- 0:00:24
598000 -- (-137.835) (-135.075) [-135.823] (-135.375) * [-135.135] (-138.802) (-135.739) (-136.347) -- 0:00:24
598500 -- (-136.124) (-135.249) (-136.410) [-134.239] * (-135.566) (-136.378) [-135.872] (-135.952) -- 0:00:24
599000 -- (-139.463) [-135.266] (-139.296) (-135.775) * [-135.354] (-136.763) (-135.492) (-135.495) -- 0:00:24
599500 -- (-136.610) (-136.741) (-136.209) [-135.462] * (-136.467) (-138.825) [-138.921] (-138.412) -- 0:00:24
600000 -- [-135.368] (-136.788) (-137.790) (-137.454) * (-136.879) (-134.795) [-136.156] (-137.641) -- 0:00:24
Average standard deviation of split frequencies: 0.009663
600500 -- (-139.023) (-134.598) (-137.098) [-139.553] * [-140.070] (-135.333) (-134.643) (-136.152) -- 0:00:23
601000 -- [-135.080] (-136.109) (-136.084) (-135.402) * (-135.128) (-135.020) (-138.073) [-136.508] -- 0:00:23
601500 -- (-135.820) (-137.281) [-137.241] (-136.653) * (-136.892) (-134.879) (-135.699) [-134.810] -- 0:00:23
602000 -- [-135.063] (-137.924) (-138.214) (-135.755) * (-134.935) [-135.281] (-134.174) (-134.878) -- 0:00:23
602500 -- [-134.720] (-136.862) (-136.606) (-136.777) * (-135.425) (-136.761) [-135.709] (-138.830) -- 0:00:23
603000 -- (-136.085) [-133.868] (-136.909) (-135.833) * (-135.565) (-138.581) [-136.954] (-134.804) -- 0:00:23
603500 -- (-140.977) (-137.139) (-138.347) [-136.195] * [-134.878] (-138.631) (-136.962) (-137.922) -- 0:00:23
604000 -- (-137.137) [-137.539] (-137.548) (-134.798) * (-135.592) [-137.410] (-136.899) (-138.177) -- 0:00:23
604500 -- [-135.721] (-134.754) (-138.481) (-137.170) * (-135.863) [-135.101] (-138.534) (-137.239) -- 0:00:23
605000 -- [-134.434] (-134.991) (-141.338) (-134.684) * (-136.128) (-134.335) [-134.942] (-136.180) -- 0:00:23
Average standard deviation of split frequencies: 0.009481
605500 -- (-136.072) [-137.642] (-141.155) (-134.740) * (-140.299) (-135.847) [-136.707] (-135.543) -- 0:00:23
606000 -- (-140.157) (-134.759) (-139.187) [-135.290] * (-139.703) (-135.416) [-136.110] (-134.463) -- 0:00:23
606500 -- (-141.523) (-137.034) [-135.534] (-137.297) * (-136.765) [-139.633] (-136.081) (-137.277) -- 0:00:23
607000 -- [-138.310] (-138.455) (-136.453) (-138.433) * [-135.714] (-138.423) (-137.255) (-138.774) -- 0:00:23
607500 -- (-140.235) (-134.837) [-135.456] (-137.240) * (-134.915) (-137.372) [-136.338] (-135.800) -- 0:00:23
608000 -- (-143.265) (-135.081) [-135.033] (-139.601) * (-138.916) [-135.762] (-135.486) (-135.675) -- 0:00:23
608500 -- (-135.143) (-136.734) [-139.419] (-135.605) * (-142.440) (-138.281) [-135.367] (-135.387) -- 0:00:23
609000 -- (-136.688) (-143.140) [-137.961] (-136.602) * (-134.373) [-135.668] (-135.452) (-134.853) -- 0:00:23
609500 -- (-141.061) (-135.829) [-136.340] (-135.541) * (-134.988) (-136.566) [-138.858] (-136.428) -- 0:00:23
610000 -- (-140.812) [-137.237] (-134.551) (-134.993) * (-138.701) (-135.682) (-135.418) [-136.443] -- 0:00:23
Average standard deviation of split frequencies: 0.009601
610500 -- (-138.541) (-135.968) [-134.819] (-137.094) * (-137.818) (-139.996) (-135.890) [-134.362] -- 0:00:22
611000 -- (-139.162) (-134.272) (-135.896) [-135.376] * (-134.995) [-136.785] (-134.980) (-135.255) -- 0:00:23
611500 -- (-138.776) (-134.266) [-136.729] (-143.442) * (-135.717) (-136.505) (-134.236) [-138.424] -- 0:00:23
612000 -- (-137.112) [-137.108] (-135.340) (-144.120) * (-138.651) (-135.704) [-138.749] (-138.175) -- 0:00:23
612500 -- (-135.426) [-143.223] (-136.552) (-135.362) * (-138.469) [-135.332] (-135.934) (-136.865) -- 0:00:23
613000 -- [-136.063] (-134.835) (-136.689) (-135.460) * (-137.357) (-135.741) [-135.731] (-134.159) -- 0:00:23
613500 -- (-136.916) (-136.157) (-135.663) [-135.083] * (-136.131) (-138.112) (-136.534) [-134.709] -- 0:00:23
614000 -- (-139.293) [-135.319] (-136.304) (-136.998) * (-140.577) [-137.651] (-136.406) (-136.010) -- 0:00:23
614500 -- (-136.698) (-142.247) [-140.005] (-136.061) * [-135.790] (-139.797) (-137.360) (-135.883) -- 0:00:23
615000 -- [-137.863] (-135.377) (-137.290) (-136.182) * (-134.474) (-138.653) (-139.196) [-136.224] -- 0:00:23
Average standard deviation of split frequencies: 0.009183
615500 -- [-135.734] (-135.462) (-134.725) (-135.802) * (-142.674) (-138.801) (-137.700) [-136.537] -- 0:00:23
616000 -- (-136.164) [-139.805] (-135.915) (-135.305) * [-137.124] (-137.729) (-136.486) (-139.987) -- 0:00:23
616500 -- (-136.066) [-135.270] (-135.343) (-139.560) * [-137.186] (-136.705) (-138.553) (-138.856) -- 0:00:23
617000 -- (-134.097) (-139.105) (-136.009) [-135.753] * (-135.481) [-138.328] (-135.532) (-138.962) -- 0:00:22
617500 -- (-134.905) [-135.645] (-139.077) (-137.785) * (-136.912) (-136.096) [-136.402] (-136.385) -- 0:00:22
618000 -- (-135.520) (-134.480) (-138.293) [-138.731] * (-139.103) [-136.325] (-134.955) (-137.117) -- 0:00:22
618500 -- [-134.537] (-135.458) (-136.946) (-134.962) * (-137.076) (-134.448) (-135.986) [-137.319] -- 0:00:22
619000 -- (-139.974) (-136.381) [-136.197] (-135.051) * [-134.244] (-134.682) (-135.345) (-138.119) -- 0:00:22
619500 -- (-135.582) (-137.452) (-137.674) [-135.064] * (-136.549) (-136.143) [-134.887] (-136.468) -- 0:00:22
620000 -- (-141.864) (-135.571) [-140.451] (-135.733) * (-135.333) [-135.290] (-134.419) (-137.721) -- 0:00:22
Average standard deviation of split frequencies: 0.008734
620500 -- (-139.531) (-134.986) [-135.934] (-138.628) * (-136.994) [-136.014] (-136.338) (-136.180) -- 0:00:22
621000 -- (-139.245) (-135.652) (-135.996) [-139.269] * (-135.494) (-135.218) [-135.115] (-135.728) -- 0:00:22
621500 -- (-135.530) (-137.962) [-136.402] (-134.706) * (-139.022) (-138.092) (-137.343) [-135.065] -- 0:00:22
622000 -- (-137.985) (-139.748) [-137.415] (-138.349) * (-139.082) (-140.018) [-136.245] (-136.990) -- 0:00:22
622500 -- (-136.793) (-139.640) (-137.614) [-136.530] * [-135.618] (-135.451) (-134.901) (-137.777) -- 0:00:22
623000 -- (-135.659) (-134.764) [-134.453] (-134.180) * (-135.470) [-136.812] (-136.965) (-136.179) -- 0:00:22
623500 -- (-135.428) (-134.980) (-136.227) [-135.324] * (-135.792) [-136.190] (-134.684) (-135.389) -- 0:00:22
624000 -- (-135.813) (-135.151) [-137.009] (-135.315) * (-136.122) (-137.303) (-134.836) [-136.978] -- 0:00:22
624500 -- (-134.946) [-137.187] (-137.009) (-136.534) * (-138.611) [-137.999] (-134.521) (-141.382) -- 0:00:22
625000 -- (-137.123) (-137.372) [-135.153] (-135.505) * (-135.908) [-141.007] (-135.242) (-136.073) -- 0:00:22
Average standard deviation of split frequencies: 0.009178
625500 -- [-135.583] (-140.477) (-138.603) (-134.436) * [-135.817] (-136.584) (-135.035) (-134.601) -- 0:00:22
626000 -- (-140.011) [-135.173] (-137.758) (-136.809) * (-135.425) (-135.127) [-135.360] (-135.201) -- 0:00:22
626500 -- (-134.924) (-136.608) (-136.640) [-135.062] * (-136.077) [-139.701] (-136.020) (-135.170) -- 0:00:22
627000 -- [-137.493] (-136.353) (-134.189) (-137.513) * (-136.510) (-136.179) (-136.787) [-134.865] -- 0:00:22
627500 -- [-137.244] (-139.249) (-139.298) (-138.335) * (-137.202) [-136.422] (-135.181) (-137.263) -- 0:00:21
628000 -- (-138.855) (-143.686) (-135.733) [-136.517] * (-136.355) (-136.619) (-140.598) [-135.541] -- 0:00:22
628500 -- (-139.191) (-137.897) (-135.547) [-138.000] * (-137.794) (-134.267) (-136.367) [-134.530] -- 0:00:22
629000 -- (-135.422) (-134.832) [-134.611] (-136.747) * (-135.589) (-140.172) [-136.341] (-138.605) -- 0:00:22
629500 -- (-134.793) (-135.154) (-135.825) [-135.006] * (-137.180) [-138.974] (-135.340) (-137.135) -- 0:00:22
630000 -- (-136.417) (-134.658) [-134.271] (-138.192) * [-135.059] (-137.018) (-137.728) (-137.304) -- 0:00:22
Average standard deviation of split frequencies: 0.008082
630500 -- (-135.233) (-138.134) (-137.830) [-138.997] * (-134.915) [-137.504] (-136.720) (-139.231) -- 0:00:22
631000 -- (-134.322) (-137.330) (-139.114) [-136.651] * (-139.222) (-135.177) [-137.560] (-137.261) -- 0:00:22
631500 -- (-141.323) (-136.312) (-136.562) [-139.241] * (-137.334) [-136.803] (-136.650) (-137.184) -- 0:00:22
632000 -- (-136.914) (-137.803) [-137.729] (-139.608) * (-138.501) (-135.711) [-136.621] (-136.957) -- 0:00:22
632500 -- (-135.033) (-135.299) [-135.332] (-136.449) * [-138.440] (-135.695) (-135.375) (-135.318) -- 0:00:22
633000 -- (-141.467) (-135.299) [-134.057] (-135.485) * (-137.593) (-136.071) [-140.510] (-135.669) -- 0:00:22
633500 -- (-137.918) [-135.094] (-135.554) (-137.093) * (-136.623) (-136.410) [-137.199] (-135.766) -- 0:00:21
634000 -- (-137.417) (-135.138) (-139.402) [-135.748] * (-134.590) [-135.182] (-135.055) (-139.150) -- 0:00:21
634500 -- (-138.730) (-135.177) [-138.873] (-134.781) * [-135.769] (-137.894) (-134.560) (-135.406) -- 0:00:21
635000 -- (-135.234) (-137.682) (-138.648) [-135.501] * (-135.187) (-135.184) (-134.146) [-136.693] -- 0:00:21
Average standard deviation of split frequencies: 0.007505
635500 -- (-136.108) [-137.888] (-135.864) (-138.898) * [-138.775] (-134.329) (-134.691) (-135.169) -- 0:00:21
636000 -- [-139.234] (-136.833) (-135.866) (-142.323) * (-134.946) (-135.896) (-137.634) [-138.222] -- 0:00:21
636500 -- (-139.525) (-135.794) [-135.758] (-136.280) * (-135.487) [-137.041] (-135.826) (-137.584) -- 0:00:21
637000 -- (-139.166) (-136.897) (-140.973) [-134.112] * [-135.206] (-135.395) (-138.928) (-136.372) -- 0:00:21
637500 -- (-135.894) (-139.207) (-136.958) [-134.869] * (-136.828) (-135.809) (-136.649) [-135.032] -- 0:00:21
638000 -- (-137.365) [-136.706] (-137.287) (-135.042) * [-135.369] (-135.383) (-136.428) (-136.009) -- 0:00:21
638500 -- (-140.778) [-136.695] (-137.746) (-135.527) * (-136.589) [-134.850] (-137.526) (-134.862) -- 0:00:21
639000 -- (-136.471) [-136.276] (-139.567) (-137.386) * (-135.451) [-134.371] (-136.774) (-136.406) -- 0:00:21
639500 -- (-134.925) [-138.733] (-135.484) (-137.535) * (-135.379) (-136.096) [-136.063] (-136.059) -- 0:00:21
640000 -- (-134.961) (-136.066) [-135.219] (-138.869) * (-134.994) [-138.380] (-135.783) (-139.412) -- 0:00:21
Average standard deviation of split frequencies: 0.007542
640500 -- (-135.399) (-137.183) (-138.691) [-140.148] * (-136.137) (-136.109) (-137.525) [-136.046] -- 0:00:21
641000 -- (-137.192) (-137.192) [-137.373] (-137.806) * (-139.143) [-136.330] (-141.100) (-140.229) -- 0:00:21
641500 -- [-138.965] (-135.736) (-137.301) (-138.908) * (-136.258) (-135.516) [-135.469] (-135.576) -- 0:00:21
642000 -- (-135.348) (-135.026) [-138.233] (-136.790) * (-137.329) [-135.128] (-136.087) (-134.645) -- 0:00:21
642500 -- (-137.932) (-135.701) (-138.567) [-136.499] * (-140.035) (-135.306) (-136.940) [-134.359] -- 0:00:21
643000 -- (-135.513) (-138.563) [-136.140] (-134.762) * (-139.715) [-137.370] (-138.808) (-134.476) -- 0:00:21
643500 -- (-137.441) (-137.464) [-135.522] (-137.034) * (-135.960) [-137.523] (-135.022) (-134.568) -- 0:00:21
644000 -- (-137.482) [-137.109] (-134.492) (-142.384) * [-137.373] (-137.164) (-134.353) (-133.980) -- 0:00:21
644500 -- [-140.823] (-136.981) (-134.398) (-141.573) * (-138.033) (-135.685) [-135.234] (-135.428) -- 0:00:20
645000 -- (-139.879) [-136.411] (-134.245) (-137.020) * (-137.661) (-135.841) [-134.500] (-138.030) -- 0:00:21
Average standard deviation of split frequencies: 0.007845
645500 -- (-136.035) (-135.136) [-135.835] (-134.915) * (-138.296) [-137.954] (-135.575) (-134.577) -- 0:00:21
646000 -- (-136.575) (-134.520) [-135.225] (-136.395) * (-135.924) [-135.316] (-139.316) (-143.725) -- 0:00:21
646500 -- [-136.304] (-134.396) (-136.480) (-138.372) * (-140.778) [-135.931] (-139.927) (-134.806) -- 0:00:21
647000 -- [-136.620] (-134.427) (-134.842) (-136.254) * (-135.945) [-136.394] (-139.548) (-136.585) -- 0:00:21
647500 -- [-137.451] (-135.617) (-136.134) (-135.170) * (-135.924) (-137.819) [-135.085] (-136.461) -- 0:00:21
648000 -- [-139.294] (-135.070) (-138.011) (-134.302) * (-142.322) (-136.534) [-134.723] (-136.203) -- 0:00:21
648500 -- (-135.603) (-135.916) (-137.001) [-135.417] * (-137.376) (-140.533) (-137.328) [-134.986] -- 0:00:21
649000 -- (-136.711) [-135.170] (-134.812) (-135.760) * (-140.077) [-135.678] (-134.452) (-137.570) -- 0:00:21
649500 -- [-138.872] (-134.859) (-135.226) (-135.250) * (-135.505) (-135.858) (-135.083) [-135.150] -- 0:00:21
650000 -- (-138.495) [-134.985] (-138.011) (-136.201) * [-137.084] (-135.429) (-138.490) (-140.138) -- 0:00:21
Average standard deviation of split frequencies: 0.008151
650500 -- (-135.134) (-135.064) (-137.890) [-136.606] * (-135.699) (-138.689) [-133.844] (-137.963) -- 0:00:20
651000 -- (-137.459) [-134.859] (-137.599) (-137.158) * [-135.944] (-138.181) (-134.131) (-138.906) -- 0:00:20
651500 -- (-136.646) [-136.089] (-134.355) (-136.107) * (-135.716) (-136.200) (-136.559) [-138.102] -- 0:00:20
652000 -- (-138.423) (-140.046) [-134.868] (-134.960) * (-136.492) (-135.901) (-134.536) [-134.959] -- 0:00:20
652500 -- (-136.502) (-137.670) [-135.663] (-134.376) * [-136.943] (-136.318) (-139.260) (-135.006) -- 0:00:20
653000 -- [-135.540] (-135.784) (-136.336) (-136.878) * (-139.849) (-138.458) (-137.823) [-134.342] -- 0:00:20
653500 -- (-134.123) (-138.505) (-135.058) [-135.383] * [-136.097] (-136.593) (-137.451) (-137.019) -- 0:00:20
654000 -- [-137.685] (-139.377) (-134.991) (-139.221) * (-135.780) (-136.152) (-137.809) [-136.349] -- 0:00:20
654500 -- (-135.466) (-138.140) (-136.102) [-138.879] * [-134.824] (-138.251) (-136.643) (-141.420) -- 0:00:20
655000 -- [-138.123] (-134.831) (-137.782) (-135.088) * (-135.938) (-134.170) (-135.396) [-144.076] -- 0:00:20
Average standard deviation of split frequencies: 0.007860
655500 -- [-139.982] (-138.784) (-136.583) (-135.491) * [-134.734] (-135.776) (-139.525) (-139.816) -- 0:00:20
656000 -- (-134.535) [-136.016] (-136.875) (-136.996) * (-138.160) (-137.099) (-138.069) [-135.807] -- 0:00:20
656500 -- (-134.991) (-139.250) (-135.008) [-136.464] * [-139.401] (-136.169) (-136.182) (-134.374) -- 0:00:20
