--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:06:59 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2429/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -349.53 -357.57
2 -349.55 -353.14
--------------------------------------
TOTAL -349.54 -356.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889789 0.084807 0.369089 1.472786 0.860998 1385.38 1443.19 1.000
r(A<->C){all} 0.176422 0.022148 0.000028 0.482368 0.137212 164.43 173.08 1.000
r(A<->G){all} 0.160276 0.017413 0.000162 0.423079 0.130129 257.67 300.12 1.001
r(A<->T){all} 0.165101 0.020326 0.000094 0.459835 0.126560 217.31 227.83 1.000
r(C<->G){all} 0.164428 0.019750 0.000075 0.449905 0.126274 114.23 125.32 1.005
r(C<->T){all} 0.161963 0.020103 0.000019 0.452781 0.122173 193.61 251.64 1.000
r(G<->T){all} 0.171811 0.022120 0.000012 0.480610 0.129188 168.94 221.01 1.004
pi(A){all} 0.175057 0.000549 0.131728 0.220517 0.174434 1226.26 1268.63 1.001
pi(C){all} 0.285762 0.000760 0.231735 0.338161 0.285311 1207.58 1354.29 1.000
pi(G){all} 0.343613 0.000847 0.286750 0.397054 0.343664 1310.45 1363.05 1.000
pi(T){all} 0.195567 0.000602 0.148434 0.244021 0.195243 1121.34 1220.06 1.000
alpha{1,2} 0.402013 0.223734 0.000148 1.335368 0.229205 907.32 1043.80 1.000
alpha{3} 0.452983 0.236223 0.000105 1.456611 0.285460 1077.41 1265.70 1.000
pinvar{all} 0.992996 0.000073 0.975734 0.999991 0.995888 922.01 1125.71 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -332.04929
Model 2: PositiveSelection -332.049287
Model 0: one-ratio -332.049295
Model 7: beta -332.049294
Model 8: beta&w>1 -332.049278
Model 0 vs 1 9.999999974752427E-6
Model 2 vs 1 5.999999984851456E-6
Model 8 vs 7 3.199999991920777E-5
>C1
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C2
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C3
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C4
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C5
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C6
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=86
C1 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C2 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C3 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C4 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C5 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C6 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
**************************************************
C1 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C2 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C3 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C4 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C5 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C6 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 86 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 86 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2580]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2580]--->[2580]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.608 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C2 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C3 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C4 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C5 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
C6 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
**************************************************
C1 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C2 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C3 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C4 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C5 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
C6 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