657000 -- [-135.555] (-138.313) (-140.328) (-135.234) * (-136.303) [-137.966] (-136.768) (-136.085) -- 0:00:20
657500 -- (-134.553) [-135.876] (-135.168) (-134.788) * (-135.120) (-135.399) (-135.729) [-136.913] -- 0:00:20
658000 -- [-134.379] (-137.112) (-137.292) (-138.126) * (-138.549) (-135.049) (-137.040) [-135.601] -- 0:00:20
658500 -- (-136.666) (-142.543) [-135.912] (-135.358) * [-136.115] (-135.257) (-135.548) (-137.834) -- 0:00:20
659000 -- (-136.122) (-137.843) [-134.231] (-134.514) * (-136.833) [-138.362] (-139.689) (-135.365) -- 0:00:20
659500 -- (-136.112) (-138.895) (-137.622) [-135.637] * (-138.205) (-137.537) [-135.773] (-137.481) -- 0:00:20
660000 -- (-138.615) [-136.075] (-136.018) (-135.226) * (-134.788) (-138.250) (-136.384) [-134.543] -- 0:00:20
Average standard deviation of split frequencies: 0.008206
660500 -- (-139.135) [-134.936] (-136.518) (-137.039) * [-138.917] (-139.398) (-139.679) (-136.402) -- 0:00:20
661000 -- (-136.776) (-141.250) [-136.176] (-137.952) * (-135.198) [-135.872] (-134.587) (-135.863) -- 0:00:20
661500 -- (-135.215) (-138.514) [-136.170] (-138.443) * (-137.581) (-136.070) [-136.099] (-135.904) -- 0:00:19
662000 -- (-137.038) (-137.612) (-134.395) [-143.316] * (-136.578) (-138.355) [-135.619] (-138.383) -- 0:00:20
662500 -- [-134.915] (-136.616) (-136.021) (-143.243) * (-136.724) (-135.785) [-136.349] (-134.755) -- 0:00:20
663000 -- (-135.147) (-136.542) (-140.516) [-139.302] * (-138.505) [-136.816] (-135.263) (-135.892) -- 0:00:20
663500 -- (-135.910) [-137.185] (-141.158) (-137.982) * (-136.091) (-140.170) [-136.373] (-135.219) -- 0:00:20
664000 -- (-134.180) (-136.979) [-138.389] (-137.890) * (-136.999) (-136.650) [-136.214] (-137.828) -- 0:00:20
664500 -- [-134.283] (-135.456) (-137.976) (-138.190) * (-135.515) [-134.441] (-133.951) (-134.946) -- 0:00:20
665000 -- (-135.967) (-136.317) (-136.427) [-138.458] * (-136.506) (-134.563) (-138.244) [-136.293] -- 0:00:20
Average standard deviation of split frequencies: 0.008538
665500 -- (-137.663) (-135.825) (-136.201) [-137.131] * (-137.396) [-135.179] (-139.287) (-137.065) -- 0:00:20
666000 -- (-143.225) [-134.409] (-134.854) (-138.001) * (-135.208) [-134.786] (-138.375) (-138.554) -- 0:00:20
666500 -- [-137.388] (-135.126) (-137.751) (-136.907) * (-134.312) (-137.257) (-134.767) [-137.420] -- 0:00:20
667000 -- (-135.628) (-137.540) [-135.409] (-143.555) * (-138.289) (-137.090) [-135.526] (-137.535) -- 0:00:19
667500 -- (-134.387) (-136.151) (-138.590) [-135.366] * (-135.918) [-135.761] (-136.387) (-136.043) -- 0:00:19
668000 -- [-134.263] (-137.820) (-137.195) (-134.338) * (-137.065) (-138.341) [-136.880] (-136.220) -- 0:00:19
668500 -- (-135.954) (-134.988) [-135.763] (-137.561) * [-135.148] (-138.657) (-136.268) (-135.195) -- 0:00:19
669000 -- [-135.666] (-134.502) (-135.751) (-138.474) * (-135.141) (-139.472) (-139.173) [-135.832] -- 0:00:19
669500 -- (-136.055) (-135.563) [-134.243] (-138.445) * [-134.042] (-137.322) (-135.139) (-138.289) -- 0:00:19
670000 -- (-137.234) (-135.244) (-135.404) [-134.873] * (-134.349) (-137.773) (-136.454) [-135.291] -- 0:00:19
Average standard deviation of split frequencies: 0.008523
670500 -- (-137.765) [-134.489] (-134.169) (-134.518) * [-136.411] (-137.014) (-135.093) (-136.008) -- 0:00:19
671000 -- [-134.518] (-135.504) (-135.603) (-137.369) * (-135.590) (-136.653) [-134.736] (-138.657) -- 0:00:19
671500 -- (-137.874) (-135.874) (-138.500) [-136.881] * [-135.141] (-136.012) (-134.851) (-134.921) -- 0:00:19
672000 -- [-135.882] (-135.011) (-134.907) (-143.011) * (-140.061) (-139.068) (-136.493) [-134.551] -- 0:00:19
672500 -- [-134.616] (-136.221) (-138.518) (-140.738) * (-136.734) (-134.515) [-137.616] (-134.873) -- 0:00:19
673000 -- (-135.158) [-136.644] (-139.647) (-138.911) * [-137.137] (-138.510) (-135.712) (-137.392) -- 0:00:19
673500 -- (-135.421) [-138.693] (-135.651) (-136.917) * [-138.598] (-135.886) (-136.579) (-141.418) -- 0:00:19
674000 -- (-136.532) (-137.278) (-140.430) [-135.535] * (-139.386) (-140.143) [-134.281] (-137.951) -- 0:00:19
674500 -- (-136.783) [-139.260] (-135.522) (-137.162) * (-135.165) [-135.723] (-134.644) (-136.460) -- 0:00:19
675000 -- (-136.877) [-139.157] (-138.241) (-135.369) * (-135.951) (-141.358) [-136.027] (-138.648) -- 0:00:19
Average standard deviation of split frequencies: 0.008760
675500 -- (-135.363) (-140.086) [-135.074] (-135.881) * [-135.152] (-143.804) (-135.905) (-137.795) -- 0:00:19
676000 -- [-137.025] (-142.677) (-137.839) (-139.519) * [-134.153] (-134.767) (-137.215) (-135.964) -- 0:00:19
676500 -- (-134.250) (-139.360) (-140.398) [-134.826] * (-134.737) [-134.707] (-134.724) (-135.689) -- 0:00:19
677000 -- [-135.061] (-137.653) (-135.629) (-136.684) * (-134.952) [-136.558] (-135.143) (-137.241) -- 0:00:19
677500 -- [-136.502] (-134.878) (-134.554) (-135.803) * (-135.092) [-135.544] (-135.839) (-136.489) -- 0:00:19
678000 -- (-137.484) (-139.102) [-136.325] (-139.011) * (-140.739) (-139.268) (-136.398) [-137.109] -- 0:00:18
678500 -- (-137.521) [-135.664] (-138.062) (-138.389) * (-135.581) [-136.066] (-135.975) (-135.212) -- 0:00:18
679000 -- (-137.454) (-137.522) [-136.016] (-137.295) * [-135.244] (-138.524) (-135.519) (-136.487) -- 0:00:19
679500 -- (-134.976) (-134.948) (-135.670) [-135.014] * [-134.525] (-138.251) (-134.763) (-134.898) -- 0:00:19
680000 -- (-136.745) [-136.034] (-140.253) (-134.160) * (-135.717) (-136.709) [-134.468] (-134.568) -- 0:00:19
Average standard deviation of split frequencies: 0.008830
680500 -- (-136.104) (-136.134) [-135.769] (-136.812) * (-134.544) (-136.346) (-134.977) [-135.379] -- 0:00:19
681000 -- (-138.639) (-135.849) [-135.531] (-134.701) * (-139.102) [-135.195] (-135.286) (-135.295) -- 0:00:19
681500 -- [-136.253] (-135.062) (-134.398) (-140.079) * (-136.729) [-136.647] (-135.345) (-137.553) -- 0:00:19
682000 -- (-136.520) (-137.305) [-135.901] (-134.799) * (-138.186) (-135.474) (-138.193) [-135.579] -- 0:00:19
682500 -- (-135.936) (-135.463) (-134.861) [-136.628] * (-137.229) (-136.168) (-137.580) [-137.283] -- 0:00:19
683000 -- [-134.264] (-139.205) (-137.520) (-142.347) * (-134.042) (-138.157) [-135.537] (-134.585) -- 0:00:19
683500 -- (-136.306) (-138.247) [-137.162] (-139.437) * (-134.011) [-134.242] (-135.217) (-134.962) -- 0:00:18
684000 -- (-137.463) [-135.451] (-136.548) (-134.392) * (-134.390) (-137.602) [-136.525] (-137.024) -- 0:00:18
684500 -- (-138.293) (-137.535) (-134.496) [-134.568] * (-138.682) (-139.645) [-136.072] (-136.091) -- 0:00:18
685000 -- (-136.497) (-133.989) (-137.765) [-137.410] * [-137.409] (-137.152) (-135.397) (-135.564) -- 0:00:18
Average standard deviation of split frequencies: 0.009019
685500 -- (-138.685) (-136.209) (-138.522) [-136.586] * (-136.602) (-135.501) (-135.980) [-137.308] -- 0:00:18
686000 -- (-140.264) (-141.030) (-137.647) [-139.560] * (-137.720) (-136.510) [-134.859] (-138.650) -- 0:00:18
686500 -- (-135.846) [-135.433] (-135.056) (-140.551) * (-136.016) (-135.880) (-134.912) [-135.654] -- 0:00:18
687000 -- (-136.289) (-135.027) (-139.943) [-138.449] * (-136.824) [-134.776] (-134.931) (-138.858) -- 0:00:18
687500 -- (-135.834) (-135.299) (-137.290) [-135.208] * (-135.198) [-136.133] (-137.101) (-136.264) -- 0:00:18
688000 -- (-137.536) [-135.290] (-135.503) (-138.096) * (-134.100) [-138.240] (-136.864) (-138.655) -- 0:00:18
688500 -- (-134.305) (-134.643) [-136.628] (-136.355) * [-134.033] (-134.757) (-137.068) (-137.776) -- 0:00:18
689000 -- (-136.273) [-135.098] (-135.238) (-136.243) * (-135.577) [-135.613] (-136.464) (-138.858) -- 0:00:18
689500 -- (-137.607) (-137.214) (-135.672) [-138.067] * (-138.167) [-134.711] (-136.378) (-136.742) -- 0:00:18
690000 -- (-134.558) (-136.911) [-135.976] (-141.429) * (-140.689) (-135.327) [-135.552] (-140.730) -- 0:00:18
Average standard deviation of split frequencies: 0.008916
690500 -- (-138.510) (-139.069) (-135.431) [-135.860] * (-139.309) (-136.716) [-136.650] (-135.568) -- 0:00:18
691000 -- [-135.247] (-138.165) (-137.175) (-135.729) * [-137.171] (-136.156) (-134.959) (-135.308) -- 0:00:18
691500 -- (-136.612) (-138.966) (-137.241) [-137.575] * (-134.940) [-135.928] (-136.199) (-136.122) -- 0:00:18
692000 -- [-136.338] (-135.803) (-139.201) (-135.964) * (-134.541) [-135.515] (-135.277) (-141.645) -- 0:00:18
692500 -- (-138.866) (-141.081) (-136.979) [-134.543] * (-134.792) (-137.662) (-134.481) [-134.485] -- 0:00:18
693000 -- (-137.654) (-136.147) [-135.035] (-138.466) * (-135.407) (-135.229) [-135.942] (-135.466) -- 0:00:18
693500 -- (-136.741) [-134.190] (-138.348) (-134.447) * (-135.199) (-134.835) (-138.677) [-134.909] -- 0:00:18
694000 -- (-135.941) (-138.768) [-137.323] (-137.743) * (-135.867) (-135.116) (-137.912) [-134.802] -- 0:00:18
694500 -- [-135.411] (-136.305) (-137.143) (-136.759) * (-136.664) [-137.037] (-137.821) (-136.625) -- 0:00:18
695000 -- (-139.115) (-135.285) [-135.684] (-137.848) * (-136.989) (-137.051) [-136.273] (-135.041) -- 0:00:17
Average standard deviation of split frequencies: 0.008636
695500 -- (-139.988) (-134.454) (-136.704) [-135.429] * (-136.487) [-136.555] (-136.503) (-134.965) -- 0:00:17
696000 -- (-138.590) [-134.877] (-138.464) (-134.968) * [-139.182] (-137.227) (-134.898) (-134.850) -- 0:00:17
696500 -- (-135.140) (-135.406) [-136.408] (-135.530) * (-134.778) (-135.572) (-135.612) [-134.553] -- 0:00:18
697000 -- (-134.754) (-136.824) (-135.393) [-135.537] * [-134.860] (-136.757) (-137.179) (-138.692) -- 0:00:18
697500 -- (-137.625) (-135.175) (-134.904) [-138.623] * (-138.536) (-139.838) [-136.969] (-135.146) -- 0:00:18
698000 -- (-135.621) (-134.771) [-136.000] (-136.595) * [-138.478] (-134.595) (-138.514) (-134.902) -- 0:00:18
698500 -- (-135.968) [-138.878] (-136.305) (-137.313) * (-134.792) [-137.329] (-137.730) (-135.414) -- 0:00:18
699000 -- [-136.440] (-134.754) (-137.227) (-137.562) * (-134.588) [-137.933] (-139.148) (-140.600) -- 0:00:18
699500 -- (-136.215) (-134.571) (-135.828) [-135.165] * [-137.815] (-135.624) (-136.370) (-136.587) -- 0:00:18
700000 -- (-135.232) [-133.966] (-135.934) (-138.439) * (-136.649) (-139.665) [-134.355] (-134.801) -- 0:00:18
Average standard deviation of split frequencies: 0.007989
700500 -- [-135.154] (-134.381) (-137.839) (-139.335) * (-137.365) [-137.904] (-139.420) (-138.054) -- 0:00:17
701000 -- (-136.161) (-134.192) [-136.988] (-136.392) * (-137.230) (-135.487) [-135.325] (-137.887) -- 0:00:17
701500 -- (-136.405) (-133.964) [-135.793] (-135.600) * (-141.082) [-137.970] (-136.566) (-138.471) -- 0:00:17
702000 -- (-140.651) (-135.925) [-136.247] (-134.640) * (-135.003) [-136.120] (-137.021) (-133.969) -- 0:00:17
702500 -- [-135.470] (-136.634) (-135.811) (-135.001) * (-139.567) [-136.267] (-137.250) (-135.337) -- 0:00:17
703000 -- (-138.197) (-135.581) [-136.140] (-138.408) * (-138.254) (-136.581) (-139.403) [-135.225] -- 0:00:17
703500 -- (-134.915) (-134.011) (-136.828) [-136.166] * (-137.793) (-136.145) (-135.435) [-136.564] -- 0:00:17
704000 -- [-134.931] (-135.106) (-137.338) (-134.722) * (-135.748) (-134.708) (-136.314) [-133.958] -- 0:00:17
704500 -- (-135.227) (-135.347) [-135.121] (-137.132) * [-135.747] (-136.187) (-136.552) (-134.708) -- 0:00:17
705000 -- (-141.244) (-134.291) (-136.861) [-134.807] * (-134.442) [-136.198] (-135.199) (-135.505) -- 0:00:17
Average standard deviation of split frequencies: 0.007804
705500 -- (-136.821) (-135.399) [-134.498] (-136.059) * (-137.683) (-136.422) (-136.739) [-134.485] -- 0:00:17
706000 -- (-136.832) [-138.896] (-136.102) (-135.301) * (-135.338) [-135.218] (-135.830) (-138.792) -- 0:00:17
706500 -- (-137.448) (-135.583) [-137.212] (-134.582) * (-136.746) (-136.720) (-137.137) [-136.452] -- 0:00:17
707000 -- (-136.896) (-137.099) (-134.571) [-135.038] * (-134.714) [-136.003] (-134.893) (-135.580) -- 0:00:17
707500 -- [-140.494] (-135.469) (-134.952) (-136.401) * (-137.135) (-135.925) [-134.737] (-135.937) -- 0:00:17
708000 -- (-138.412) (-135.549) (-135.814) [-137.659] * (-135.726) (-135.893) (-135.671) [-134.926] -- 0:00:17
708500 -- (-135.442) [-134.712] (-138.600) (-141.568) * [-136.345] (-138.248) (-134.908) (-137.998) -- 0:00:17
709000 -- (-138.672) [-134.980] (-135.045) (-137.789) * (-135.804) [-135.082] (-135.964) (-137.997) -- 0:00:17
709500 -- (-136.432) (-134.818) (-134.648) [-135.999] * (-134.079) (-138.723) (-139.188) [-140.187] -- 0:00:17
710000 -- (-137.562) (-135.903) [-135.548] (-140.404) * [-135.549] (-138.763) (-138.001) (-136.854) -- 0:00:17
Average standard deviation of split frequencies: 0.007518
710500 -- (-135.861) [-136.802] (-135.824) (-134.198) * (-136.362) (-139.555) (-144.242) [-137.938] -- 0:00:17
711000 -- (-135.915) [-134.683] (-135.877) (-135.386) * (-138.412) (-137.698) (-141.934) [-135.042] -- 0:00:17
711500 -- [-135.445] (-136.317) (-135.007) (-135.846) * (-137.311) (-135.696) [-138.746] (-137.281) -- 0:00:17
712000 -- (-135.935) (-140.358) [-135.377] (-134.194) * (-134.914) (-136.003) (-138.261) [-134.957] -- 0:00:16
712500 -- (-136.067) (-136.350) [-136.603] (-136.459) * (-137.368) (-135.771) (-138.239) [-137.834] -- 0:00:16
713000 -- [-137.001] (-136.918) (-135.640) (-134.464) * (-141.883) (-139.798) [-134.867] (-135.750) -- 0:00:16
713500 -- (-135.179) (-138.455) [-134.808] (-135.084) * (-136.411) (-133.947) [-135.003] (-136.005) -- 0:00:16
714000 -- (-135.097) (-138.332) [-134.125] (-135.132) * [-136.986] (-134.129) (-137.223) (-135.418) -- 0:00:17
714500 -- [-136.376] (-138.707) (-136.396) (-137.726) * [-138.567] (-138.501) (-135.227) (-135.692) -- 0:00:17
715000 -- (-135.883) (-138.678) [-135.028] (-137.047) * (-135.422) (-138.954) [-138.635] (-137.436) -- 0:00:17
Average standard deviation of split frequencies: 0.007023
715500 -- (-135.311) (-142.710) (-136.412) [-135.471] * [-134.811] (-135.792) (-139.046) (-136.371) -- 0:00:17
716000 -- (-139.368) (-136.459) [-135.751] (-135.357) * [-136.203] (-136.583) (-134.448) (-134.747) -- 0:00:17
716500 -- (-136.704) [-137.472] (-136.836) (-138.224) * (-135.869) [-134.694] (-137.149) (-136.418) -- 0:00:17
717000 -- [-135.720] (-137.372) (-136.903) (-138.587) * [-134.834] (-135.722) (-134.795) (-136.231) -- 0:00:16
717500 -- [-136.754] (-135.544) (-138.253) (-135.497) * [-135.291] (-134.525) (-137.859) (-134.647) -- 0:00:16
718000 -- (-139.297) (-134.628) (-134.876) [-135.857] * (-138.957) (-136.370) (-134.150) [-135.421] -- 0:00:16
718500 -- (-141.281) [-134.699] (-135.878) (-142.599) * (-134.659) (-136.329) (-136.649) [-135.424] -- 0:00:16
719000 -- [-137.359] (-141.946) (-139.433) (-135.343) * (-134.419) (-137.003) [-134.678] (-136.091) -- 0:00:16
719500 -- [-138.452] (-136.066) (-138.376) (-135.113) * (-135.727) (-141.926) (-138.205) [-134.753] -- 0:00:16
720000 -- (-137.220) (-134.847) (-138.068) [-135.412] * (-138.812) (-139.708) [-139.044] (-137.420) -- 0:00:16
Average standard deviation of split frequencies: 0.006846
720500 -- (-136.907) (-136.571) (-139.062) [-134.658] * (-139.766) (-136.207) (-136.375) [-134.088] -- 0:00:16
721000 -- (-137.479) (-137.293) (-137.049) [-134.942] * (-145.180) (-138.639) [-135.579] (-135.653) -- 0:00:16
721500 -- (-137.397) [-138.298] (-137.945) (-135.431) * [-139.112] (-136.397) (-139.203) (-139.287) -- 0:00:16
722000 -- (-135.800) [-137.396] (-140.368) (-136.833) * [-136.707] (-134.770) (-138.625) (-136.674) -- 0:00:16
722500 -- (-137.945) (-135.544) (-135.617) [-134.923] * [-137.453] (-139.617) (-136.823) (-136.596) -- 0:00:16
723000 -- (-138.173) [-139.652] (-136.077) (-137.560) * (-139.768) (-135.189) [-134.892] (-136.403) -- 0:00:16
723500 -- (-138.478) [-136.063] (-135.040) (-135.901) * (-135.393) (-135.365) (-137.360) [-136.579] -- 0:00:16
724000 -- (-138.444) (-135.077) [-138.072] (-140.246) * (-135.667) [-135.435] (-135.458) (-135.980) -- 0:00:16
724500 -- [-138.523] (-136.288) (-136.520) (-142.036) * (-135.767) [-134.781] (-135.056) (-136.441) -- 0:00:16
725000 -- (-134.984) (-137.503) (-135.958) [-136.810] * [-134.950] (-137.062) (-135.559) (-137.358) -- 0:00:16
Average standard deviation of split frequencies: 0.006969
725500 -- (-135.544) [-134.781] (-137.790) (-139.362) * [-138.012] (-141.382) (-135.677) (-138.918) -- 0:00:16
726000 -- [-136.918] (-134.809) (-134.778) (-137.297) * (-136.438) [-138.730] (-137.813) (-136.601) -- 0:00:16
726500 -- (-135.397) [-137.565] (-134.908) (-135.211) * [-136.263] (-135.676) (-139.569) (-136.073) -- 0:00:16
727000 -- [-134.918] (-134.983) (-138.554) (-137.102) * (-136.472) (-136.418) [-136.018] (-136.499) -- 0:00:16
727500 -- (-134.793) [-134.813] (-137.063) (-136.789) * (-138.982) (-138.081) (-137.391) [-134.374] -- 0:00:16
728000 -- (-135.622) [-135.343] (-140.176) (-136.832) * (-134.873) (-135.936) (-138.421) [-134.793] -- 0:00:16
728500 -- [-139.688] (-135.240) (-137.528) (-146.251) * (-137.731) (-138.026) [-134.377] (-135.395) -- 0:00:16
729000 -- (-137.175) (-136.987) [-136.361] (-139.769) * (-139.110) [-135.722] (-135.890) (-137.976) -- 0:00:15
729500 -- (-137.157) (-141.251) [-134.053] (-136.450) * (-139.486) (-136.558) (-135.469) [-138.839] -- 0:00:15
730000 -- (-135.567) (-138.193) (-134.946) [-134.810] * (-136.118) [-136.473] (-136.244) (-139.124) -- 0:00:16
Average standard deviation of split frequencies: 0.006538
730500 -- [-134.794] (-135.349) (-134.975) (-138.914) * [-134.601] (-135.541) (-136.268) (-136.120) -- 0:00:16
731000 -- (-141.645) [-137.043] (-134.782) (-136.222) * (-141.504) (-135.026) (-134.704) [-138.140] -- 0:00:16
731500 -- (-134.688) (-135.017) [-137.668] (-138.376) * (-136.609) [-135.844] (-136.815) (-136.005) -- 0:00:16
732000 -- (-137.603) (-138.036) [-135.289] (-135.188) * (-137.410) (-135.697) (-140.107) [-134.391] -- 0:00:16
732500 -- (-136.206) (-138.133) [-136.490] (-142.290) * (-137.387) (-135.478) (-142.058) [-136.228] -- 0:00:16
733000 -- [-137.756] (-135.938) (-135.350) (-137.145) * (-138.646) (-136.271) [-135.274] (-134.831) -- 0:00:16
733500 -- (-139.243) [-138.157] (-135.138) (-135.932) * (-136.305) (-137.381) (-138.492) [-136.029] -- 0:00:15
734000 -- (-139.589) (-137.007) [-135.402] (-136.951) * [-136.431] (-137.145) (-137.634) (-135.786) -- 0:00:15
734500 -- (-136.321) [-134.617] (-134.749) (-136.604) * (-136.673) [-136.230] (-137.646) (-139.512) -- 0:00:15
735000 -- (-134.904) (-138.127) (-136.605) [-136.347] * (-137.904) (-137.630) [-136.461] (-137.519) -- 0:00:15
Average standard deviation of split frequencies: 0.006405
735500 -- (-134.855) [-135.074] (-135.187) (-136.105) * (-135.265) (-136.705) [-136.645] (-135.694) -- 0:00:15
736000 -- (-137.660) (-134.730) [-136.928] (-135.955) * (-140.458) [-138.295] (-136.333) (-135.190) -- 0:00:15
736500 -- (-135.463) [-137.230] (-135.478) (-135.162) * [-134.741] (-137.943) (-137.413) (-136.302) -- 0:00:15
737000 -- (-135.281) (-138.278) (-138.970) [-135.819] * (-135.709) [-137.200] (-136.826) (-135.841) -- 0:00:15
737500 -- (-135.085) (-140.668) (-137.209) [-134.727] * [-135.646] (-138.576) (-137.466) (-138.050) -- 0:00:15
738000 -- (-139.406) [-135.175] (-136.276) (-134.630) * (-136.038) (-141.952) [-134.529] (-136.691) -- 0:00:15
738500 -- (-136.252) (-135.974) (-136.967) [-136.458] * (-137.302) [-142.070] (-138.447) (-135.201) -- 0:00:15
739000 -- (-137.971) [-134.246] (-140.676) (-137.437) * (-138.961) (-135.278) [-135.895] (-139.090) -- 0:00:15
739500 -- (-136.604) (-135.210) (-137.001) [-137.462] * (-137.737) (-137.233) [-136.355] (-134.496) -- 0:00:15
740000 -- (-137.147) (-139.445) (-135.602) [-136.908] * (-137.357) (-138.455) [-135.108] (-134.808) -- 0:00:15
Average standard deviation of split frequencies: 0.006365
740500 -- (-137.146) (-137.458) (-136.108) [-134.323] * [-135.258] (-135.454) (-135.419) (-134.551) -- 0:00:15
741000 -- (-140.154) (-143.499) (-136.415) [-136.793] * [-142.171] (-136.704) (-136.243) (-134.311) -- 0:00:15
741500 -- (-137.964) (-136.292) [-135.770] (-137.829) * (-140.193) (-137.770) [-136.197] (-137.139) -- 0:00:15
742000 -- (-136.074) (-135.702) [-135.340] (-134.590) * [-135.534] (-136.773) (-135.128) (-136.759) -- 0:00:15
742500 -- (-135.972) [-137.145] (-135.066) (-134.953) * [-136.569] (-135.196) (-135.400) (-136.731) -- 0:00:15
743000 -- [-138.595] (-134.473) (-135.859) (-133.999) * [-135.165] (-134.407) (-135.696) (-138.071) -- 0:00:15
743500 -- (-135.256) (-134.408) [-136.360] (-135.504) * [-135.194] (-136.610) (-134.637) (-136.846) -- 0:00:15
744000 -- (-138.782) (-136.033) [-135.654] (-136.518) * (-134.692) (-136.072) [-136.133] (-137.056) -- 0:00:15
744500 -- (-136.146) (-134.192) (-138.705) [-135.480] * [-136.799] (-135.599) (-136.470) (-136.968) -- 0:00:15
745000 -- (-135.723) [-135.347] (-135.982) (-134.407) * (-134.819) (-134.702) [-135.559] (-134.962) -- 0:00:15
Average standard deviation of split frequencies: 0.006151
745500 -- (-136.595) (-138.204) (-137.406) [-135.480] * (-136.877) [-134.507] (-136.345) (-135.757) -- 0:00:15
746000 -- (-137.226) (-135.610) [-137.467] (-136.142) * (-137.379) (-135.288) [-135.379] (-136.061) -- 0:00:14
746500 -- (-135.379) (-141.982) (-138.451) [-139.181] * (-137.371) (-138.740) [-136.396] (-134.339) -- 0:00:15
747000 -- (-138.002) (-136.628) (-139.525) [-139.096] * (-137.952) (-137.211) [-134.728] (-134.894) -- 0:00:15
747500 -- [-136.918] (-134.827) (-140.092) (-139.197) * (-138.885) (-135.488) [-135.123] (-134.250) -- 0:00:15
748000 -- (-135.207) [-137.232] (-143.556) (-138.907) * (-140.764) (-135.313) (-139.088) [-135.196] -- 0:00:15
748500 -- (-136.358) (-136.955) [-140.704] (-135.932) * [-141.125] (-136.966) (-135.935) (-137.514) -- 0:00:15
749000 -- (-137.329) [-137.111] (-137.857) (-136.752) * [-135.082] (-136.542) (-136.376) (-135.922) -- 0:00:15
749500 -- (-136.619) (-138.202) (-142.670) [-138.486] * (-137.905) (-137.697) [-136.083] (-135.415) -- 0:00:15
750000 -- (-136.120) (-142.081) (-143.633) [-135.098] * (-135.171) (-136.799) [-137.327] (-134.805) -- 0:00:15
Average standard deviation of split frequencies: 0.006405
750500 -- (-135.010) (-135.637) (-135.768) [-135.346] * (-136.704) (-135.112) [-138.590] (-135.062) -- 0:00:14
751000 -- [-136.927] (-136.135) (-141.521) (-135.344) * [-136.669] (-138.240) (-138.778) (-135.485) -- 0:00:14
751500 -- [-137.412] (-133.981) (-140.364) (-134.555) * (-134.807) (-137.563) [-136.117] (-134.428) -- 0:00:14
752000 -- [-136.627] (-138.786) (-138.038) (-134.971) * (-140.685) [-136.427] (-134.630) (-137.033) -- 0:00:14
752500 -- [-138.131] (-135.674) (-134.277) (-136.806) * (-135.781) (-135.595) (-139.469) [-137.810] -- 0:00:14
753000 -- (-138.520) (-134.438) [-134.956] (-136.076) * [-134.769] (-135.112) (-136.371) (-138.244) -- 0:00:14
753500 -- [-135.949] (-135.419) (-139.440) (-135.431) * (-134.831) [-134.604] (-137.849) (-137.816) -- 0:00:14
754000 -- (-135.856) [-135.853] (-138.658) (-136.318) * (-139.461) (-134.725) [-134.834] (-137.442) -- 0:00:14
754500 -- (-138.041) (-137.035) (-140.802) [-135.217] * [-139.259] (-136.354) (-134.941) (-135.500) -- 0:00:14
755000 -- (-138.030) (-138.086) (-139.780) [-135.708] * (-139.512) (-135.164) [-134.720] (-149.377) -- 0:00:14
Average standard deviation of split frequencies: 0.005820
755500 -- (-135.820) (-135.209) [-137.228] (-135.530) * (-139.310) (-135.095) [-134.963] (-136.478) -- 0:00:14
756000 -- (-139.419) (-136.818) [-136.702] (-135.786) * (-137.646) (-134.124) [-137.116] (-136.931) -- 0:00:14
756500 -- (-139.957) (-138.041) [-139.613] (-139.218) * (-136.967) [-134.981] (-136.033) (-141.291) -- 0:00:14
757000 -- (-138.703) (-138.299) (-135.197) [-136.438] * [-134.967] (-139.166) (-136.816) (-143.879) -- 0:00:14
757500 -- (-135.929) (-137.191) [-134.457] (-137.353) * [-137.798] (-135.535) (-135.492) (-137.872) -- 0:00:14
758000 -- (-138.505) [-137.277] (-139.904) (-135.467) * [-134.953] (-136.175) (-140.706) (-135.376) -- 0:00:14
758500 -- (-136.108) (-136.681) (-138.093) [-134.593] * (-136.734) (-135.879) [-138.589] (-139.193) -- 0:00:14
759000 -- [-136.798] (-136.777) (-144.000) (-136.473) * (-135.059) (-137.294) [-139.861] (-135.743) -- 0:00:14
759500 -- (-135.922) (-135.935) [-138.369] (-139.511) * (-135.536) [-134.842] (-138.120) (-136.338) -- 0:00:14
760000 -- [-136.874] (-135.461) (-135.056) (-137.601) * (-138.548) (-135.633) [-139.715] (-135.219) -- 0:00:14
Average standard deviation of split frequencies: 0.006528
760500 -- (-137.347) (-135.787) (-134.240) [-134.583] * (-135.128) [-134.155] (-138.229) (-138.030) -- 0:00:14
761000 -- (-135.052) (-137.358) [-135.970] (-135.083) * [-136.450] (-142.350) (-134.831) (-136.158) -- 0:00:14
761500 -- [-134.247] (-138.150) (-134.907) (-136.606) * [-135.076] (-138.794) (-137.388) (-136.447) -- 0:00:14
762000 -- [-134.191] (-135.034) (-137.735) (-135.603) * (-136.932) [-135.499] (-137.049) (-138.449) -- 0:00:14
762500 -- (-135.192) (-136.235) (-136.838) [-138.310] * (-133.989) [-134.132] (-135.782) (-134.705) -- 0:00:14
763000 -- (-134.529) (-136.363) (-137.090) [-135.328] * [-134.737] (-134.638) (-134.562) (-135.208) -- 0:00:14
763500 -- (-134.964) (-137.277) (-137.439) [-136.353] * (-134.916) (-137.573) (-134.999) [-137.091] -- 0:00:14
764000 -- (-136.797) [-136.141] (-138.377) (-135.792) * [-136.218] (-136.913) (-135.867) (-140.438) -- 0:00:14
764500 -- [-135.215] (-138.646) (-137.597) (-137.001) * (-137.054) (-135.903) [-135.766] (-135.732) -- 0:00:14
765000 -- (-136.042) (-137.422) [-137.580] (-134.042) * (-138.738) [-134.877] (-138.611) (-139.093) -- 0:00:14
Average standard deviation of split frequencies: 0.006359
765500 -- (-137.661) (-136.097) (-135.304) [-134.492] * [-135.959] (-136.478) (-136.871) (-137.137) -- 0:00:14
766000 -- (-135.513) (-136.681) (-134.369) [-134.897] * (-134.753) (-135.504) (-134.591) [-135.646] -- 0:00:14
766500 -- (-135.906) (-138.122) [-136.306] (-135.387) * [-136.489] (-134.396) (-136.423) (-138.962) -- 0:00:14
767000 -- [-135.179] (-137.159) (-134.342) (-133.861) * (-137.699) (-135.586) [-137.531] (-138.247) -- 0:00:13
767500 -- (-135.565) (-140.826) [-134.897] (-136.338) * [-134.713] (-136.726) (-135.250) (-135.511) -- 0:00:13
768000 -- (-134.564) (-134.852) (-135.142) [-135.254] * (-135.146) (-136.395) [-136.769] (-135.187) -- 0:00:13
768500 -- [-134.251] (-134.835) (-134.217) (-139.491) * (-135.748) [-134.416] (-139.435) (-138.928) -- 0:00:13
769000 -- [-135.723] (-141.361) (-136.001) (-140.015) * (-135.572) (-139.780) [-138.047] (-139.266) -- 0:00:13
769500 -- (-135.828) (-138.982) [-136.383] (-137.265) * (-136.503) [-137.429] (-134.667) (-134.859) -- 0:00:13
770000 -- (-139.481) (-134.762) [-136.179] (-138.621) * (-136.491) (-138.833) (-134.147) [-134.158] -- 0:00:13
Average standard deviation of split frequencies: 0.005954
770500 -- [-143.643] (-136.089) (-139.123) (-137.279) * (-138.962) (-137.254) (-134.812) [-134.484] -- 0:00:13
771000 -- (-136.597) (-138.222) [-135.995] (-136.346) * (-138.190) [-134.989] (-135.632) (-136.324) -- 0:00:13
771500 -- (-138.476) (-136.627) (-136.396) [-134.927] * (-134.141) (-135.840) (-137.186) [-134.855] -- 0:00:13
772000 -- [-136.333] (-138.512) (-135.347) (-137.217) * (-135.294) (-139.687) [-136.628] (-137.796) -- 0:00:13
772500 -- (-136.889) (-136.759) [-136.139] (-137.292) * (-134.975) (-137.819) [-137.237] (-134.752) -- 0:00:13
773000 -- [-135.722] (-135.706) (-139.441) (-136.885) * [-136.319] (-136.647) (-136.071) (-138.094) -- 0:00:13
773500 -- [-135.394] (-135.806) (-135.331) (-138.699) * [-136.065] (-134.373) (-136.782) (-137.595) -- 0:00:13
774000 -- (-135.108) (-138.805) [-136.366] (-135.977) * (-135.163) [-135.543] (-134.622) (-136.520) -- 0:00:13
774500 -- [-136.699] (-139.620) (-135.758) (-136.362) * [-135.622] (-135.216) (-136.956) (-137.128) -- 0:00:13
775000 -- (-136.326) (-135.170) (-137.408) [-134.943] * [-136.042] (-140.424) (-135.580) (-136.620) -- 0:00:13
Average standard deviation of split frequencies: 0.006318
775500 -- (-141.013) [-136.374] (-135.787) (-136.918) * (-136.465) (-137.125) (-134.985) [-137.891] -- 0:00:13