C2 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
C3 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
C4 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
C5 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
C6 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
**************************************************
C1 GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
C2 GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
C3 GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
C4 GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
C5 GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
C6 GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
**************************************************
C1 CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
C2 CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
C3 CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
C4 CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
C5 CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
C6 CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
**************************************************
C1 CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
C2 CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
C3 CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
C4 CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
C5 CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
C6 CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
**************************************************
C1 CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
C2 CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
C3 CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
C4 CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
C5 CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
C6 CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
**************************************************
C1 ACGTGGGC
C2 ACGTGGGC
C3 ACGTGGGC
C4 ACGTGGGC
C5 ACGTGGGC
C6 ACGTGGGC
********
>C1
ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
ACGTGGGC
>C2
ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
ACGTGGGC
>C3
ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
ACGTGGGC
>C4
ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
ACGTGGGC
>C5
ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
ACGTGGGC
>C6
ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT
GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA
CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC
CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT
CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG
ACGTGGGC
>C1
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C2
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C3
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C4
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C5
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
>C6
MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 258 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856737
Setting output file names to "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1173417201
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5778268416
Seed = 252804593
Swapseed = 1579856737
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -577.416368 -- -24.965149
Chain 2 -- -577.416334 -- -24.965149
Chain 3 -- -577.416334 -- -24.965149
Chain 4 -- -577.416368 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -577.416368 -- -24.965149
Chain 2 -- -577.416334 -- -24.965149
Chain 3 -- -577.416334 -- -24.965149
Chain 4 -- -577.416280 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-577.416] (-577.416) (-577.416) (-577.416) * [-577.416] (-577.416) (-577.416) (-577.416)