776000 -- (-136.982) (-137.561) [-134.729] (-135.982) * (-137.400) (-136.020) (-138.332) [-135.531] -- 0:00:13
776500 -- [-135.621] (-137.492) (-134.854) (-137.526) * [-136.598] (-142.671) (-139.726) (-134.611) -- 0:00:13
777000 -- (-135.137) [-135.384] (-136.117) (-136.107) * (-135.394) [-135.925] (-136.684) (-135.064) -- 0:00:13
777500 -- [-136.514] (-136.451) (-135.733) (-136.794) * (-139.851) [-137.013] (-135.759) (-135.359) -- 0:00:13
778000 -- [-137.665] (-137.535) (-139.776) (-135.973) * (-137.340) (-136.522) (-136.646) [-134.982] -- 0:00:13
778500 -- (-137.702) [-135.333] (-136.668) (-135.018) * (-135.290) (-135.645) [-134.007] (-137.212) -- 0:00:13
779000 -- (-136.827) (-136.461) (-135.724) [-136.265] * (-136.836) (-138.002) (-134.738) [-135.588] -- 0:00:13
779500 -- (-136.571) (-135.213) [-136.455] (-138.506) * (-138.381) [-138.631] (-136.608) (-136.787) -- 0:00:13
780000 -- (-134.925) (-138.287) [-136.753] (-135.865) * [-136.360] (-138.422) (-136.760) (-137.496) -- 0:00:12
Average standard deviation of split frequencies: 0.007020
780500 -- [-135.156] (-136.333) (-137.979) (-137.224) * (-135.055) (-136.195) [-138.553] (-137.932) -- 0:00:13
781000 -- (-135.574) (-134.507) [-136.258] (-137.178) * [-135.320] (-138.228) (-134.860) (-137.967) -- 0:00:13
781500 -- [-135.690] (-138.383) (-135.321) (-140.621) * (-135.745) (-137.329) [-135.179] (-134.199) -- 0:00:13
782000 -- (-135.134) (-136.381) (-134.462) [-140.479] * (-138.064) (-135.928) (-138.528) [-138.713] -- 0:00:13
782500 -- (-135.788) (-136.979) [-134.021] (-137.866) * (-140.414) [-136.708] (-135.874) (-135.636) -- 0:00:13
783000 -- (-134.146) (-137.491) (-134.838) [-139.390] * [-137.364] (-137.575) (-136.183) (-136.477) -- 0:00:13
783500 -- (-134.211) (-137.404) (-134.886) [-137.557] * (-136.242) (-137.109) [-134.779] (-136.935) -- 0:00:12
784000 -- [-134.294] (-137.385) (-139.876) (-139.097) * (-134.896) [-139.685] (-137.243) (-136.882) -- 0:00:12
784500 -- (-135.731) (-138.872) (-142.020) [-134.914] * (-134.613) (-140.580) [-135.416] (-140.579) -- 0:00:12
785000 -- [-134.846] (-136.734) (-138.832) (-135.094) * [-138.376] (-139.156) (-140.785) (-140.435) -- 0:00:12
Average standard deviation of split frequencies: 0.007085
785500 -- [-135.049] (-137.787) (-137.926) (-137.598) * (-138.373) (-140.732) [-136.366] (-136.817) -- 0:00:12
786000 -- [-134.366] (-136.240) (-140.943) (-137.763) * (-137.327) (-136.341) [-137.972] (-143.432) -- 0:00:12
786500 -- (-134.941) (-135.391) (-139.513) [-136.412] * (-137.044) (-136.792) [-139.838] (-137.946) -- 0:00:12
787000 -- (-136.113) [-137.960] (-139.014) (-135.890) * (-135.554) [-137.369] (-135.657) (-136.524) -- 0:00:12
787500 -- [-138.348] (-139.831) (-137.926) (-134.162) * (-135.374) [-139.625] (-142.606) (-135.985) -- 0:00:12
788000 -- (-136.108) [-138.223] (-135.185) (-137.585) * [-139.955] (-135.127) (-145.700) (-136.041) -- 0:00:12
788500 -- [-135.756] (-136.778) (-136.597) (-137.224) * [-134.655] (-135.259) (-138.474) (-134.253) -- 0:00:12
789000 -- (-139.112) (-135.277) (-136.711) [-136.327] * (-136.119) (-137.000) (-136.638) [-136.160] -- 0:00:12
789500 -- (-139.030) (-137.397) (-139.876) [-134.812] * (-137.473) [-134.380] (-134.885) (-137.719) -- 0:00:12
790000 -- [-136.093] (-135.266) (-135.426) (-137.900) * (-137.048) (-135.014) (-134.674) [-135.545] -- 0:00:12
Average standard deviation of split frequencies: 0.006280
790500 -- (-137.288) [-135.255] (-137.061) (-141.363) * [-135.735] (-140.882) (-137.966) (-138.500) -- 0:00:12
791000 -- [-136.444] (-137.466) (-139.905) (-137.816) * (-137.378) (-135.702) [-135.704] (-134.164) -- 0:00:12
791500 -- (-140.294) (-141.815) (-137.769) [-134.248] * [-136.091] (-134.550) (-140.175) (-134.042) -- 0:00:12
792000 -- (-136.592) [-135.839] (-137.364) (-134.290) * (-135.320) [-134.586] (-135.766) (-135.721) -- 0:00:12
792500 -- (-136.369) (-134.518) (-135.553) [-135.984] * (-135.460) (-136.627) [-134.722] (-135.951) -- 0:00:12
793000 -- (-137.156) [-134.440] (-137.711) (-135.654) * (-134.463) (-136.100) [-136.455] (-136.835) -- 0:00:12
793500 -- (-137.233) [-135.201] (-134.854) (-135.204) * (-138.502) [-136.511] (-135.120) (-141.624) -- 0:00:12
794000 -- (-140.259) (-134.644) (-134.896) [-135.328] * (-134.796) (-134.926) (-136.205) [-136.887] -- 0:00:12
794500 -- (-135.465) [-135.792] (-137.461) (-137.336) * (-135.666) [-134.902] (-138.746) (-135.882) -- 0:00:12
795000 -- (-135.143) [-136.970] (-136.603) (-137.497) * [-137.153] (-134.494) (-137.791) (-136.509) -- 0:00:12
Average standard deviation of split frequencies: 0.006751
795500 -- [-134.726] (-137.727) (-138.041) (-139.080) * (-137.574) [-136.616] (-137.619) (-137.287) -- 0:00:12
796000 -- (-134.966) (-135.062) (-134.746) [-136.463] * (-136.558) (-134.013) [-134.767] (-136.988) -- 0:00:12
796500 -- (-136.152) (-135.341) [-136.277] (-135.334) * (-137.650) [-136.577] (-137.384) (-135.726) -- 0:00:12
797000 -- (-136.795) (-138.549) (-138.315) [-135.226] * (-134.193) [-135.903] (-134.911) (-140.973) -- 0:00:12
797500 -- (-137.107) (-135.366) [-135.103] (-135.145) * [-136.205] (-134.794) (-136.456) (-138.109) -- 0:00:12
798000 -- [-142.858] (-136.452) (-134.805) (-136.410) * (-134.448) (-136.410) (-138.409) [-137.606] -- 0:00:12
798500 -- (-137.633) (-139.093) (-134.687) [-134.494] * (-135.023) (-134.279) [-136.102] (-137.429) -- 0:00:12
799000 -- (-138.925) [-136.447] (-138.721) (-136.464) * (-136.856) [-135.690] (-140.454) (-139.323) -- 0:00:12
799500 -- [-135.319] (-135.472) (-135.749) (-136.524) * [-136.679] (-137.731) (-139.353) (-138.793) -- 0:00:12
800000 -- (-141.122) (-134.120) (-136.660) [-135.997] * (-135.184) [-139.688] (-135.503) (-137.387) -- 0:00:12
Average standard deviation of split frequencies: 0.006633
800500 -- [-135.902] (-139.533) (-135.642) (-136.887) * (-134.114) (-137.733) [-137.839] (-139.110) -- 0:00:11
801000 -- (-134.924) [-136.392] (-139.761) (-134.325) * [-139.441] (-136.759) (-137.261) (-138.299) -- 0:00:11
801500 -- [-134.329] (-138.493) (-136.436) (-138.088) * (-140.332) (-137.072) [-135.447] (-135.429) -- 0:00:11
802000 -- (-137.278) [-137.742] (-136.764) (-139.032) * (-137.627) (-136.748) (-136.697) [-136.369] -- 0:00:11
802500 -- (-134.824) [-134.707] (-135.989) (-138.980) * (-136.258) (-138.234) [-135.539] (-136.801) -- 0:00:11
803000 -- (-134.914) (-139.855) [-139.996] (-135.364) * [-134.056] (-139.431) (-143.542) (-135.614) -- 0:00:11
803500 -- [-136.009] (-134.246) (-137.809) (-135.078) * [-140.451] (-138.994) (-136.319) (-134.556) -- 0:00:11
804000 -- (-135.569) (-139.415) (-135.126) [-134.991] * (-137.345) [-137.083] (-137.602) (-135.544) -- 0:00:11
804500 -- (-136.243) (-141.680) [-134.466] (-135.356) * (-137.179) (-136.748) (-135.571) [-136.540] -- 0:00:11
805000 -- [-136.892] (-137.060) (-136.435) (-135.509) * (-134.424) (-136.758) [-135.785] (-135.530) -- 0:00:11
Average standard deviation of split frequencies: 0.006745
805500 -- (-136.455) (-135.763) (-134.357) [-134.462] * (-134.804) (-138.955) [-136.366] (-135.816) -- 0:00:11
806000 -- (-136.410) (-136.562) (-139.155) [-135.603] * (-136.872) (-141.059) (-138.105) [-136.913] -- 0:00:11
806500 -- (-135.432) (-137.793) [-135.855] (-136.277) * [-136.405] (-138.935) (-138.112) (-137.923) -- 0:00:11
807000 -- (-135.606) (-138.505) [-135.003] (-138.486) * [-135.408] (-137.655) (-135.553) (-137.769) -- 0:00:11
807500 -- [-134.907] (-139.498) (-137.270) (-136.586) * (-135.249) [-134.078] (-138.332) (-138.442) -- 0:00:11
808000 -- [-136.555] (-135.824) (-138.896) (-135.287) * (-135.619) [-135.976] (-138.908) (-135.415) -- 0:00:11
808500 -- (-141.642) (-135.255) [-138.909] (-134.109) * (-136.647) (-134.426) [-135.498] (-138.207) -- 0:00:11
809000 -- (-137.318) (-137.945) (-136.720) [-134.811] * (-136.332) [-142.369] (-134.687) (-134.565) -- 0:00:11
809500 -- (-134.656) (-136.673) (-134.395) [-135.367] * [-134.986] (-138.101) (-135.531) (-137.316) -- 0:00:11
810000 -- (-134.660) (-134.836) [-140.844] (-138.185) * [-135.578] (-135.619) (-137.344) (-136.016) -- 0:00:11
Average standard deviation of split frequencies: 0.006900
810500 -- (-134.341) (-135.494) (-137.419) [-136.194] * (-137.993) (-134.726) [-134.579] (-135.642) -- 0:00:11
811000 -- (-136.365) (-136.766) [-137.065] (-136.709) * (-135.138) (-135.926) (-135.917) [-135.469] -- 0:00:11
811500 -- (-134.557) (-136.743) [-134.624] (-136.849) * [-135.312] (-134.469) (-135.933) (-141.496) -- 0:00:11
812000 -- (-134.282) (-135.480) [-137.542] (-142.091) * (-136.287) (-135.152) [-136.899] (-134.622) -- 0:00:11
812500 -- [-135.581] (-137.054) (-136.633) (-138.420) * (-138.523) (-135.479) (-136.982) [-137.720] -- 0:00:11
813000 -- (-138.462) (-136.409) [-135.645] (-136.093) * (-137.561) [-138.533] (-136.584) (-137.052) -- 0:00:11
813500 -- (-138.651) [-135.533] (-134.587) (-135.836) * (-134.944) (-139.878) [-136.975] (-136.053) -- 0:00:11
814000 -- (-137.988) (-137.611) [-135.319] (-135.529) * [-137.208] (-137.633) (-136.997) (-136.666) -- 0:00:11
814500 -- [-135.059] (-134.607) (-136.292) (-135.745) * [-137.674] (-138.490) (-137.658) (-137.908) -- 0:00:11
815000 -- (-134.278) (-138.050) [-134.338] (-137.033) * (-138.259) [-135.661] (-135.110) (-135.040) -- 0:00:11
Average standard deviation of split frequencies: 0.006624
815500 -- (-135.365) (-135.469) [-134.198] (-137.284) * (-135.012) (-140.516) (-135.120) [-136.070] -- 0:00:11
816000 -- (-134.870) (-140.605) [-134.505] (-137.577) * [-138.660] (-139.061) (-135.309) (-136.359) -- 0:00:11
816500 -- [-136.889] (-134.669) (-137.948) (-135.007) * (-138.153) (-134.362) [-146.016] (-135.570) -- 0:00:11
817000 -- (-135.885) (-138.586) (-138.110) [-135.430] * (-138.304) (-139.097) (-136.975) [-134.761] -- 0:00:10
817500 -- (-138.043) (-136.914) [-136.925] (-135.906) * (-135.426) (-135.087) (-136.592) [-135.855] -- 0:00:10
818000 -- [-137.232] (-139.732) (-135.707) (-137.070) * [-135.086] (-135.032) (-135.502) (-134.682) -- 0:00:10
818500 -- (-138.500) [-134.967] (-136.255) (-135.094) * (-135.717) [-135.892] (-134.602) (-135.233) -- 0:00:10
819000 -- [-135.323] (-137.140) (-136.807) (-135.901) * [-134.298] (-138.901) (-134.147) (-134.228) -- 0:00:10
819500 -- (-136.461) [-136.851] (-136.178) (-134.830) * (-139.776) [-137.142] (-134.937) (-136.631) -- 0:00:10
820000 -- [-139.682] (-135.675) (-139.805) (-136.491) * (-137.597) (-142.546) (-134.552) [-136.006] -- 0:00:10
Average standard deviation of split frequencies: 0.007216
820500 -- (-140.781) [-133.977] (-137.480) (-138.200) * (-141.831) [-140.482] (-135.038) (-136.103) -- 0:00:10
821000 -- [-136.170] (-138.120) (-136.262) (-135.089) * (-136.124) [-136.183] (-134.171) (-134.651) -- 0:00:10
821500 -- [-135.820] (-137.130) (-134.484) (-135.959) * (-135.462) (-137.087) (-138.119) [-134.776] -- 0:00:10
822000 -- (-134.814) (-139.511) [-141.714] (-135.463) * (-138.313) (-135.481) [-137.867] (-136.539) -- 0:00:10
822500 -- (-136.100) (-135.970) (-135.873) [-136.652] * [-137.409] (-135.503) (-138.867) (-137.901) -- 0:00:10
823000 -- (-141.505) (-137.271) [-136.889] (-136.721) * (-135.335) (-136.028) [-135.633] (-139.829) -- 0:00:10
823500 -- (-135.091) (-135.052) [-135.113] (-136.266) * (-135.004) (-143.979) [-136.501] (-139.357) -- 0:00:10
824000 -- (-135.579) (-138.944) [-136.399] (-138.325) * [-136.227] (-139.518) (-134.591) (-135.086) -- 0:00:10
824500 -- (-137.360) [-136.670] (-134.730) (-139.115) * (-135.704) (-136.681) (-138.240) [-138.501] -- 0:00:10
825000 -- (-136.199) (-143.069) [-134.796] (-135.808) * [-134.080] (-137.126) (-137.292) (-136.753) -- 0:00:10
Average standard deviation of split frequencies: 0.007277
825500 -- (-135.859) (-140.552) [-136.881] (-135.894) * (-139.375) (-137.492) (-136.075) [-136.005] -- 0:00:10
826000 -- [-134.893] (-137.149) (-135.789) (-141.696) * (-137.401) (-136.454) [-135.179] (-135.620) -- 0:00:10
826500 -- [-135.144] (-134.951) (-136.138) (-139.388) * (-136.614) (-137.869) (-137.747) [-134.437] -- 0:00:10
827000 -- [-137.707] (-135.365) (-135.369) (-135.079) * [-136.580] (-139.203) (-137.860) (-138.271) -- 0:00:10
827500 -- [-139.543] (-135.348) (-136.246) (-135.909) * (-137.854) (-135.541) [-134.900] (-138.576) -- 0:00:10
828000 -- [-138.249] (-136.639) (-138.111) (-135.911) * (-142.360) (-136.938) [-137.381] (-136.671) -- 0:00:10
828500 -- (-134.961) (-137.016) [-136.276] (-134.661) * [-140.604] (-141.306) (-137.441) (-138.095) -- 0:00:10
829000 -- (-136.332) (-139.708) [-135.308] (-138.486) * (-135.491) (-134.609) (-136.146) [-138.819] -- 0:00:10
829500 -- (-137.649) (-134.406) [-136.035] (-139.139) * [-136.462] (-134.845) (-138.246) (-138.274) -- 0:00:10
830000 -- (-137.897) [-134.701] (-136.833) (-135.255) * (-135.971) (-137.893) (-137.076) [-139.362] -- 0:00:10
Average standard deviation of split frequencies: 0.007165
830500 -- [-139.486] (-135.723) (-136.072) (-135.035) * (-135.301) (-138.191) (-137.112) [-135.502] -- 0:00:10
831000 -- (-144.458) (-134.458) [-138.268] (-134.724) * (-136.878) (-134.487) [-137.732] (-136.469) -- 0:00:10
831500 -- [-135.979] (-136.066) (-138.911) (-135.016) * [-135.817] (-136.035) (-136.048) (-136.690) -- 0:00:10
832000 -- [-135.220] (-137.907) (-139.014) (-133.983) * (-141.203) (-135.707) [-136.363] (-134.558) -- 0:00:10
832500 -- (-136.914) (-137.110) [-139.093] (-134.158) * (-140.666) (-137.158) (-135.896) [-136.454] -- 0:00:10
833000 -- (-141.929) [-137.237] (-138.837) (-141.855) * (-137.187) (-138.492) [-136.822] (-138.242) -- 0:00:10
833500 -- (-138.131) (-135.919) [-138.268] (-134.777) * (-135.727) (-139.990) [-135.093] (-136.193) -- 0:00:09
834000 -- [-137.100] (-136.446) (-138.121) (-138.032) * (-136.118) (-136.167) (-135.672) [-135.287] -- 0:00:09
834500 -- (-138.956) [-135.462] (-139.199) (-136.397) * (-136.958) [-136.225] (-136.641) (-134.317) -- 0:00:09
835000 -- (-136.204) [-134.672] (-136.841) (-137.404) * (-136.535) [-137.726] (-138.516) (-135.606) -- 0:00:09
Average standard deviation of split frequencies: 0.007154
835500 -- [-138.592] (-136.265) (-138.216) (-134.315) * (-137.310) [-136.601] (-138.989) (-135.497) -- 0:00:09
836000 -- (-137.140) (-135.569) (-136.777) [-135.875] * (-139.311) (-138.636) (-135.209) [-134.341] -- 0:00:09
836500 -- (-139.003) [-135.686] (-138.780) (-134.492) * [-139.962] (-136.747) (-137.327) (-135.106) -- 0:00:09
837000 -- (-137.463) [-135.793] (-138.744) (-136.214) * (-137.635) [-135.080] (-135.376) (-137.646) -- 0:00:09
837500 -- [-137.414] (-134.667) (-134.644) (-135.968) * (-137.705) (-136.663) [-136.509] (-134.396) -- 0:00:09
838000 -- (-143.839) (-134.269) (-137.214) [-134.880] * (-139.136) (-134.488) (-140.989) [-135.520] -- 0:00:09
838500 -- (-140.311) (-134.344) [-141.690] (-135.026) * [-135.150] (-134.004) (-135.535) (-139.333) -- 0:00:09
839000 -- (-137.143) [-135.649] (-136.561) (-135.945) * (-137.238) (-135.994) [-139.247] (-139.675) -- 0:00:09
839500 -- [-137.428] (-135.136) (-135.427) (-135.877) * (-136.493) (-142.825) [-139.300] (-136.568) -- 0:00:09
840000 -- (-139.733) [-134.856] (-137.417) (-134.997) * (-137.888) (-135.646) [-135.274] (-136.926) -- 0:00:09
Average standard deviation of split frequencies: 0.007395
840500 -- (-136.262) [-136.988] (-137.213) (-138.341) * (-136.321) (-139.542) (-138.688) [-134.810] -- 0:00:09
841000 -- [-134.651] (-135.504) (-136.029) (-134.670) * [-137.534] (-136.446) (-134.619) (-135.363) -- 0:00:09
841500 -- (-134.405) [-134.580] (-136.503) (-136.803) * (-135.337) (-135.824) [-137.283] (-138.778) -- 0:00:09
842000 -- [-134.476] (-138.283) (-135.190) (-138.808) * [-136.290] (-135.677) (-135.926) (-137.874) -- 0:00:09
842500 -- (-135.771) (-135.410) [-136.837] (-135.910) * (-137.029) [-135.646] (-139.806) (-136.631) -- 0:00:09
843000 -- (-139.273) (-140.767) [-138.098] (-136.514) * (-136.881) (-137.888) (-136.675) [-139.511] -- 0:00:09
843500 -- (-139.182) (-135.315) [-134.912] (-136.598) * [-137.011] (-134.860) (-135.674) (-136.727) -- 0:00:09
844000 -- (-134.590) (-136.267) (-135.722) [-136.001] * [-135.818] (-135.338) (-135.215) (-135.017) -- 0:00:09
844500 -- (-134.708) (-134.717) (-136.893) [-134.547] * (-138.910) (-134.964) (-143.392) [-135.656] -- 0:00:09
845000 -- [-135.637] (-137.645) (-134.820) (-138.163) * (-137.708) [-135.538] (-134.113) (-137.112) -- 0:00:09
Average standard deviation of split frequencies: 0.007539
845500 -- (-134.996) [-139.397] (-134.291) (-136.247) * (-135.565) [-136.196] (-139.858) (-138.250) -- 0:00:09
846000 -- (-134.621) (-137.044) (-135.088) [-135.916] * [-138.380] (-136.040) (-141.247) (-136.651) -- 0:00:09
846500 -- (-138.641) [-135.752] (-137.416) (-136.132) * [-135.163] (-135.293) (-139.492) (-141.462) -- 0:00:09
847000 -- (-135.906) [-136.148] (-137.737) (-135.688) * [-134.362] (-134.756) (-137.679) (-139.310) -- 0:00:09
847500 -- (-138.448) [-134.902] (-138.624) (-137.830) * (-135.068) (-134.848) [-138.030] (-138.072) -- 0:00:09
848000 -- (-136.825) (-135.509) (-135.101) [-137.707] * (-142.003) (-135.084) (-135.176) [-135.420] -- 0:00:09
848500 -- (-135.552) (-134.009) [-137.217] (-136.657) * (-138.275) (-134.760) (-137.430) [-135.450] -- 0:00:09
849000 -- (-141.489) (-138.059) [-134.805] (-137.510) * (-137.212) (-136.032) (-134.400) [-138.084] -- 0:00:09
849500 -- (-136.517) [-138.981] (-134.470) (-138.952) * (-136.721) (-143.589) [-135.803] (-138.113) -- 0:00:09
850000 -- (-135.090) (-134.688) (-138.275) [-137.245] * [-135.498] (-135.458) (-136.401) (-137.100) -- 0:00:09
Average standard deviation of split frequencies: 0.007239
850500 -- [-137.860] (-135.943) (-135.076) (-134.412) * (-135.775) (-135.284) (-137.140) [-135.906] -- 0:00:08
851000 -- (-134.862) (-140.014) (-137.041) [-134.859] * (-136.921) [-136.206] (-138.383) (-135.553) -- 0:00:08
851500 -- (-134.941) (-136.120) [-135.119] (-134.964) * (-136.058) (-138.043) (-136.683) [-138.979] -- 0:00:08
852000 -- (-141.568) (-136.553) (-136.462) [-135.603] * (-134.942) (-137.191) [-134.829] (-138.790) -- 0:00:08
852500 -- (-141.587) (-135.455) (-137.075) [-136.259] * (-134.785) (-134.656) [-135.130] (-139.074) -- 0:00:08
853000 -- (-134.421) [-135.135] (-137.142) (-136.872) * (-135.000) [-134.575] (-137.949) (-137.962) -- 0:00:08
853500 -- [-133.870] (-136.328) (-134.491) (-134.619) * [-136.521] (-135.510) (-139.733) (-137.652) -- 0:00:08
854000 -- [-134.329] (-136.800) (-134.552) (-136.011) * (-136.203) (-135.423) [-135.054] (-139.849) -- 0:00:08
854500 -- (-136.028) (-138.022) [-134.517] (-137.004) * [-137.357] (-135.041) (-138.098) (-135.372) -- 0:00:08
855000 -- (-135.574) (-141.227) (-135.289) [-135.702] * (-135.833) (-140.026) [-137.527] (-136.871) -- 0:00:08
Average standard deviation of split frequencies: 0.007503
855500 -- (-135.647) (-141.374) [-134.585] (-139.204) * [-134.840] (-136.521) (-139.285) (-137.766) -- 0:00:08
856000 -- (-135.318) (-134.499) (-135.343) [-138.212] * (-136.016) [-135.497] (-135.346) (-137.038) -- 0:00:08
856500 -- [-139.933] (-138.772) (-137.969) (-142.295) * (-134.294) [-138.503] (-135.462) (-136.102) -- 0:00:08
857000 -- (-136.492) (-141.238) (-137.892) [-138.157] * (-135.325) (-142.604) (-135.654) [-135.967] -- 0:00:08
857500 -- [-134.525] (-139.079) (-137.489) (-136.350) * (-136.315) (-137.989) [-135.838] (-135.235) -- 0:00:08
858000 -- (-135.732) (-140.215) (-137.164) [-136.546] * (-134.561) [-138.540] (-134.211) (-138.674) -- 0:00:08
858500 -- [-135.483] (-140.889) (-145.535) (-137.039) * (-134.443) [-134.751] (-135.699) (-141.509) -- 0:00:08
859000 -- (-136.504) (-135.637) (-140.561) [-136.176] * (-135.231) [-138.299] (-135.421) (-136.942) -- 0:00:08
859500 -- (-137.812) [-134.548] (-135.993) (-134.517) * (-136.911) [-139.569] (-137.971) (-136.376) -- 0:00:08
860000 -- (-134.924) [-135.240] (-135.274) (-134.696) * (-136.835) (-140.601) [-135.007] (-138.458) -- 0:00:08
Average standard deviation of split frequencies: 0.007394
860500 -- (-138.687) (-135.340) [-136.989] (-136.710) * (-141.350) (-134.636) [-135.847] (-136.393) -- 0:00:08
861000 -- (-138.331) [-135.613] (-140.287) (-141.257) * [-134.887] (-135.175) (-136.447) (-135.361) -- 0:00:08
861500 -- (-135.866) [-134.795] (-136.790) (-135.609) * (-135.503) (-135.982) [-135.547] (-137.284) -- 0:00:08
862000 -- [-137.687] (-138.486) (-138.634) (-139.703) * (-135.608) (-138.130) [-136.330] (-134.913) -- 0:00:08
862500 -- [-138.061] (-136.045) (-134.989) (-140.582) * (-137.622) [-136.257] (-136.232) (-136.322) -- 0:00:08
863000 -- (-137.369) (-136.668) (-134.371) [-139.948] * [-139.791] (-134.830) (-135.996) (-135.301) -- 0:00:08
863500 -- [-136.966] (-137.889) (-135.225) (-136.608) * (-139.184) [-137.552] (-135.565) (-140.485) -- 0:00:08
864000 -- (-134.910) (-138.094) [-134.332] (-138.764) * (-138.849) [-134.813] (-137.478) (-134.789) -- 0:00:08
864500 -- [-136.608] (-139.365) (-136.673) (-137.699) * (-136.351) (-139.943) (-138.645) [-136.692] -- 0:00:08
865000 -- (-134.858) [-136.676] (-138.305) (-136.273) * (-134.909) (-135.631) [-135.012] (-138.336) -- 0:00:08
Average standard deviation of split frequencies: 0.007493
865500 -- (-137.523) [-136.711] (-140.371) (-140.440) * [-134.590] (-134.792) (-136.422) (-135.043) -- 0:00:08
866000 -- (-135.859) (-139.916) (-141.498) [-134.430] * [-137.803] (-135.657) (-136.805) (-137.342) -- 0:00:08
866500 -- (-137.042) (-136.074) [-134.682] (-136.357) * (-138.412) [-135.452] (-135.792) (-141.737) -- 0:00:08
867000 -- (-140.993) (-134.758) [-137.062] (-136.497) * (-135.820) (-138.584) (-137.124) [-134.987] -- 0:00:07
867500 -- (-137.037) (-137.118) [-137.092] (-136.311) * [-137.384] (-137.135) (-137.840) (-136.154) -- 0:00:07
868000 -- (-139.449) (-137.428) [-135.397] (-140.419) * (-134.893) (-134.020) [-137.126] (-136.643) -- 0:00:07
868500 -- (-137.847) (-137.402) [-134.857] (-137.843) * (-136.609) (-136.222) [-135.688] (-134.908) -- 0:00:07
869000 -- (-135.071) (-140.066) (-137.642) [-136.351] * (-136.309) [-139.974] (-136.672) (-135.000) -- 0:00:07
869500 -- (-137.143) (-137.082) [-135.016] (-134.857) * (-136.966) (-143.786) [-135.119] (-137.224) -- 0:00:07
870000 -- (-134.846) (-137.412) [-136.287] (-136.029) * (-138.106) (-142.943) (-136.134) [-135.865] -- 0:00:07
Average standard deviation of split frequencies: 0.007580
870500 -- (-134.749) (-135.778) [-137.543] (-137.033) * (-135.481) [-140.851] (-137.946) (-134.790) -- 0:00:07
871000 -- (-134.684) (-138.479) (-141.111) [-134.771] * (-137.581) (-134.386) (-136.668) [-135.539] -- 0:00:07
871500 -- (-138.958) [-136.147] (-135.529) (-136.675) * [-134.937] (-139.619) (-138.372) (-135.717) -- 0:00:07
872000 -- (-135.628) [-134.781] (-136.334) (-135.238) * (-134.576) (-134.945) (-135.173) [-134.578] -- 0:00:07
872500 -- (-136.089) [-135.484] (-136.949) (-135.298) * (-135.287) [-139.749] (-137.682) (-136.127) -- 0:00:07
873000 -- [-135.226] (-138.675) (-135.043) (-139.350) * [-136.210] (-140.112) (-137.566) (-136.172) -- 0:00:07
873500 -- (-137.486) (-135.061) (-136.343) [-136.507] * (-135.921) (-138.678) [-137.494] (-137.164) -- 0:00:07
874000 -- (-136.210) (-136.320) (-136.120) [-138.932] * (-143.571) (-136.364) [-142.783] (-137.916) -- 0:00:07
874500 -- (-136.568) (-134.922) (-135.100) [-134.673] * (-135.606) (-136.007) [-137.280] (-148.533) -- 0:00:07
875000 -- [-135.007] (-134.813) (-138.713) (-135.303) * [-134.937] (-135.102) (-135.943) (-136.076) -- 0:00:07
Average standard deviation of split frequencies: 0.007097
875500 -- (-134.405) [-137.216] (-134.410) (-134.742) * (-134.648) (-136.410) (-135.204) [-135.575] -- 0:00:07
876000 -- (-134.404) (-135.326) (-134.994) [-135.865] * (-137.132) [-136.271] (-134.519) (-137.278) -- 0:00:07
876500 -- [-137.188] (-137.455) (-134.133) (-136.032) * (-138.685) (-138.803) [-135.326] (-136.179) -- 0:00:07
877000 -- (-134.648) (-139.199) [-135.651] (-136.084) * (-134.808) [-136.553] (-135.026) (-139.691) -- 0:00:07
877500 -- (-134.788) (-140.450) (-136.799) [-135.899] * (-137.560) (-135.140) (-137.436) [-137.817] -- 0:00:07
878000 -- [-136.392] (-136.586) (-138.529) (-136.542) * (-137.629) [-136.325] (-140.053) (-138.912) -- 0:00:07
878500 -- (-136.962) (-136.033) (-139.346) [-136.566] * [-137.934] (-134.562) (-136.066) (-138.495) -- 0:00:07
879000 -- (-136.276) (-134.491) (-141.524) [-133.965] * (-136.600) (-134.739) [-136.455] (-138.802) -- 0:00:07
879500 -- [-135.715] (-136.817) (-138.141) (-135.236) * (-135.112) (-134.326) [-138.109] (-135.975) -- 0:00:07
880000 -- (-137.883) (-134.510) [-135.554] (-134.611) * (-134.979) (-135.896) [-137.985] (-136.085) -- 0:00:07
Average standard deviation of split frequencies: 0.007092
880500 -- [-136.809] (-134.968) (-136.681) (-136.263) * (-136.883) [-139.109] (-136.551) (-136.108) -- 0:00:07
881000 -- [-138.213] (-135.778) (-136.903) (-135.703) * (-137.001) (-136.843) [-135.687] (-135.082) -- 0:00:07
881500 -- [-134.915] (-138.801) (-138.828) (-137.078) * [-135.242] (-134.834) (-135.024) (-137.851) -- 0:00:07
882000 -- [-137.616] (-136.925) (-145.455) (-137.179) * (-137.262) (-134.756) (-136.507) [-135.886] -- 0:00:07
882500 -- (-136.243) (-136.016) (-140.073) [-135.920] * (-135.336) (-134.769) (-134.544) [-136.240] -- 0:00:07
883000 -- (-135.160) [-137.606] (-135.994) (-138.683) * (-135.864) (-135.622) [-134.507] (-138.897) -- 0:00:07
883500 -- [-135.709] (-144.486) (-134.700) (-139.547) * (-137.522) (-138.795) (-135.772) [-144.256] -- 0:00:06
884000 -- (-138.791) (-137.777) (-135.761) [-135.999] * (-134.479) (-137.604) (-139.547) [-138.744] -- 0:00:06
884500 -- (-137.497) (-136.287) (-134.840) [-141.713] * (-137.020) (-135.546) (-135.829) [-136.674] -- 0:00:06
885000 -- [-137.666] (-137.804) (-134.917) (-136.546) * (-136.792) [-135.833] (-136.333) (-138.232) -- 0:00:06
Average standard deviation of split frequencies: 0.006850
885500 -- [-135.176] (-138.687) (-134.322) (-135.000) * [-135.406] (-137.226) (-136.016) (-136.127) -- 0:00:06
886000 -- (-137.670) (-137.579) (-135.341) [-135.312] * [-135.232] (-135.292) (-138.770) (-139.948) -- 0:00:06
886500 -- [-134.121] (-137.189) (-134.910) (-134.283) * [-136.343] (-134.004) (-137.548) (-138.653) -- 0:00:06
887000 -- [-134.225] (-139.845) (-138.880) (-135.507) * [-139.221] (-135.238) (-139.852) (-136.179) -- 0:00:06
887500 -- (-134.386) (-135.415) (-139.285) [-134.326] * (-135.061) (-135.398) (-135.369) [-135.203] -- 0:00:06
888000 -- (-134.527) [-135.546] (-139.729) (-136.162) * (-136.768) [-134.771] (-136.143) (-136.092) -- 0:00:06
888500 -- (-135.350) (-137.292) (-139.930) [-137.100] * (-136.576) (-136.174) [-135.658] (-136.843) -- 0:00:06
889000 -- (-135.388) [-135.579] (-147.351) (-137.334) * (-137.668) (-138.085) [-135.987] (-134.712) -- 0:00:06
889500 -- [-136.469] (-137.232) (-135.395) (-137.254) * (-138.184) [-137.493] (-134.292) (-136.176) -- 0:00:06
890000 -- (-138.300) (-136.079) (-136.910) [-135.037] * [-135.362] (-138.114) (-135.381) (-135.122) -- 0:00:06
Average standard deviation of split frequencies: 0.007503
890500 -- (-138.461) (-136.108) [-134.489] (-136.469) * (-136.564) (-135.848) [-137.246] (-135.998) -- 0:00:06
891000 -- (-138.033) [-136.417] (-135.153) (-136.592) * [-136.584] (-139.958) (-135.820) (-140.704) -- 0:00:06
891500 -- (-136.116) (-138.025) [-135.276] (-135.220) * (-136.213) (-135.275) (-135.776) [-135.001] -- 0:00:06
892000 -- (-139.308) [-136.121] (-137.568) (-134.839) * [-134.485] (-135.366) (-138.517) (-137.031) -- 0:00:06
892500 -- (-141.278) [-137.755] (-140.008) (-135.696) * (-136.641) (-134.692) (-138.492) [-136.387] -- 0:00:06
893000 -- (-136.163) [-137.171] (-139.050) (-135.628) * (-137.925) (-136.984) (-138.686) [-135.648] -- 0:00:06
893500 -- (-135.275) [-135.484] (-138.003) (-134.668) * (-135.711) [-134.665] (-137.186) (-135.923) -- 0:00:06
894000 -- (-135.291) (-134.721) [-136.676] (-136.319) * (-135.619) (-136.718) [-137.218] (-135.141) -- 0:00:06