500 -- (-370.578) (-362.560) (-359.716) [-366.093] * (-372.054) (-363.691) (-354.657) [-361.914] -- 0:33:19
1000 -- (-358.871) (-358.209) (-358.354) [-353.614] * (-351.280) (-357.773) [-362.350] (-364.291) -- 0:16:39
1500 -- (-355.191) (-360.541) [-363.578] (-352.989) * (-363.606) (-357.050) (-367.277) [-355.872] -- 0:11:05
2000 -- (-354.573) (-363.398) [-356.819] (-357.359) * (-361.093) (-361.682) (-354.816) [-355.797] -- 0:08:19
2500 -- (-359.868) (-364.626) (-359.903) [-352.996] * [-361.188] (-358.360) (-366.053) (-355.584) -- 0:06:39
3000 -- (-363.943) [-357.185] (-359.143) (-363.223) * [-354.674] (-363.868) (-357.765) (-369.167) -- 0:05:32
3500 -- (-353.571) (-367.818) [-358.586] (-354.610) * (-361.029) (-358.558) [-355.901] (-361.271) -- 0:04:44
4000 -- (-365.323) [-363.270] (-358.561) (-370.345) * (-358.701) (-361.246) (-360.828) [-356.038] -- 0:04:09
4500 -- [-355.843] (-357.453) (-359.159) (-367.454) * (-360.553) (-362.541) [-361.053] (-363.965) -- 0:03:41
5000 -- (-360.606) (-362.228) [-359.357] (-360.904) * (-359.672) [-355.389] (-358.176) (-357.631) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-362.264) (-353.788) (-357.656) [-353.787] * (-362.134) (-363.876) (-363.183) [-357.984] -- 0:03:00
6000 -- [-355.816] (-359.052) (-354.149) (-362.634) * (-359.363) (-356.529) [-360.140] (-359.929) -- 0:02:45
6500 -- (-362.615) [-361.474] (-359.318) (-353.606) * (-356.174) (-361.304) [-364.620] (-361.442) -- 0:02:32
7000 -- (-360.462) [-360.442] (-359.481) (-353.673) * (-358.958) [-360.598] (-355.279) (-361.156) -- 0:02:21
7500 -- (-360.448) (-365.164) [-356.267] (-361.911) * (-360.923) (-363.022) [-355.903] (-364.115) -- 0:02:12
8000 -- (-355.189) (-363.053) (-361.421) [-358.659] * (-355.395) [-359.146] (-367.492) (-365.234) -- 0:02:04
8500 -- (-360.513) (-357.546) (-355.664) [-359.335] * (-358.267) (-364.095) [-355.366] (-363.054) -- 0:01:56
9000 -- (-356.129) (-361.957) (-352.818) [-360.917] * (-362.972) (-350.553) [-361.693] (-364.340) -- 0:01:50
9500 -- (-356.647) [-360.487] (-361.487) (-357.415) * (-355.289) (-351.066) (-354.731) [-350.264] -- 0:01:44
10000 -- (-360.828) (-359.472) [-357.896] (-359.325) * [-358.804] (-352.184) (-363.083) (-353.174) -- 0:01:39
Average standard deviation of split frequencies: 0.069448
10500 -- (-370.917) [-356.899] (-355.949) (-362.605) * (-357.926) (-350.851) [-358.961] (-349.124) -- 0:01:34
11000 -- [-358.921] (-362.087) (-356.611) (-353.116) * (-358.723) (-352.063) [-360.418] (-354.100) -- 0:01:29
11500 -- (-358.337) (-365.117) (-354.200) [-357.394] * (-359.824) (-348.571) (-359.919) [-351.845] -- 0:01:25
12000 -- (-349.558) [-358.289] (-361.282) (-361.768) * (-363.875) [-348.108] (-354.980) (-350.077) -- 0:01:22
12500 -- [-352.147] (-369.848) (-357.577) (-361.058) * (-356.520) (-350.378) (-356.584) [-350.598] -- 0:01:19
13000 -- (-348.058) (-358.729) [-359.731] (-362.264) * (-355.144) (-351.129) [-352.406] (-348.633) -- 0:01:15
13500 -- (-349.475) [-354.947] (-359.086) (-372.552) * (-362.775) (-349.719) [-356.037] (-349.204) -- 0:01:13
14000 -- (-349.126) [-358.826] (-369.907) (-371.763) * (-357.927) (-350.071) (-363.464) [-349.225] -- 0:01:10
14500 -- (-353.212) [-356.367] (-358.496) (-361.114) * (-364.099) [-351.107] (-363.978) (-348.909) -- 0:01:07
15000 -- (-352.523) (-363.824) [-353.917] (-351.703) * (-359.317) (-352.233) [-358.034] (-351.492) -- 0:01:05
Average standard deviation of split frequencies: 0.068230
15500 -- (-350.467) (-359.564) [-357.719] (-348.350) * [-358.805] (-348.055) (-373.272) (-351.619) -- 0:01:03
16000 -- (-353.811) [-354.080] (-362.442) (-348.296) * (-362.965) [-348.643] (-358.033) (-350.907) -- 0:01:01
16500 -- (-349.848) (-370.071) (-360.096) [-353.911] * [-362.341] (-348.813) (-364.839) (-350.208) -- 0:00:59