894500 -- (-134.371) [-135.801] (-135.537) (-137.793) * (-135.442) (-134.629) (-135.301) [-136.782] -- 0:00:06
895000 -- [-136.170] (-135.616) (-134.767) (-139.303) * [-136.305] (-137.300) (-139.718) (-136.765) -- 0:00:06
Average standard deviation of split frequencies: 0.007459
895500 -- (-135.085) (-135.630) [-137.127] (-138.651) * (-138.433) (-135.686) (-141.590) [-135.221] -- 0:00:06
896000 -- (-135.535) (-138.395) [-134.764] (-137.565) * [-136.854] (-135.206) (-136.239) (-136.558) -- 0:00:06
896500 -- (-134.904) (-135.912) (-138.088) [-137.471] * (-136.670) [-135.464] (-135.622) (-139.318) -- 0:00:06
897000 -- (-136.359) (-134.749) (-139.962) [-139.344] * (-134.362) (-134.611) (-136.270) [-134.308] -- 0:00:06
897500 -- [-137.134] (-136.402) (-136.451) (-139.443) * (-134.755) (-134.047) [-136.192] (-136.161) -- 0:00:06
898000 -- (-137.357) [-138.363] (-135.064) (-136.493) * [-134.749] (-134.629) (-137.001) (-138.995) -- 0:00:06
898500 -- (-136.228) (-136.055) [-135.144] (-135.301) * [-137.007] (-135.397) (-135.639) (-138.081) -- 0:00:06
899000 -- (-135.422) (-136.526) [-138.791] (-136.249) * (-138.727) (-137.026) [-141.845] (-140.696) -- 0:00:06
899500 -- [-135.013] (-137.445) (-137.619) (-136.240) * [-137.933] (-141.919) (-137.501) (-138.509) -- 0:00:06
900000 -- (-138.029) (-140.883) (-136.705) [-134.996] * (-134.102) [-140.744] (-135.929) (-136.677) -- 0:00:06
Average standard deviation of split frequencies: 0.007112
900500 -- [-140.120] (-137.128) (-134.594) (-137.561) * [-134.676] (-137.570) (-135.991) (-137.174) -- 0:00:05
901000 -- (-136.112) (-139.169) [-134.727] (-137.154) * (-134.778) [-135.457] (-136.392) (-136.371) -- 0:00:05
901500 -- (-136.012) (-141.141) [-139.954] (-136.943) * (-136.387) (-142.349) [-134.501] (-134.974) -- 0:00:05
902000 -- (-134.360) [-137.234] (-136.517) (-135.260) * [-138.600] (-136.408) (-134.219) (-137.053) -- 0:00:05
902500 -- [-133.898] (-143.757) (-137.962) (-136.788) * (-138.124) (-137.715) (-135.159) [-136.101] -- 0:00:05
903000 -- (-134.214) (-139.467) [-135.397] (-134.686) * (-137.120) [-137.444] (-139.163) (-135.582) -- 0:00:05
903500 -- (-137.395) [-136.558] (-137.705) (-139.219) * (-136.071) (-135.451) [-134.761] (-136.087) -- 0:00:05
904000 -- (-136.928) [-136.431] (-136.745) (-135.627) * (-135.703) [-137.348] (-134.888) (-135.116) -- 0:00:05
904500 -- (-134.846) [-135.532] (-140.367) (-135.344) * (-136.040) [-136.362] (-136.259) (-135.535) -- 0:00:05
905000 -- (-136.765) (-135.954) [-137.594] (-135.252) * [-135.635] (-134.776) (-137.289) (-136.299) -- 0:00:05
Average standard deviation of split frequencies: 0.007376
905500 -- [-134.920] (-138.294) (-140.493) (-135.015) * (-135.318) (-134.710) (-143.535) [-135.399] -- 0:00:05
906000 -- [-135.521] (-135.510) (-138.427) (-136.963) * (-135.333) (-136.462) (-135.872) [-136.366] -- 0:00:05
906500 -- (-137.118) (-136.802) (-140.864) [-135.456] * (-137.232) (-135.332) (-136.192) [-136.266] -- 0:00:05
907000 -- (-134.148) (-138.060) (-135.784) [-134.868] * (-136.001) (-137.069) (-140.021) [-136.987] -- 0:00:05
907500 -- [-136.969] (-135.802) (-137.174) (-136.507) * (-138.886) (-138.180) (-138.269) [-136.430] -- 0:00:05
908000 -- (-138.081) (-138.307) [-134.545] (-138.307) * (-141.323) (-136.272) (-138.093) [-134.533] -- 0:00:05
908500 -- (-134.790) (-140.661) [-135.783] (-135.140) * (-141.287) [-136.673] (-136.601) (-136.588) -- 0:00:05
909000 -- (-137.188) (-134.451) (-135.255) [-135.755] * (-139.714) [-137.784] (-136.230) (-137.116) -- 0:00:05
909500 -- [-137.036] (-135.680) (-136.286) (-137.769) * (-139.921) (-135.592) [-136.272] (-134.866) -- 0:00:05
910000 -- (-137.967) [-140.151] (-134.631) (-141.204) * (-136.164) [-136.337] (-137.566) (-135.354) -- 0:00:05
Average standard deviation of split frequencies: 0.007460
910500 -- (-137.399) (-136.244) (-135.057) [-142.380] * [-137.785] (-140.881) (-135.711) (-136.371) -- 0:00:05
911000 -- (-137.267) [-135.114] (-134.763) (-145.147) * [-138.009] (-143.808) (-137.768) (-137.742) -- 0:00:05
911500 -- (-134.081) [-134.963] (-135.957) (-142.360) * (-135.737) (-138.789) [-136.353] (-137.714) -- 0:00:05
912000 -- (-138.496) [-135.092] (-136.557) (-138.882) * (-135.632) (-137.501) (-136.933) [-136.894] -- 0:00:05
912500 -- (-135.469) [-136.203] (-137.778) (-135.622) * (-138.310) (-137.653) [-136.910] (-135.987) -- 0:00:05
913000 -- [-137.163] (-135.192) (-134.272) (-134.658) * [-138.403] (-137.342) (-134.983) (-134.411) -- 0:00:05
913500 -- (-136.420) (-136.961) (-134.697) [-135.088] * (-140.523) (-135.945) [-135.669] (-134.670) -- 0:00:05
914000 -- (-136.130) (-136.481) (-135.863) [-136.236] * (-136.802) (-135.297) (-135.127) [-135.898] -- 0:00:05
914500 -- (-136.836) [-134.909] (-135.622) (-137.653) * [-138.712] (-135.541) (-135.212) (-136.008) -- 0:00:05
915000 -- [-136.376] (-145.745) (-140.362) (-136.537) * (-136.755) (-134.346) [-135.301] (-135.001) -- 0:00:05
Average standard deviation of split frequencies: 0.007568
915500 -- (-137.709) [-135.110] (-136.896) (-137.053) * (-137.124) (-135.620) (-136.789) [-136.933] -- 0:00:05
916000 -- [-134.441] (-135.922) (-134.359) (-135.747) * (-137.616) [-134.605] (-135.850) (-134.805) -- 0:00:05
916500 -- (-135.422) (-136.200) (-136.835) [-137.183] * (-140.442) [-136.866] (-136.952) (-136.599) -- 0:00:05
917000 -- (-135.617) (-139.706) (-137.843) [-136.782] * [-134.939] (-136.069) (-135.370) (-135.254) -- 0:00:04
917500 -- (-135.935) (-137.906) (-135.772) [-135.460] * (-135.872) (-135.059) [-136.400] (-134.946) -- 0:00:04
918000 -- (-135.300) [-136.924] (-134.216) (-135.456) * (-135.450) [-135.270] (-139.502) (-137.048) -- 0:00:04
918500 -- (-136.906) (-138.991) [-136.206] (-137.413) * (-137.730) (-135.779) (-136.710) [-138.377] -- 0:00:04
919000 -- [-137.305] (-137.834) (-138.162) (-137.695) * [-136.670] (-137.298) (-136.484) (-137.043) -- 0:00:04
919500 -- [-135.431] (-137.248) (-136.783) (-136.526) * (-140.299) (-139.463) (-135.447) [-137.407] -- 0:00:04
920000 -- (-135.258) [-134.321] (-136.808) (-136.056) * [-141.500] (-136.503) (-135.428) (-134.571) -- 0:00:04
Average standard deviation of split frequencies: 0.007040
920500 -- (-135.564) (-137.184) [-134.594] (-135.850) * [-141.479] (-138.608) (-135.943) (-135.232) -- 0:00:04
921000 -- (-139.651) [-136.867] (-134.682) (-135.758) * (-135.425) (-139.310) (-134.523) [-136.231] -- 0:00:04
921500 -- (-135.754) (-139.032) [-136.746] (-138.631) * (-142.164) [-137.282] (-135.488) (-135.629) -- 0:00:04
922000 -- (-137.397) [-138.248] (-137.418) (-135.987) * [-137.525] (-135.987) (-136.247) (-134.630) -- 0:00:04
922500 -- (-136.966) (-137.895) (-136.819) [-137.522] * (-136.452) (-135.800) (-135.370) [-141.864] -- 0:00:04
923000 -- (-135.732) [-136.314] (-136.961) (-136.964) * [-136.266] (-136.350) (-135.455) (-141.785) -- 0:00:04
923500 -- (-137.641) (-137.936) [-135.032] (-138.601) * (-134.755) (-138.675) (-134.627) [-134.717] -- 0:00:04
924000 -- (-141.562) [-137.144] (-137.760) (-134.741) * (-135.797) [-139.677] (-139.405) (-139.183) -- 0:00:04
924500 -- (-136.907) (-135.647) (-140.599) [-134.611] * [-135.680] (-134.966) (-138.591) (-140.351) -- 0:00:04
925000 -- [-134.851] (-136.629) (-138.054) (-136.024) * [-137.528] (-136.729) (-137.061) (-143.006) -- 0:00:04
Average standard deviation of split frequencies: 0.007307
925500 -- (-137.030) [-136.602] (-135.212) (-136.527) * [-136.857] (-135.294) (-137.642) (-138.124) -- 0:00:04
926000 -- (-137.537) [-134.513] (-137.256) (-138.050) * (-136.517) (-135.533) [-136.252] (-137.078) -- 0:00:04
926500 -- [-133.882] (-134.047) (-137.433) (-136.279) * [-134.096] (-135.554) (-136.926) (-137.071) -- 0:00:04
927000 -- (-140.721) (-137.887) [-137.625] (-137.167) * (-135.309) (-139.164) (-143.159) [-134.956] -- 0:00:04
927500 -- [-134.511] (-137.093) (-135.301) (-138.120) * [-135.120] (-136.216) (-136.159) (-136.045) -- 0:00:04
928000 -- [-134.389] (-138.683) (-139.152) (-144.402) * (-140.494) [-135.357] (-138.065) (-134.659) -- 0:00:04
928500 -- (-138.329) (-135.273) [-138.838] (-140.918) * [-134.783] (-135.735) (-135.945) (-135.765) -- 0:00:04
929000 -- (-134.184) (-137.324) [-136.508] (-139.843) * [-135.629] (-135.037) (-135.303) (-139.628) -- 0:00:04
929500 -- (-135.686) [-137.336] (-137.012) (-141.841) * (-135.219) (-135.661) (-137.430) [-136.812] -- 0:00:04
930000 -- (-135.451) (-134.946) (-135.877) [-134.840] * (-144.414) (-138.143) [-136.851] (-134.830) -- 0:00:04
Average standard deviation of split frequencies: 0.006648
930500 -- (-134.728) (-137.010) [-136.005] (-135.191) * [-134.907] (-136.137) (-136.745) (-135.229) -- 0:00:04
931000 -- (-138.156) (-134.758) (-136.798) [-135.993] * (-135.178) (-137.576) [-134.671] (-135.574) -- 0:00:04
931500 -- (-138.767) [-138.434] (-138.559) (-137.664) * (-137.606) (-136.130) (-134.254) [-135.499] -- 0:00:04
932000 -- (-134.247) (-135.118) [-135.245] (-137.868) * [-140.981] (-136.419) (-137.317) (-136.458) -- 0:00:04
932500 -- (-136.106) (-136.032) [-135.803] (-138.514) * [-135.131] (-139.779) (-135.926) (-137.206) -- 0:00:04
933000 -- [-134.808] (-142.832) (-137.555) (-137.630) * [-135.787] (-135.796) (-136.461) (-137.577) -- 0:00:04
933500 -- (-134.750) (-135.585) (-137.010) [-135.812] * (-136.465) (-135.788) [-134.904] (-134.933) -- 0:00:03
934000 -- (-136.893) (-137.023) [-135.914] (-134.718) * (-136.658) [-136.554] (-135.445) (-144.604) -- 0:00:03
934500 -- (-138.317) [-136.071] (-138.783) (-139.041) * (-135.927) [-138.074] (-135.832) (-137.505) -- 0:00:03
935000 -- [-135.273] (-138.432) (-138.567) (-139.858) * (-137.347) [-138.146] (-134.397) (-135.955) -- 0:00:03
Average standard deviation of split frequencies: 0.006413
935500 -- [-136.317] (-140.686) (-137.113) (-136.474) * [-135.500] (-139.377) (-136.874) (-134.127) -- 0:00:03
936000 -- (-143.108) (-137.667) [-134.520] (-135.516) * (-135.473) (-134.380) [-135.447] (-135.812) -- 0:00:03
936500 -- (-135.435) (-136.870) [-135.157] (-135.205) * (-135.451) [-137.253] (-137.996) (-137.797) -- 0:00:03
937000 -- (-136.304) (-134.951) [-135.193] (-135.604) * (-141.522) [-136.210] (-134.840) (-138.289) -- 0:00:03
937500 -- (-135.453) [-134.960] (-136.237) (-134.443) * (-138.793) (-135.744) (-136.783) [-135.659] -- 0:00:03
938000 -- (-136.271) (-135.603) (-134.245) [-136.986] * [-137.183] (-134.656) (-137.213) (-136.259) -- 0:00:03
938500 -- (-134.635) (-138.912) [-135.250] (-135.812) * (-137.331) (-134.400) [-136.371] (-135.626) -- 0:00:03
939000 -- [-134.999] (-137.777) (-135.634) (-137.414) * [-136.782] (-134.769) (-136.457) (-135.336) -- 0:00:03
939500 -- [-135.022] (-137.944) (-137.994) (-140.927) * (-138.310) (-135.125) (-136.739) [-135.027] -- 0:00:03
940000 -- (-136.591) [-138.321] (-136.629) (-137.266) * (-139.412) (-135.124) [-136.662] (-135.967) -- 0:00:03
Average standard deviation of split frequencies: 0.006314
940500 -- [-134.803] (-134.619) (-136.168) (-139.562) * (-137.995) [-136.404] (-135.689) (-138.443) -- 0:00:03
941000 -- (-135.345) [-135.713] (-135.918) (-134.857) * [-134.343] (-137.322) (-135.254) (-140.020) -- 0:00:03
941500 -- (-136.887) (-136.861) (-135.566) [-135.591] * (-138.027) [-135.736] (-136.133) (-136.461) -- 0:00:03
942000 -- (-137.912) (-138.718) (-136.292) [-135.286] * (-135.111) (-135.377) [-135.377] (-136.410) -- 0:00:03
942500 -- (-135.731) [-135.615] (-138.664) (-137.124) * (-135.123) (-136.519) (-135.004) [-135.793] -- 0:00:03
943000 -- (-136.831) (-135.281) (-144.106) [-135.035] * (-135.441) [-138.962] (-140.107) (-138.605) -- 0:00:03
943500 -- [-134.728] (-138.084) (-143.745) (-136.330) * (-135.427) (-137.235) [-136.195] (-139.211) -- 0:00:03
944000 -- (-134.552) [-138.586] (-136.932) (-135.873) * (-134.336) (-138.456) [-137.612] (-135.889) -- 0:00:03
944500 -- [-134.905] (-135.945) (-136.469) (-135.956) * (-135.523) [-136.975] (-135.588) (-142.443) -- 0:00:03
945000 -- (-135.704) (-135.476) (-136.776) [-135.889] * [-135.383] (-136.195) (-134.731) (-137.933) -- 0:00:03
Average standard deviation of split frequencies: 0.006412
945500 -- (-136.379) (-134.944) [-138.790] (-139.104) * (-137.242) (-136.731) [-134.204] (-135.103) -- 0:00:03
946000 -- (-136.794) [-135.754] (-137.275) (-136.869) * (-137.402) (-138.254) (-134.386) [-135.329] -- 0:00:03
946500 -- (-136.165) (-137.512) [-135.482] (-136.477) * (-137.444) (-139.084) [-136.488] (-136.580) -- 0:00:03
947000 -- (-134.733) [-137.970] (-137.125) (-135.908) * (-138.997) (-134.939) (-135.541) [-141.179] -- 0:00:03
947500 -- (-135.076) (-138.063) [-135.402] (-141.213) * [-139.052] (-138.555) (-138.799) (-138.455) -- 0:00:03
948000 -- [-137.084] (-135.911) (-135.499) (-138.351) * (-135.811) (-138.263) (-136.305) [-134.681] -- 0:00:03
948500 -- (-137.019) (-141.752) [-142.635] (-143.796) * (-135.411) (-137.997) (-136.659) [-135.227] -- 0:00:03
949000 -- (-137.383) (-137.600) (-136.939) [-139.464] * (-137.046) (-135.446) [-137.199] (-135.448) -- 0:00:03
949500 -- (-137.213) [-136.449] (-136.867) (-134.680) * (-135.098) (-134.223) (-135.556) [-136.240] -- 0:00:03
950000 -- (-134.684) [-138.258] (-135.365) (-135.140) * (-138.027) (-134.300) [-134.625] (-135.521) -- 0:00:03
Average standard deviation of split frequencies: 0.006942
950500 -- (-134.548) (-139.946) [-136.406] (-136.450) * (-138.310) (-134.775) (-134.337) [-135.199] -- 0:00:02
951000 -- [-136.701] (-139.525) (-138.785) (-134.174) * (-138.965) [-135.792] (-137.311) (-137.837) -- 0:00:02
951500 -- (-139.689) (-139.125) (-138.228) [-134.841] * (-136.337) [-137.064] (-137.564) (-139.423) -- 0:00:02
952000 -- (-135.479) (-145.458) (-137.295) [-135.804] * [-137.352] (-136.784) (-137.137) (-135.575) -- 0:00:02
952500 -- [-135.277] (-137.368) (-138.538) (-136.277) * [-136.015] (-136.148) (-138.657) (-136.838) -- 0:00:02
953000 -- [-135.590] (-137.179) (-138.846) (-138.899) * (-135.530) [-135.786] (-143.023) (-138.423) -- 0:00:02
953500 -- (-140.198) (-136.710) [-135.175] (-136.775) * (-134.727) (-136.322) [-135.922] (-136.741) -- 0:00:02