17000 -- (-352.624) (-356.789) (-363.975) [-352.775] * (-360.046) (-350.670) (-359.213) [-349.557] -- 0:00:57
17500 -- (-349.510) (-370.960) [-360.337] (-352.144) * (-355.451) (-353.996) (-363.065) [-352.056] -- 0:01:52
18000 -- (-349.471) [-355.737] (-364.010) (-349.459) * (-356.961) (-352.234) [-361.832] (-351.518) -- 0:01:49
18500 -- [-349.780] (-364.594) (-359.293) (-349.465) * (-356.079) (-349.789) [-362.995] (-348.670) -- 0:01:46
19000 -- (-353.416) [-358.032] (-356.335) (-350.001) * (-354.265) (-348.718) (-360.841) [-350.678] -- 0:01:43
19500 -- (-351.506) [-361.138] (-359.776) (-348.760) * (-356.948) [-349.366] (-359.092) (-351.105) -- 0:01:40
20000 -- (-351.914) (-357.351) [-359.826] (-348.589) * (-367.060) (-350.293) (-351.629) [-351.377] -- 0:01:38
Average standard deviation of split frequencies: 0.059559
20500 -- (-349.689) (-363.822) [-368.929] (-352.325) * [-360.514] (-351.452) (-351.229) (-352.927) -- 0:01:35
21000 -- (-350.270) (-359.906) [-355.017] (-353.364) * (-367.508) [-351.629] (-354.075) (-353.133) -- 0:01:33
21500 -- (-348.325) (-359.916) [-355.371] (-359.644) * [-361.491] (-351.288) (-348.424) (-348.312) -- 0:01:31
22000 -- (-349.722) [-357.870] (-369.329) (-355.690) * (-366.185) (-352.143) [-349.406] (-351.114) -- 0:01:28
22500 -- (-349.683) [-361.955] (-364.772) (-351.219) * (-365.054) (-349.496) (-352.317) [-348.772] -- 0:01:26
23000 -- (-349.676) (-361.764) (-359.121) [-351.361] * (-365.554) (-350.277) (-350.595) [-349.643] -- 0:01:24
23500 -- [-351.177] (-358.812) (-372.327) (-351.051) * (-357.587) (-351.540) [-350.564] (-348.067) -- 0:01:23
24000 -- (-352.590) (-366.196) (-357.384) [-353.224] * (-354.508) [-354.576] (-350.025) (-354.848) -- 0:01:21
24500 -- (-350.758) (-360.687) (-354.246) [-351.532] * [-349.092] (-358.158) (-350.613) (-350.643) -- 0:01:19
25000 -- (-351.963) [-357.599] (-366.976) (-352.427) * [-349.426] (-350.850) (-348.511) (-350.100) -- 0:01:18
Average standard deviation of split frequencies: 0.033361
25500 -- [-349.197] (-362.466) (-359.245) (-350.347) * (-351.142) (-353.037) [-354.545] (-351.781) -- 0:01:16
26000 -- (-349.179) (-356.576) [-355.437] (-349.386) * (-351.284) (-354.423) (-350.797) [-348.478] -- 0:01:14
26500 -- (-349.933) (-357.987) (-367.289) [-348.249] * (-352.593) [-350.947] (-348.738) (-349.037) -- 0:01:13
27000 -- (-349.013) (-356.355) [-361.315] (-348.192) * (-361.343) (-350.672) (-348.315) [-348.512] -- 0:01:12
27500 -- [-349.425] (-360.089) (-367.256) (-348.234) * (-349.244) [-353.963] (-349.343) (-351.604) -- 0:01:10
28000 -- (-350.910) (-372.297) (-365.482) [-350.033] * [-353.444] (-351.651) (-350.933) (-350.891) -- 0:01:09
28500 -- (-350.526) (-359.191) [-361.417] (-348.573) * [-351.901] (-348.186) (-348.471) (-350.109) -- 0:01:08
29000 -- (-349.102) (-356.612) [-358.831] (-352.460) * (-350.692) [-348.203] (-348.360) (-350.004) -- 0:01:06
29500 -- (-351.252) (-372.716) (-362.304) [-354.157] * (-352.062) (-349.714) [-349.714] (-350.299) -- 0:01:05
30000 -- [-349.197] (-364.555) (-359.420) (-348.881) * (-357.236) (-353.330) (-355.313) [-350.986] -- 0:01:04
Average standard deviation of split frequencies: 0.031384
30500 -- (-354.375) [-357.869] (-358.234) (-349.081) * (-351.035) (-351.213) [-349.275] (-351.504) -- 0:01:03
31000 -- [-351.618] (-375.642) (-355.665) (-348.705) * [-349.294] (-349.657) (-350.127) (-350.491) -- 0:01:02
31500 -- (-350.532) (-352.606) [-357.375] (-350.869) * (-349.789) (-348.756) [-351.094] (-349.743) -- 0:01:01
32000 -- (-349.887) (-367.782) (-360.736) [-350.803] * (-350.189) (-349.625) (-350.042) [-350.290] -- 0:01:00
32500 -- [-352.277] (-370.262) (-369.108) (-352.892) * [-348.748] (-349.479) (-350.881) (-348.307) -- 0:00:59
33000 -- (-352.791) (-366.892) [-360.541] (-353.760) * [-349.050] (-353.833) (-351.395) (-349.773) -- 0:00:58
33500 -- (-354.949) (-360.916) (-358.052) [-350.433] * (-349.389) (-348.928) [-351.509] (-351.033) -- 0:00:57
34000 -- (-350.420) (-355.842) (-358.336) [-349.078] * (-351.638) [-349.879] (-349.584) (-351.338) -- 0:00:56
34500 -- (-351.054) (-350.402) [-355.145] (-351.387) * (-358.949) (-350.203) [-348.808] (-360.564) -- 0:01:23
35000 -- (-348.716) [-348.200] (-357.439) (-351.550) * (-357.378) (-349.680) (-351.402) [-358.061] -- 0:01:22
Average standard deviation of split frequencies: 0.027380
35500 -- (-353.454) (-350.398) (-356.738) [-353.641] * [-351.863] (-348.783) (-351.362) (-351.179) -- 0:01:21
36000 -- (-352.546) [-349.436] (-353.229) (-350.766) * [-353.625] (-349.983) (-350.061) (-349.176) -- 0:01:20
36500 -- (-353.166) (-349.653) (-357.994) [-349.735] * [-348.408] (-352.862) (-353.432) (-348.905) -- 0:01:19
37000 -- (-349.560) (-352.096) [-365.047] (-350.910) * (-349.763) [-349.165] (-349.488) (-351.654) -- 0:01:18
37500 -- (-350.046) (-351.293) [-358.677] (-350.844) * (-351.756) (-350.269) (-351.067) [-351.152] -- 0:01:17
38000 -- (-350.034) (-352.299) [-371.460] (-348.442) * (-359.149) (-352.434) (-349.632) [-348.586] -- 0:01:15
38500 -- (-351.392) (-351.865) (-364.155) [-350.108] * (-352.009) (-350.789) (-348.438) [-349.155] -- 0:01:14
39000 -- (-350.424) (-349.747) (-354.476) [-348.400] * (-349.574) (-350.243) [-349.894] (-349.526) -- 0:01:13
39500 -- [-348.405] (-350.716) (-357.689) (-349.376) * (-349.504) [-349.240] (-351.195) (-349.062) -- 0:01:12
40000 -- [-350.019] (-348.798) (-360.003) (-349.464) * (-351.112) (-352.999) (-351.887) [-349.429] -- 0:01:12
Average standard deviation of split frequencies: 0.032945
40500 -- (-351.322) [-350.541] (-366.234) (-350.490) * (-350.447) (-351.437) (-350.234) [-350.056] -- 0:01:11
41000 -- (-350.125) (-351.767) [-356.597] (-348.169) * (-351.968) (-348.707) [-352.015] (-349.739) -- 0:01:10
41500 -- (-349.472) (-349.218) (-362.160) [-349.235] * (-350.714) [-351.067] (-350.139) (-349.055) -- 0:01:09
42000 -- [-352.862] (-358.189) (-356.873) (-351.336) * (-352.536) [-352.207] (-348.738) (-352.780) -- 0:01:08
42500 -- [-354.126] (-349.009) (-363.766) (-352.290) * (-353.246) (-352.443) [-348.878] (-351.246) -- 0:01:07
43000 -- (-350.134) (-349.528) (-361.151) [-355.515] * (-352.198) (-351.215) [-352.066] (-351.119) -- 0:01:06
43500 -- (-348.460) (-354.883) [-361.813] (-349.893) * (-349.973) (-350.923) (-350.388) [-348.944] -- 0:01:05
44000 -- (-349.674) [-349.511] (-368.918) (-352.397) * (-349.098) [-350.703] (-349.702) (-349.237) -- 0:01:05
44500 -- (-349.752) [-348.418] (-361.254) (-351.408) * (-349.695) [-349.063] (-349.869) (-350.755) -- 0:01:04
45000 -- [-350.306] (-348.550) (-362.163) (-350.215) * (-348.705) (-353.055) [-351.975] (-352.079) -- 0:01:03
Average standard deviation of split frequencies: 0.034648
45500 -- [-352.452] (-349.215) (-361.245) (-350.106) * (-351.966) [-349.981] (-349.178) (-350.115) -- 0:01:02
46000 -- (-353.165) [-350.880] (-363.566) (-349.395) * (-349.155) (-350.171) [-348.774] (-350.448) -- 0:01:02
46500 -- (-350.144) (-350.456) [-359.346] (-350.755) * (-349.526) (-351.132) (-349.391) [-351.352] -- 0:01:01
47000 -- (-348.593) (-348.170) [-361.585] (-349.831) * (-350.473) (-355.193) (-348.322) [-351.226] -- 0:01:00
47500 -- (-353.371) (-351.386) [-356.600] (-352.676) * (-349.917) (-349.382) [-349.431] (-351.985) -- 0:01:00
48000 -- (-356.106) (-353.273) (-368.350) [-349.262] * [-351.743] (-349.118) (-351.152) (-349.622) -- 0:00:59
48500 -- [-353.192] (-351.549) (-358.537) (-349.931) * (-348.325) (-350.026) [-349.215] (-352.716) -- 0:00:58
49000 -- (-352.021) (-353.645) [-355.746] (-350.874) * (-348.620) [-349.092] (-350.116) (-352.912) -- 0:00:58