954000 -- (-136.060) [-136.157] (-137.966) (-136.974) * (-135.215) (-137.771) (-136.831) [-135.586] -- 0:00:02
954500 -- (-139.910) [-136.462] (-139.839) (-138.107) * [-136.046] (-137.327) (-137.845) (-136.210) -- 0:00:02
955000 -- (-136.567) (-135.214) (-136.434) [-135.869] * (-138.338) [-136.268] (-135.580) (-137.712) -- 0:00:02
Average standard deviation of split frequencies: 0.006965
955500 -- (-137.964) (-138.930) (-134.943) [-134.926] * [-136.385] (-136.027) (-134.907) (-137.693) -- 0:00:02
956000 -- (-136.230) (-136.334) (-136.170) [-135.192] * [-135.274] (-139.011) (-135.658) (-135.996) -- 0:00:02
956500 -- [-136.266] (-137.177) (-135.877) (-135.085) * (-135.219) [-136.054] (-135.254) (-135.931) -- 0:00:02
957000 -- (-141.318) (-136.093) (-136.969) [-135.163] * (-136.176) [-138.090] (-135.464) (-135.444) -- 0:00:02
957500 -- (-137.638) (-135.508) (-139.796) [-135.564] * [-136.470] (-137.045) (-137.476) (-136.408) -- 0:00:02
958000 -- (-135.045) (-135.429) (-134.937) [-139.294] * [-134.868] (-135.360) (-139.536) (-137.437) -- 0:00:02
958500 -- [-138.973] (-134.401) (-136.538) (-137.936) * (-136.128) (-134.512) (-137.106) [-136.651] -- 0:00:02
959000 -- (-138.155) [-135.836] (-135.096) (-135.341) * [-135.493] (-135.234) (-137.393) (-139.252) -- 0:00:02
959500 -- (-136.749) [-136.014] (-135.316) (-136.499) * (-135.525) (-136.178) (-134.799) [-134.875] -- 0:00:02
960000 -- [-134.749] (-136.927) (-139.378) (-135.554) * (-137.731) (-135.277) (-137.372) [-135.323] -- 0:00:02
Average standard deviation of split frequencies: 0.007207
960500 -- (-137.917) [-134.842] (-137.216) (-136.432) * [-134.895] (-135.542) (-134.685) (-140.113) -- 0:00:02
961000 -- (-136.703) (-136.108) [-138.337] (-137.951) * (-136.602) (-135.314) (-137.710) [-134.618] -- 0:00:02
961500 -- [-135.168] (-136.586) (-136.819) (-139.287) * (-137.347) (-136.316) [-135.376] (-135.647) -- 0:00:02
962000 -- [-134.783] (-138.761) (-136.039) (-135.909) * (-139.805) [-135.499] (-135.831) (-136.995) -- 0:00:02
962500 -- (-135.690) (-137.269) (-140.626) [-137.373] * (-139.023) (-134.808) [-137.284] (-135.339) -- 0:00:02
963000 -- (-134.298) (-135.214) (-138.262) [-134.665] * (-138.577) (-139.099) (-134.731) [-137.494] -- 0:00:02
963500 -- (-138.904) (-136.999) (-134.430) [-138.761] * (-137.675) (-141.986) [-135.102] (-136.237) -- 0:00:02
964000 -- (-139.558) (-136.371) (-134.726) [-134.345] * (-149.055) (-138.625) (-135.393) [-136.753] -- 0:00:02
964500 -- [-135.525] (-137.021) (-136.227) (-135.312) * (-139.075) (-140.571) [-137.357] (-137.868) -- 0:00:02
965000 -- (-135.330) (-140.370) (-135.260) [-135.860] * (-135.762) (-137.509) (-142.121) [-135.144] -- 0:00:02
Average standard deviation of split frequencies: 0.007578
965500 -- (-137.990) (-135.653) [-140.367] (-136.824) * [-136.583] (-140.592) (-139.524) (-136.544) -- 0:00:02
966000 -- (-143.686) [-137.567] (-136.465) (-138.259) * [-135.508] (-134.430) (-137.915) (-136.831) -- 0:00:02
966500 -- (-137.996) (-135.054) (-139.440) [-134.689] * (-135.495) (-135.414) (-135.773) [-135.178] -- 0:00:02
967000 -- [-134.863] (-138.356) (-135.110) (-136.754) * (-137.731) (-134.948) (-137.614) [-136.371] -- 0:00:01
967500 -- [-136.305] (-138.406) (-135.093) (-136.565) * [-135.800] (-136.919) (-136.301) (-136.097) -- 0:00:01
968000 -- (-135.513) (-136.364) (-135.996) [-136.026] * (-139.254) (-137.242) [-136.621] (-135.852) -- 0:00:01
968500 -- (-135.332) (-136.327) (-137.985) [-137.547] * (-134.425) (-138.126) [-136.011] (-136.141) -- 0:00:01
969000 -- [-135.037] (-139.570) (-136.094) (-137.739) * (-135.457) [-135.971] (-135.951) (-134.693) -- 0:00:01
969500 -- (-137.436) [-135.942] (-135.589) (-140.868) * (-138.123) (-144.914) (-135.218) [-134.565] -- 0:00:01
970000 -- (-135.937) (-136.019) [-135.786] (-134.827) * (-135.623) (-137.396) [-134.425] (-134.918) -- 0:00:01
Average standard deviation of split frequencies: 0.007770
970500 -- (-134.536) [-134.690] (-136.799) (-134.273) * (-137.146) (-134.729) (-137.923) [-135.951] -- 0:00:01
971000 -- (-135.979) (-134.773) (-135.800) [-136.536] * (-135.903) (-135.926) [-140.193] (-137.318) -- 0:00:01
971500 -- (-135.320) (-136.957) [-134.434] (-137.146) * (-138.526) (-134.977) [-138.025] (-143.722) -- 0:00:01
972000 -- (-137.001) (-134.374) [-134.216] (-136.917) * (-142.529) (-134.723) [-134.336] (-134.929) -- 0:00:01
972500 -- (-135.412) [-135.562] (-138.009) (-135.782) * [-141.559] (-134.725) (-136.414) (-137.923) -- 0:00:01
973000 -- (-135.839) (-136.038) (-137.154) [-139.008] * (-137.731) (-136.373) (-136.853) [-136.494] -- 0:00:01
973500 -- (-135.433) [-137.365] (-138.208) (-145.294) * (-135.830) (-138.670) (-138.875) [-135.214] -- 0:00:01
974000 -- [-135.973] (-135.704) (-134.802) (-141.099) * [-135.869] (-136.003) (-135.523) (-134.671) -- 0:00:01
974500 -- (-134.217) (-138.690) [-136.261] (-135.195) * (-136.136) (-135.536) (-136.333) [-134.578] -- 0:00:01
975000 -- (-136.220) [-136.241] (-138.079) (-135.305) * (-136.188) (-137.445) (-135.453) [-138.440] -- 0:00:01
Average standard deviation of split frequencies: 0.008183
975500 -- (-138.134) [-136.236] (-135.188) (-134.899) * (-134.870) (-135.953) [-134.807] (-140.551) -- 0:00:01
976000 -- (-137.282) [-136.032] (-136.589) (-135.571) * (-137.463) [-135.294] (-134.494) (-141.885) -- 0:00:01
976500 -- (-138.479) (-135.955) [-138.157] (-137.096) * (-138.254) (-137.560) (-134.744) [-140.159] -- 0:00:01
977000 -- (-135.222) [-134.716] (-135.071) (-136.854) * (-138.329) [-135.413] (-134.842) (-140.831) -- 0:00:01
977500 -- (-134.567) (-134.618) (-135.964) [-136.194] * (-137.632) [-135.244] (-135.262) (-136.882) -- 0:00:01
978000 -- (-135.678) [-136.440] (-135.780) (-137.177) * (-134.512) (-138.580) [-135.687] (-136.568) -- 0:00:01
978500 -- [-137.929] (-137.204) (-137.368) (-136.721) * (-136.496) (-138.673) [-137.476] (-135.750) -- 0:00:01
979000 -- (-137.873) (-135.284) (-136.846) [-136.562] * [-134.750] (-135.486) (-135.592) (-135.607) -- 0:00:01
979500 -- (-137.756) [-134.532] (-135.021) (-135.551) * (-141.659) (-134.723) (-137.889) [-135.333] -- 0:00:01
980000 -- (-137.750) (-137.423) (-136.226) [-135.092] * (-138.789) (-136.272) (-138.131) [-134.264] -- 0:00:01
Average standard deviation of split frequencies: 0.008172
980500 -- (-134.022) (-135.010) (-136.064) [-135.765] * (-137.617) [-137.057] (-136.528) (-135.968) -- 0:00:01
981000 -- (-136.767) (-135.070) [-137.290] (-135.207) * [-135.970] (-139.078) (-137.120) (-140.619) -- 0:00:01
981500 -- [-138.054] (-137.228) (-137.061) (-134.991) * [-137.498] (-137.121) (-135.137) (-137.226) -- 0:00:01
982000 -- [-137.826] (-137.130) (-136.276) (-135.022) * (-135.299) [-137.093] (-135.605) (-136.913) -- 0:00:01
982500 -- (-137.770) (-135.579) [-136.069] (-135.915) * (-136.504) (-137.586) (-141.090) [-134.897] -- 0:00:01
983000 -- (-139.116) (-135.495) [-137.504] (-134.327) * (-137.232) (-139.008) [-136.096] (-135.376) -- 0:00:01
983500 -- (-135.057) [-136.461] (-135.600) (-137.802) * (-136.854) (-140.714) [-134.953] (-135.989) -- 0:00:00
984000 -- (-136.819) (-139.667) (-134.908) [-136.079] * (-135.432) (-136.568) (-136.719) [-137.803] -- 0:00:00
984500 -- (-143.791) [-142.030] (-136.962) (-135.015) * (-136.774) (-138.020) (-137.813) [-137.416] -- 0:00:00
985000 -- (-140.643) [-135.553] (-137.466) (-141.241) * (-135.378) (-134.589) (-136.465) [-138.602] -- 0:00:00
Average standard deviation of split frequencies: 0.008071
985500 -- (-135.771) [-136.167] (-137.662) (-141.546) * (-135.237) (-134.715) [-136.222] (-139.355) -- 0:00:00
986000 -- [-134.883] (-135.512) (-136.226) (-135.985) * [-135.250] (-138.133) (-141.244) (-134.266) -- 0:00:00
986500 -- (-135.690) (-136.780) (-137.977) [-134.594] * (-140.401) (-136.794) [-134.257] (-135.939) -- 0:00:00
987000 -- (-135.375) (-137.880) [-134.934] (-135.859) * [-137.033] (-136.009) (-139.482) (-136.161) -- 0:00:00
987500 -- [-134.647] (-137.705) (-137.155) (-137.997) * (-135.672) (-134.885) [-136.497] (-137.736) -- 0:00:00
988000 -- (-134.474) (-135.189) (-136.316) [-135.659] * (-135.147) (-134.286) [-133.960] (-141.309) -- 0:00:00
988500 -- [-135.872] (-139.108) (-135.085) (-139.397) * (-135.291) (-137.190) [-135.108] (-135.914) -- 0:00:00
989000 -- [-135.411] (-136.354) (-134.129) (-136.935) * [-140.720] (-137.599) (-136.228) (-138.461) -- 0:00:00
989500 -- (-137.650) (-136.465) [-134.957] (-135.174) * [-142.412] (-136.874) (-136.245) (-134.873) -- 0:00:00
990000 -- [-134.361] (-139.544) (-137.136) (-135.440) * (-137.302) (-136.536) (-135.900) [-134.443] -- 0:00:00
Average standard deviation of split frequencies: 0.008061
990500 -- (-137.056) (-138.877) (-136.344) [-134.159] * (-137.442) (-134.977) [-134.448] (-134.332) -- 0:00:00
991000 -- (-139.613) [-135.147] (-137.828) (-136.401) * [-135.631] (-137.292) (-134.399) (-134.806) -- 0:00:00
991500 -- [-139.090] (-137.129) (-137.597) (-137.586) * [-136.611] (-143.179) (-135.459) (-136.494) -- 0:00:00
992000 -- (-138.360) (-136.316) (-135.774) [-136.716] * (-136.042) (-137.838) [-135.841] (-139.459) -- 0:00:00
992500 -- (-141.225) (-138.867) [-135.999] (-136.840) * (-135.705) [-136.582] (-138.973) (-137.777) -- 0:00:00
993000 -- [-137.404] (-135.689) (-139.073) (-136.043) * (-137.493) (-140.559) [-144.541] (-135.196) -- 0:00:00
993500 -- [-135.913] (-134.909) (-137.206) (-134.916) * (-138.898) (-134.698) [-137.095] (-138.503) -- 0:00:00
994000 -- (-135.307) [-136.212] (-137.016) (-137.215) * [-140.436] (-135.583) (-134.050) (-134.988) -- 0:00:00
994500 -- (-134.883) (-139.600) [-137.347] (-134.861) * (-137.143) (-138.418) [-134.301] (-135.743) -- 0:00:00
995000 -- (-136.929) [-135.444] (-136.652) (-134.113) * (-136.309) [-136.913] (-136.405) (-139.217) -- 0:00:00
Average standard deviation of split frequencies: 0.007740
995500 -- (-134.030) [-138.108] (-138.246) (-134.762) * (-136.457) (-136.826) (-137.498) [-137.181] -- 0:00:00
996000 -- (-136.351) (-139.507) (-135.937) [-140.675] * [-135.084] (-137.817) (-136.580) (-136.934) -- 0:00:00
996500 -- [-134.893] (-140.528) (-137.643) (-138.516) * [-138.284] (-136.831) (-136.030) (-135.721) -- 0:00:00
997000 -- [-134.836] (-140.753) (-136.076) (-137.721) * [-134.974] (-138.598) (-134.040) (-136.291) -- 0:00:00
997500 -- (-137.060) (-138.691) (-137.613) [-136.152] * (-134.285) (-135.970) [-136.021] (-138.278) -- 0:00:00
998000 -- (-135.818) (-134.825) (-136.065) [-134.423] * (-134.915) (-141.297) (-135.722) [-139.548] -- 0:00:00
998500 -- (-137.451) (-134.586) [-135.871] (-134.758) * (-135.281) (-136.271) (-138.630) [-136.856] -- 0:00:00
999000 -- (-136.830) [-135.516] (-137.128) (-136.016) * (-135.326) (-136.443) (-138.985) [-135.073] -- 0:00:00
999500 -- (-135.549) (-135.508) (-136.735) [-136.574] * (-134.940) (-137.116) (-137.364) [-135.472] -- 0:00:00
1000000 -- (-137.253) [-135.132] (-137.584) (-135.046) * (-137.253) [-136.030] (-136.719) (-136.264) -- 0:00:00
Average standard deviation of split frequencies: 0.007420
Analysis completed in 60 seconds
Analysis used 58.03 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -133.83
Likelihood of best state for "cold" chain of run 2 was -133.83
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
58.8 % ( 46 %) Dirichlet(Pi{all})
54.5 % ( 41 %) Slider(Pi{all})
78.7 % ( 54 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
32.2 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 84 %) ParsSPR(Tau{all},V{all})
28.3 % ( 25 %) Multiplier(V{all})
97.5 % ( 95 %) Nodeslider(V{all})
30.6 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 68 %) Dirichlet(Revmat{all})
99.8 % ( 99 %) Slider(Revmat{all})
60.4 % ( 52 %) Dirichlet(Pi{all})
55.7 % ( 39 %) Slider(Pi{all})
78.3 % ( 61 %) Multiplier(Alpha{1,2})
78.1 % ( 48 %) Multiplier(Alpha{3})
32.6 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.8 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166768 0.82 0.67
3 | 166776 166596 0.84
4 | 166817 166228 166815
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.65 0.50
2 | 167621 0.82 0.67
3 | 166122 166271 0.84
4 | 166777 166684 166525
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -135.61
| 1 1 2 2 |
| 1 2 2 2 1 2 |
| 1 1 1 1 1|
| 1 12 21 * 1 122 111 1 12 1 |
| 2 2222 1112 2 1 2* 12 12 * 1 21 2112 12 |
|21 22 22 2 1 1 1 22 1 11 * 2 |
| 1 1 11 2 1 1 2 2 2 22 2 1 |
| 2 1 2 1 2 2 1 1 |
| 2 2 2 2 |
| 1 1 1 22 2|
| * 21 2 |
| 1 2 |
| |
| |
|1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -137.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -135.55 -143.43
2 -135.58 -139.85
--------------------------------------
TOTAL -135.56 -142.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892291 0.090372 0.378814 1.517238 0.861251 1363.36 1415.26 1.000
r(A<->C){all} 0.169384 0.019246 0.000065 0.439712 0.136756 247.32 258.60 1.005
r(A<->G){all} 0.165264 0.018731 0.000172 0.436430 0.131361 264.88 279.14 1.008
r(A<->T){all} 0.171391 0.019880 0.000058 0.451779 0.134850 167.78 169.24 1.002
r(C<->G){all} 0.158052 0.019419 0.000034 0.435484 0.115805 163.68 262.88 1.001
r(C<->T){all} 0.171656 0.022464 0.000030 0.481276 0.131444 133.23 156.60 1.006
r(G<->T){all} 0.164252 0.019284 0.000053 0.438871 0.128499 268.47 290.91 1.000
pi(A){all} 0.319793 0.002090 0.231743 0.409893 0.317760 1313.47 1321.49 1.000
pi(C){all} 0.242472 0.001729 0.161970 0.321794 0.240618 967.81 1097.91 1.000
pi(G){all} 0.280605 0.001918 0.196452 0.365995 0.279664 1143.78 1176.27 1.000
pi(T){all} 0.157130 0.001222 0.090783 0.224252 0.155541 1200.26 1300.58 1.000
alpha{1,2} 0.403241 0.217820 0.000104 1.353412 0.236805 1439.20 1454.50 1.000
alpha{3} 0.465495 0.271934 0.000179 1.480327 0.293446 1321.21 1374.46 1.000
pinvar{all} 0.980683 0.000592 0.934655 0.999996 0.988726 1036.23 1250.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..**..
9 -- ..****
10 -- ..*.*.
11 -- ...**.
12 -- ..*..*
13 -- .****.
14 -- ....**
15 -- .*.***
16 -- ...*.*
17 -- .*.*..
18 -- .**...
19 -- .***.*
20 -- .*..*.