49500 -- (-351.566) [-350.691] (-358.776) (-352.308) * (-348.688) (-349.487) (-355.419) [-349.757] -- 0:00:57
50000 -- (-349.607) (-350.411) [-358.271] (-352.696) * (-349.162) (-350.041) [-352.670] (-350.122) -- 0:00:57
Average standard deviation of split frequencies: 0.027912
50500 -- (-350.104) (-353.974) (-362.546) [-351.940] * (-348.279) (-351.267) (-350.508) [-349.637] -- 0:00:56
51000 -- (-352.702) (-351.498) [-360.094] (-352.649) * (-349.916) (-351.748) [-351.712] (-349.665) -- 0:00:55
51500 -- (-349.546) (-350.294) (-364.851) [-349.703] * (-348.529) [-349.940] (-352.722) (-350.303) -- 0:00:55
52000 -- [-352.571] (-349.257) (-373.385) (-350.692) * [-350.235] (-350.910) (-353.988) (-349.625) -- 0:01:12
52500 -- (-351.656) [-349.217] (-359.581) (-351.343) * (-349.357) (-352.818) (-352.765) [-349.890] -- 0:01:12
53000 -- (-350.740) (-348.086) [-359.457] (-348.392) * [-350.552] (-354.192) (-352.688) (-351.600) -- 0:01:11
53500 -- [-354.338] (-348.855) (-365.622) (-350.358) * [-348.494] (-356.995) (-352.379) (-355.889) -- 0:01:10
54000 -- (-350.835) (-352.008) [-354.689] (-350.009) * (-348.945) (-349.390) (-349.276) [-350.748] -- 0:01:10
54500 -- [-352.271] (-350.123) (-356.556) (-354.707) * [-347.981] (-350.874) (-349.793) (-348.449) -- 0:01:09
55000 -- (-356.415) (-351.736) [-363.228] (-348.790) * (-349.362) (-349.561) (-354.571) [-349.455] -- 0:01:08
Average standard deviation of split frequencies: 0.031013
55500 -- [-351.170] (-351.061) (-362.627) (-348.773) * [-349.571] (-349.018) (-351.295) (-348.833) -- 0:01:08
56000 -- (-351.808) (-354.475) (-369.234) [-352.401] * (-351.102) [-348.597] (-352.308) (-351.449) -- 0:01:07
56500 -- (-348.943) (-357.565) [-356.590] (-354.346) * (-349.719) [-350.991] (-353.803) (-348.729) -- 0:01:06
57000 -- (-348.649) (-354.996) (-353.786) [-353.671] * (-351.372) (-350.973) [-350.304] (-351.342) -- 0:01:06
57500 -- (-351.713) [-349.772] (-365.467) (-350.335) * (-349.984) (-350.272) (-350.336) [-350.424] -- 0:01:05
58000 -- (-351.509) (-350.809) (-364.333) [-348.978] * (-353.371) [-348.645] (-350.936) (-349.624) -- 0:01:04
58500 -- (-352.237) [-349.318] (-361.627) (-351.207) * (-352.665) (-355.772) (-350.439) [-351.952] -- 0:01:04
59000 -- [-348.971] (-350.176) (-356.463) (-351.804) * (-352.232) (-352.858) (-351.731) [-348.555] -- 0:01:03
59500 -- (-352.104) (-350.925) [-361.043] (-348.629) * (-354.860) [-348.561] (-349.863) (-348.685) -- 0:01:03
60000 -- (-349.630) (-350.438) (-363.460) [-349.800] * (-351.178) [-356.166] (-349.313) (-353.395) -- 0:01:02
Average standard deviation of split frequencies: 0.026968
60500 -- (-349.332) [-349.004] (-365.943) (-349.473) * (-349.052) (-354.904) (-352.137) [-351.024] -- 0:01:02
61000 -- (-352.418) [-348.312] (-355.286) (-348.883) * (-351.667) [-354.041] (-351.886) (-351.006) -- 0:01:01
61500 -- (-349.357) [-349.444] (-366.666) (-348.468) * [-349.736] (-349.520) (-349.503) (-350.570) -- 0:01:01
62000 -- (-350.577) (-348.101) (-360.656) [-348.510] * (-348.329) (-348.787) [-350.404] (-350.479) -- 0:01:00
62500 -- [-351.916] (-351.852) (-358.583) (-348.268) * [-349.187] (-349.833) (-349.927) (-350.725) -- 0:01:00
63000 -- [-349.261] (-353.702) (-360.442) (-351.852) * [-351.792] (-350.923) (-350.826) (-350.511) -- 0:00:59
63500 -- (-348.726) (-350.848) [-357.627] (-348.774) * (-349.851) (-349.793) (-353.867) [-350.061] -- 0:00:58
64000 -- (-350.432) (-351.358) [-357.271] (-349.043) * (-351.086) (-350.007) [-354.438] (-348.897) -- 0:00:58
64500 -- [-352.106] (-349.544) (-362.991) (-351.794) * (-350.664) (-350.605) (-352.051) [-348.582] -- 0:00:58
65000 -- (-349.681) [-352.083] (-362.015) (-352.389) * [-348.386] (-352.249) (-350.776) (-348.518) -- 0:00:57
Average standard deviation of split frequencies: 0.022142
65500 -- [-348.930] (-348.358) (-369.240) (-349.348) * (-350.038) (-354.307) (-353.215) [-349.683] -- 0:00:57
66000 -- [-352.119] (-351.517) (-367.392) (-350.325) * (-349.053) (-348.506) (-350.022) [-350.709] -- 0:00:56
66500 -- (-350.398) [-349.677] (-366.389) (-348.802) * [-348.896] (-352.382) (-349.923) (-349.702) -- 0:00:56
67000 -- (-349.828) (-354.643) (-362.773) [-351.758] * (-351.617) (-351.976) [-351.166] (-350.513) -- 0:00:55
67500 -- [-352.259] (-354.609) (-360.812) (-351.778) * (-349.369) (-353.876) (-349.266) [-353.730] -- 0:00:55
68000 -- (-350.578) (-350.023) [-360.993] (-351.220) * [-350.117] (-351.383) (-350.228) (-352.346) -- 0:00:54
68500 -- (-350.229) (-350.137) (-371.379) [-348.927] * (-349.280) (-350.926) [-349.966] (-352.399) -- 0:00:54
69000 -- (-351.757) [-349.346] (-369.782) (-348.963) * (-350.919) (-354.119) [-350.567] (-353.762) -- 0:01:07
69500 -- (-349.800) (-353.217) (-363.425) [-351.830] * (-350.075) [-351.020] (-348.922) (-351.969) -- 0:01:06
70000 -- [-349.574] (-350.622) (-361.535) (-353.959) * (-349.408) [-351.518] (-350.389) (-350.528) -- 0:01:06
Average standard deviation of split frequencies: 0.018107
70500 -- (-350.280) [-352.439] (-354.120) (-352.155) * (-349.394) [-348.193] (-350.974) (-349.018) -- 0:01:05
71000 -- (-348.600) (-349.509) [-351.069] (-352.651) * [-348.771] (-350.357) (-350.591) (-350.044) -- 0:01:05
71500 -- (-349.061) (-351.839) (-351.097) [-348.610] * (-351.164) [-349.472] (-350.631) (-349.316) -- 0:01:04
72000 -- (-348.741) (-350.973) (-351.007) [-349.914] * (-349.234) [-350.592] (-349.637) (-348.544) -- 0:01:04
72500 -- (-349.001) [-352.898] (-352.501) (-350.033) * (-349.362) [-350.421] (-350.624) (-351.022) -- 0:01:03
73000 -- (-351.320) (-357.378) [-349.491] (-349.543) * (-348.664) (-355.069) (-353.237) [-348.757] -- 0:01:03
73500 -- (-352.052) [-349.324] (-355.240) (-349.905) * (-348.629) [-351.714] (-351.378) (-355.474) -- 0:01:03
74000 -- (-350.153) [-351.123] (-352.491) (-351.041) * [-350.321] (-353.296) (-348.464) (-350.645) -- 0:01:02
74500 -- (-351.114) (-348.242) [-350.084] (-352.515) * [-354.669] (-348.867) (-350.025) (-351.082) -- 0:01:02
75000 -- (-350.472) [-351.833] (-349.218) (-357.259) * (-349.132) [-350.392] (-348.583) (-349.990) -- 0:01:01
Average standard deviation of split frequencies: 0.016541
75500 -- [-348.594] (-349.502) (-348.937) (-351.090) * (-351.662) (-350.941) [-348.781] (-351.283) -- 0:01:01
76000 -- (-349.941) [-351.487] (-348.804) (-349.327) * (-349.902) (-353.181) [-348.173] (-352.447) -- 0:01:00
76500 -- (-351.287) (-348.897) [-351.017] (-349.655) * (-349.558) [-352.230] (-349.839) (-353.704) -- 0:01:00
77000 -- (-353.129) (-350.500) [-349.930] (-349.790) * [-352.482] (-354.870) (-348.678) (-352.811) -- 0:00:59
77500 -- (-351.030) [-350.806] (-352.272) (-350.261) * (-348.963) (-349.146) (-348.757) [-350.675] -- 0:00:59
78000 -- (-349.975) [-348.525] (-349.197) (-350.364) * [-348.795] (-349.009) (-348.694) (-350.049) -- 0:00:59
78500 -- (-351.283) [-353.815] (-351.429) (-348.734) * (-349.404) [-348.154] (-348.950) (-349.187) -- 0:00:58
79000 -- (-351.551) [-348.833] (-350.805) (-349.255) * (-349.088) [-348.485] (-353.676) (-349.419) -- 0:00:58
79500 -- (-353.177) [-348.043] (-348.792) (-350.716) * [-348.852] (-348.532) (-351.543) (-349.661) -- 0:00:57
80000 -- [-349.942] (-351.350) (-349.009) (-349.577) * (-349.296) [-350.529] (-352.981) (-348.954) -- 0:00:57
Average standard deviation of split frequencies: 0.022401
80500 -- (-350.293) [-350.640] (-348.024) (-348.913) * [-349.225] (-350.474) (-350.973) (-349.668) -- 0:00:57
81000 -- [-352.282] (-351.629) (-351.865) (-350.129) * [-349.463] (-348.954) (-349.129) (-350.016) -- 0:00:56