21 -- .**.**
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.005182 0.148568 0.155896 2
8 453 0.150899 0.015546 0.139907 0.161892 2
9 452 0.150566 0.016017 0.139241 0.161892 2
10 443 0.147568 0.009893 0.140573 0.154564 2
11 440 0.146569 0.012248 0.137908 0.155230 2
12 438 0.145903 0.011306 0.137908 0.153897 2
13 431 0.143571 0.002355 0.141905 0.145237 2
14 429 0.142905 0.008009 0.137242 0.148568 2
15 423 0.140906 0.001413 0.139907 0.141905 2
16 422 0.140573 0.002827 0.138574 0.142572 2
17 420 0.139907 0.011306 0.131912 0.147901 2
18 420 0.139907 0.002827 0.137908 0.141905 2
19 419 0.139574 0.005182 0.135909 0.143238 2
20 382 0.127249 0.000942 0.126582 0.127915 2
21 382 0.127249 0.002827 0.125250 0.129247 2
22 279 0.092938 0.010835 0.085276 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.095753 0.009746 0.000042 0.298393 0.064947 1.000 2
length{all}[2] 0.099289 0.009460 0.000090 0.301209 0.068382 1.000 2
length{all}[3] 0.098008 0.009928 0.000043 0.293437 0.066980 1.000 2
length{all}[4] 0.099692 0.010082 0.000014 0.302952 0.069621 1.000 2
length{all}[5] 0.100412 0.010025 0.000016 0.309302 0.070096 1.000 2
length{all}[6] 0.099317 0.010066 0.000047 0.294605 0.068893 1.000 2
length{all}[7] 0.105233 0.010045 0.000366 0.300345 0.073201 0.998 2
length{all}[8] 0.104422 0.010306 0.000492 0.282800 0.069785 0.999 2
length{all}[9] 0.099699 0.010050 0.000007 0.289812 0.068025 0.998 2
length{all}[10] 0.103792 0.012341 0.000110 0.311047 0.068105 0.998 2
length{all}[11] 0.105165 0.010669 0.000253 0.325350 0.078186 0.998 2
length{all}[12] 0.101082 0.009377 0.000004 0.305687 0.070499 1.001 2
length{all}[13] 0.094758 0.010419 0.000380 0.289708 0.063222 0.998 2
length{all}[14] 0.091110 0.008293 0.000392 0.283840 0.059326 0.998 2
length{all}[15] 0.101895 0.010317 0.000176 0.296882 0.071648 0.999 2
length{all}[16] 0.104935 0.010130 0.000168 0.295969 0.072523 1.004 2
length{all}[17] 0.102897 0.012930 0.000206 0.328179 0.065694 0.998 2
length{all}[18] 0.098530 0.010245 0.000521 0.293988 0.070618 0.999 2
length{all}[19] 0.106357 0.011708 0.000883 0.322716 0.074607 0.999 2
length{all}[20] 0.097829 0.009708 0.000483 0.305993 0.064469 0.997 2
length{all}[21] 0.101151 0.011511 0.000821 0.301431 0.068223 1.005 2
length{all}[22] 0.097705 0.009257 0.000753 0.283697 0.069531 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007420
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 99
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 22 patterns at 33 / 33 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 22 patterns at 33 / 33 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
21472 bytes for conP
1936 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064371 0.073190 0.073421 0.049109 0.048731 0.089776 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -138.192676
Iterating by ming2
Initial: fx= 138.192676
x= 0.06437 0.07319 0.07342 0.04911 0.04873 0.08978 0.30000 1.30000
1 h-m-p 0.0000 0.0015 79.2672 ++++ 128.717850 m 0.0015 15 | 1/8
2 h-m-p 0.0095 0.6938 11.4049 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 73.0923 ++ 128.655561 m 0.0000 48 | 2/8
4 h-m-p 0.0014 0.7044 10.9603 -----------.. | 2/8
5 h-m-p 0.0000 0.0005 65.3048 +++ 126.641663 m 0.0005 80 | 3/8
6 h-m-p 0.0028 0.8631 9.3745 ------------.. | 3/8
7 h-m-p 0.0000 0.0003 56.7028 +++ 125.763225 m 0.0003 113 | 4/8
8 h-m-p 0.0022 1.0830 7.7191 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 46.3599 ++ 125.747837 m 0.0000 145 | 5/8
10 h-m-p 0.0032 1.5968 5.3803 ------------.. | 5/8
11 h-m-p 0.0000 0.0005 32.7230 +++ 125.202783 m 0.0005 178 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 125.202783 m 8.0000 189 | 6/8
13 h-m-p 0.3831 8.0000 0.0000 +++ 125.202783 m 8.0000 203 | 6/8
14 h-m-p 0.0160 8.0000 0.0221 -----Y 125.202783 0 0.0000 221 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 ----C 125.202783 0 0.0000 238 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 Y 125.202783 0 0.0160 251
Out..
lnL = -125.202783
252 lfun, 252 eigenQcodon, 1512 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038244 0.021275 0.081222 0.010416 0.075245 0.099646 0.300186 0.744026 0.415333
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.429084
np = 9
lnL0 = -135.589235
Iterating by ming2
Initial: fx= 135.589235
x= 0.03824 0.02128 0.08122 0.01042 0.07524 0.09965 0.30019 0.74403 0.41533
1 h-m-p 0.0000 0.0003 76.4421 +++ 133.651885 m 0.0003 15 | 1/9
2 h-m-p 0.0002 0.0011 48.2229 ++ 131.894698 m 0.0011 27 | 2/9
3 h-m-p 0.0002 0.0012 33.2074 ++ 130.071776 m 0.0012 39 | 3/9
4 h-m-p 0.0003 0.0014 115.1002 ++ 126.304273 m 0.0014 51 | 4/9
5 h-m-p 0.0000 0.0000 1465.1474 ++ 125.871693 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0002 718.7669 ++ 125.202775 m 0.0002 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 125.202775 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.0553 -----------Y 125.202775 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0006 +++++ 125.202775 m 8.0000 131 | 6/9
10 h-m-p 0.0244 6.0136 0.1804 ----------Y 125.202775 0 0.0000 156 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 125.202775 m 8.0000 174 | 6/9
12 h-m-p 0.0068 3.3768 0.2363 -------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 125.202775 m 8.0000 218 | 6/9
14 h-m-p 0.0135 6.7520 0.1573 -------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 125.202775 m 8.0000 262 | 6/9
16 h-m-p 0.0135 6.7529 0.1573 --------Y 125.202775 0 0.0000 285 | 6/9
17 h-m-p 0.0160 8.0000 0.0072 +++++ 125.202773 m 8.0000 303 | 6/9
18 h-m-p 0.3274 6.3853 0.1758 -------------C 125.202773 0 0.0000 331 | 6/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 125.202773 m 8.0000 349 | 6/9
20 h-m-p 0.0082 4.1184 0.2055 ----------Y 125.202773 0 0.0000 374 | 6/9
21 h-m-p 0.0160 8.0000 0.0001 -----Y 125.202773 0 0.0000 394 | 6/9
22 h-m-p 0.0160 8.0000 0.0000 ---C 125.202773 0 0.0001 412
Out..
lnL = -125.202773
413 lfun, 1239 eigenQcodon, 4956 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050425 0.026542 0.047061 0.090561 0.057948 0.107552 0.221467 1.115421 0.497378 0.125378 1.327190
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.546393
np = 11
lnL0 = -136.517868
Iterating by ming2
Initial: fx= 136.517868
x= 0.05043 0.02654 0.04706 0.09056 0.05795 0.10755 0.22147 1.11542 0.49738 0.12538 1.32719
1 h-m-p 0.0000 0.0010 66.5595 ++++ 132.075474 m 0.0010 18 | 1/11
2 h-m-p 0.0007 0.0034 35.3434 ++ 128.889245 m 0.0034 32 | 2/11
3 h-m-p 0.0000 0.0000 1501.6530 ++ 128.487388 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0000 392.6450 ++ 128.452073 m 0.0000 60 | 4/11
5 h-m-p 0.0001 0.0169 7.8019 ----------.. | 4/11
6 h-m-p 0.0000 0.0002 52.0243 +++ 127.807708 m 0.0002 97 | 5/11
7 h-m-p 0.0034 0.1209 2.9282 ------------.. | 5/11
8 h-m-p 0.0000 0.0011 42.9817 ++++ 125.763384 m 0.0011 137 | 6/11
9 h-m-p 0.0194 0.2237 1.6808 -------------.. | 6/11
10 h-m-p 0.0000 0.0005 32.0913 +++ 125.202780 m 0.0005 177 | 7/11
11 h-m-p 0.9845 8.0000 0.0000 ++ 125.202780 m 8.0000 191 | 7/11
12 h-m-p 0.0838 8.0000 0.0003 -----Y 125.202780 0 0.0000 214
Out..
lnL = -125.202780
215 lfun, 860 eigenQcodon, 3870 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -125.204867 S = -125.202286 -0.000986
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 22 patterns 0:02
did 20 / 22 patterns 0:02
did 22 / 22 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037510 0.016862 0.053301 0.056907 0.098198 0.038284 0.201548 0.937009 1.476489
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.118765
np = 9
lnL0 = -134.638870
Iterating by ming2
Initial: fx= 134.638870
x= 0.03751 0.01686 0.05330 0.05691 0.09820 0.03828 0.20155 0.93701 1.47649
1 h-m-p 0.0000 0.0006 74.0464 +++ 131.574272 m 0.0006 15 | 1/9
2 h-m-p 0.0043 0.0352 8.7387 ------------.. | 1/9
3 h-m-p 0.0000 0.0007 69.1734 ++++ 128.339390 m 0.0007 51 | 2/9
4 h-m-p 0.0073 0.0565 5.6214 -------------.. | 2/9
5 h-m-p 0.0000 0.0000 63.4839 ++ 128.240641 m 0.0000 86 | 3/9
6 h-m-p 0.0003 0.0838 3.9862 ----------.. | 3/9
7 h-m-p 0.0000 0.0005 54.8901 +++ 126.793237 m 0.0005 119 | 4/9
8 h-m-p 0.0066 0.1078 3.2137 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 45.3296 ++ 126.559444 m 0.0001 153 | 5/9
10 h-m-p 0.0016 0.1599 2.3314 -----------.. | 5/9
11 h-m-p 0.0000 0.0013 31.9235 ++++ 125.202778 m 0.0013 188 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 125.202778 m 8.0000 200 | 6/9
13 h-m-p 0.0257 8.0000 0.0006 -------C 125.202778 0 0.0000 222
Out..
lnL = -125.202778
223 lfun, 2453 eigenQcodon, 13380 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070004 0.025610 0.060623 0.077485 0.026411 0.107977 0.201270 0.900000 0.639702 1.806481 1.299985
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.685902
np = 11
lnL0 = -136.151215
Iterating by ming2
Initial: fx= 136.151215
x= 0.07000 0.02561 0.06062 0.07748 0.02641 0.10798 0.20127 0.90000 0.63970 1.80648 1.29998
1 h-m-p 0.0000 0.0009 67.1968 ++++ 131.853005 m 0.0009 18 | 1/11
2 h-m-p 0.0001 0.0003 25.4148 ++ 131.723377 m 0.0003 32 | 2/11
3 h-m-p 0.0002 0.0038 26.1010 ++ 127.537946 m 0.0038 46 | 3/11
4 h-m-p 0.0041 0.0205 14.0967 ++ 126.204850 m 0.0205 60 | 4/11
5 h-m-p 0.0000 0.0000 5409.4287 ++ 125.765819 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 429.1488 ++ 125.762985 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0045 205.3260 --------.. | 6/11
8 h-m-p 0.0000 0.0006 31.6676 +++ 125.202778 m 0.0006 123 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 125.202778 m 8.0000 137 | 7/11
10 h-m-p 0.0160 8.0000 0.0399 +++++ 125.202775 m 8.0000 158 | 7/11
11 h-m-p 0.0188 0.0942 1.7787 ++ 125.202774 m 0.0942 176 | 8/11
12 h-m-p 0.2511 1.3828 0.6193 ++ 125.202749 m 1.3828 190 | 9/11
13 h-m-p 1.6000 8.0000 0.0015 ++ 125.202749 m 8.0000 207 | 9/11
14 h-m-p 0.0160 8.0000 1.4900 -----N 125.202749 0 0.0000 228 | 9/11
15 h-m-p 0.9411 8.0000 0.0000 Y 125.202749 0 0.9411 242 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 -N 125.202749 0 0.0500 259
Out..
lnL = -125.202749
260 lfun, 3120 eigenQcodon, 17160 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -125.215737 S = -125.202950 -0.005614
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 22 patterns 0:10
did 20 / 22 patterns 0:10
did 22 / 22 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=33
NC_011896_1_WP_003402602_1_2596_MLBR_RS12360 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
NC_002677_1_NP_302573_1_1445_ML2428A GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
*********************************
>NC_011896_1_WP_003402602_1_2596_MLBR_RS12360 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA >NC_002677_1_NP_302573_1_1445_ML2428A GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA >NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA >NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA >NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA >NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690 GGGTTCAGTAATCAAAAAACGGCGCAAGCGTATGTCCAAGAAAAAGCATC GCAAGTTGCTGCGCCGCACCCGGGTGCAGCGCAGAAAACTTGGCAAGTA
>NC_011896_1_WP_003402602_1_2596_MLBR_RS12360 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV >NC_002677_1_NP_302573_1_1445_ML2428A GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV >NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV >NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV >NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV >NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690 GFSNQKTAQAYVQEKASQVAAPHPGAAQKTWQV
#NEXUS
[ID: 5982560740]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_003402602_1_2596_MLBR_RS12360
NC_002677_1_NP_302573_1_1445_ML2428A
NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855
NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555
NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365
NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690
;
end;
begin trees;
translate
1 NC_011896_1_WP_003402602_1_2596_MLBR_RS12360,
2 NC_002677_1_NP_302573_1_1445_ML2428A,
3 NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855,
4 NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555,
5 NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365,
6 NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06494676,2:0.0683823,3:0.06698015,4:0.06962094,5:0.07009602,6:0.06889261);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06494676,2:0.0683823,3:0.06698015,4:0.06962094,5:0.07009602,6:0.06889261);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -135.55 -143.43
2 -135.58 -139.85
--------------------------------------
TOTAL -135.56 -142.76
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2428A/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.892291 0.090372 0.378814 1.517238 0.861251 1363.36 1415.26 1.000
r(A<->C){all} 0.169384 0.019246 0.000065 0.439712 0.136756 247.32 258.60 1.005
r(A<->G){all} 0.165264 0.018731 0.000172 0.436430 0.131361 264.88 279.14 1.008
r(A<->T){all} 0.171391 0.019880 0.000058 0.451779 0.134850 167.78 169.24 1.002
r(C<->G){all} 0.158052 0.019419 0.000034 0.435484 0.115805 163.68 262.88 1.001
r(C<->T){all} 0.171656 0.022464 0.000030 0.481276 0.131444 133.23 156.60 1.006
r(G<->T){all} 0.164252 0.019284 0.000053 0.438871 0.128499 268.47 290.91 1.000
pi(A){all} 0.319793 0.002090 0.231743 0.409893 0.317760 1313.47 1321.49 1.000
pi(C){all} 0.242472 0.001729 0.161970 0.321794 0.240618 967.81 1097.91 1.000
pi(G){all} 0.280605 0.001918 0.196452 0.365995 0.279664 1143.78 1176.27 1.000
pi(T){all} 0.157130 0.001222 0.090783 0.224252 0.155541 1200.26 1300.58 1.000
alpha{1,2} 0.403241 0.217820 0.000104 1.353412 0.236805 1439.20 1454.50 1.000
alpha{3} 0.465495 0.271934 0.000179 1.480327 0.293446 1321.21 1374.46 1.000
pinvar{all} 0.980683 0.000592 0.934655 0.999996 0.988726 1036.23 1250.67 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2428A/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 33
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 5 5 5 5 5 5 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 0 0 0 0 0 0 | ACC 0 0 0 0 0 0 | AAC 0 0 0 0 0 0 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 0 0 0 0 0 0 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 0 0 0 0 0 0 | GAC 0 0 0 0 0 0 | GGC 0 0 0 0 0 0
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 0 0 0 0 0 0 | GCG 4 4 4 4 4 4 | GAG 0 0 0 0 0 0 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_003402602_1_2596_MLBR_RS12360
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
#2: NC_002677_1_NP_302573_1_1445_ML2428A
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
#3: NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
#4: NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
#5: NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
#6: NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 0 | CAC 6 | CGC 0
CTA 0 | CCA 0 | Gln Q CAA 30 | CGA 0
CTG 0 | CCG 12 | CAG 6 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 0 | ACC 0 | AAC 0 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 0 | ACG 6 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 0 | Gly G GGT 6
GTC 6 | GCC 0 | GAC 0 | GGC 0
GTA 6 | GCA 12 | Glu E GAA 6 | GGA 0
GTG 0 | GCG 24 | GAG 0 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12121 C:0.27273 A:0.21212 G:0.39394
position 2: T:0.12121 C:0.36364 A:0.39394 G:0.12121
position 3: T:0.21212 C:0.09091 A:0.36364 G:0.33333
Average T:0.15152 C:0.24242 A:0.32323 G:0.28283
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -125.202783 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300186 1.299985
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003402602_1_2596_MLBR_RS12360: 0.000004, NC_002677_1_NP_302573_1_1445_ML2428A: 0.000004, NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855: 0.000004, NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555: 0.000004, NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365: 0.000004, NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30019
omega (dN/dS) = 1.29998
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 79.2 19.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 79.2 19.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 79.2 19.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 79.2 19.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 79.2 19.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 79.2 19.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -125.202773 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.221467 0.834715 0.020354
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003402602_1_2596_MLBR_RS12360: 0.000004, NC_002677_1_NP_302573_1_1445_ML2428A: 0.000004, NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855: 0.000004, NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555: 0.000004, NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365: 0.000004, NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.22147
MLEs of dN/dS (w) for site classes (K=2)
p: 0.83471 0.16529
w: 0.02035 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 80.0 19.0 0.1823 0.0000 0.0000 0.0 0.0
7..2 0.000 80.0 19.0 0.1823 0.0000 0.0000 0.0 0.0
7..3 0.000 80.0 19.0 0.1823 0.0000 0.0000 0.0 0.0
7..4 0.000 80.0 19.0 0.1823 0.0000 0.0000 0.0 0.0
7..5 0.000 80.0 19.0 0.1823 0.0000 0.0000 0.0 0.0
7..6 0.000 80.0 19.0 0.1823 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -125.202780 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.201548 0.541665 0.283651 0.000001 1.344983
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003402602_1_2596_MLBR_RS12360: 0.000004, NC_002677_1_NP_302573_1_1445_ML2428A: 0.000004, NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855: 0.000004, NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555: 0.000004, NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365: 0.000004, NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.20155
MLEs of dN/dS (w) for site classes (K=3)
p: 0.54166 0.28365 0.17468
w: 0.00000 1.00000 1.34498
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 80.2 18.8 0.5186 0.0000 0.0000 0.0 0.0
7..2 0.000 80.2 18.8 0.5186 0.0000 0.0000 0.0 0.0
7..3 0.000 80.2 18.8 0.5186 0.0000 0.0000 0.0 0.0
7..4 0.000 80.2 18.8 0.5186 0.0000 0.0000 0.0 0.0
7..5 0.000 80.2 18.8 0.5186 0.0000 0.0000 0.0 0.0
7..6 0.000 80.2 18.8 0.5186 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_003402602_1_2596_MLBR_RS12360)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_003402602_1_2596_MLBR_RS12360)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -125.202778 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.201270 0.936670 1.476567
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003402602_1_2596_MLBR_RS12360: 0.000004, NC_002677_1_NP_302573_1_1445_ML2428A: 0.000004, NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855: 0.000004, NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555: 0.000004, NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365: 0.000004, NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.20127
Parameters in M7 (beta):
p = 0.93667 q = 1.47657
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02763 0.09072 0.15938 0.23299 0.31181 0.39666 0.48899 0.59149 0.70978 0.86145
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 80.2 18.8 0.3871 0.0000 0.0000 0.0 0.0
7..2 0.000 80.2 18.8 0.3871 0.0000 0.0000 0.0 0.0
7..3 0.000 80.2 18.8 0.3871 0.0000 0.0000 0.0 0.0
7..4 0.000 80.2 18.8 0.3871 0.0000 0.0000 0.0 0.0
7..5 0.000 80.2 18.8 0.3871 0.0000 0.0000 0.0 0.0
7..6 0.000 80.2 18.8 0.3871 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -125.202749 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.926567 1.784687
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003402602_1_2596_MLBR_RS12360: 0.000004, NC_002677_1_NP_302573_1_1445_ML2428A: 0.000004, NZ_LVXE01000055_1_WP_003402602_1_2199_A3216_RS11855: 0.000004, NZ_LYPH01000045_1_WP_003402602_1_1793_A8144_RS08555: 0.000004, NZ_CP029543_1_WP_003402602_1_2624_DIJ64_RS13365: 0.000004, NZ_AP014567_1_WP_003402602_1_2689_JK2ML_RS13690: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.92657
(p1 = 0.00001) w = 1.78469
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.78469
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 82.6 16.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 82.6 16.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 82.6 16.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 82.6 16.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 82.6 16.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 82.6 16.4 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_003402602_1_2596_MLBR_RS12360)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:11
Model 1: NearlyNeutral -125.202773 Model 2: PositiveSelection -125.20278 Model 0: one-ratio -125.202783 Model 7: beta -125.202778 Model 8: beta&w>1 -125.202749 Model 0 vs 1 2.0000000006348273E-5 Model 2 vs 1 1.4000000021496817E-5 Model 8 vs 7 5.7999999995672624E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