81500 -- (-348.663) [-349.295] (-352.022) (-350.673) * (-349.390) [-352.209] (-349.442) (-349.979) -- 0:00:56
82000 -- (-348.538) (-349.988) (-350.430) [-349.078] * (-350.963) (-349.559) [-348.830] (-350.230) -- 0:00:55
82500 -- (-349.803) [-351.428] (-350.273) (-348.686) * (-350.385) (-350.805) [-350.898] (-350.959) -- 0:00:55
83000 -- [-350.649] (-350.809) (-348.529) (-350.229) * (-351.226) (-349.176) [-349.663] (-350.329) -- 0:00:55
83500 -- (-348.834) [-350.613] (-348.362) (-350.781) * [-350.999] (-350.544) (-351.432) (-351.631) -- 0:00:54
84000 -- (-348.657) [-350.933] (-348.847) (-351.488) * (-352.127) [-349.369] (-353.770) (-349.553) -- 0:00:54
84500 -- (-350.172) (-349.322) (-350.791) [-349.915] * [-350.317] (-350.222) (-349.853) (-350.436) -- 0:00:54
85000 -- [-350.037] (-350.573) (-349.028) (-349.292) * (-350.139) (-351.705) [-351.844] (-350.058) -- 0:00:53
Average standard deviation of split frequencies: 0.020360
85500 -- (-349.384) [-348.530] (-349.660) (-352.036) * (-349.361) (-350.715) [-350.099] (-347.932) -- 0:00:53
86000 -- (-349.057) (-348.850) (-348.858) [-350.770] * (-350.894) (-350.294) (-349.203) [-348.513] -- 0:00:53
86500 -- [-348.653] (-348.874) (-348.418) (-354.376) * (-351.242) (-350.968) [-349.622] (-348.770) -- 0:01:03
87000 -- [-348.775] (-351.234) (-349.911) (-351.686) * [-350.367] (-352.006) (-349.187) (-348.827) -- 0:01:02
87500 -- (-350.062) (-352.917) [-350.974] (-350.054) * (-349.519) (-348.808) (-350.019) [-349.329] -- 0:01:02
88000 -- (-351.591) [-352.693] (-348.783) (-352.664) * (-350.067) (-349.026) (-349.877) [-349.566] -- 0:01:02
88500 -- [-349.508] (-349.519) (-348.774) (-351.783) * (-352.593) (-350.337) [-348.290] (-350.117) -- 0:01:01
89000 -- (-349.625) [-348.329] (-349.325) (-351.618) * (-350.334) (-351.849) [-349.121] (-349.519) -- 0:01:01
89500 -- (-351.313) (-350.639) [-348.113] (-350.326) * (-356.162) (-349.622) [-354.581] (-348.445) -- 0:01:01
90000 -- (-349.108) [-351.418] (-350.175) (-356.040) * (-352.302) [-351.091] (-352.673) (-351.383) -- 0:01:00
Average standard deviation of split frequencies: 0.023273
90500 -- [-350.607] (-351.836) (-350.662) (-349.463) * (-355.890) (-348.779) [-349.892] (-352.553) -- 0:01:00
91000 -- [-352.771] (-352.036) (-348.589) (-348.986) * (-352.750) (-351.671) (-352.661) [-351.070] -- 0:00:59
91500 -- [-349.742] (-348.285) (-348.827) (-351.846) * [-350.620] (-349.035) (-349.124) (-353.211) -- 0:00:59
92000 -- (-354.263) (-358.738) (-348.476) [-350.947] * (-348.480) [-354.328] (-350.358) (-350.469) -- 0:00:59
92500 -- (-348.648) (-350.539) (-349.101) [-348.406] * [-352.070] (-354.656) (-349.364) (-350.302) -- 0:00:58
93000 -- [-352.359] (-349.922) (-351.846) (-356.930) * (-348.444) (-349.353) [-350.604] (-349.598) -- 0:00:58
93500 -- (-353.101) [-349.014] (-355.868) (-350.787) * [-350.604] (-348.568) (-350.998) (-353.887) -- 0:00:58
94000 -- (-350.982) [-350.266] (-348.843) (-350.847) * (-351.024) (-349.403) [-349.292] (-351.855) -- 0:00:57
94500 -- (-349.382) (-350.583) (-348.923) [-350.101] * (-351.715) (-348.297) [-349.112] (-349.553) -- 0:00:57
95000 -- (-350.097) [-351.570] (-348.799) (-348.302) * (-356.086) (-351.832) (-349.047) [-351.852] -- 0:00:57
Average standard deviation of split frequencies: 0.022915
95500 -- (-350.583) [-349.315] (-349.270) (-349.322) * (-349.771) (-348.934) (-349.221) [-351.638] -- 0:00:56
96000 -- (-353.939) (-350.221) [-350.043] (-351.937) * (-351.370) (-352.225) (-348.015) [-350.462] -- 0:00:56
96500 -- [-350.905] (-349.053) (-349.329) (-350.108) * [-350.082] (-352.794) (-349.151) (-352.530) -- 0:00:56
97000 -- (-351.556) (-348.781) (-349.258) [-349.510] * (-350.031) [-354.942] (-348.559) (-349.890) -- 0:00:55
97500 -- (-352.902) [-350.708] (-350.686) (-350.158) * [-348.972] (-350.533) (-349.029) (-353.313) -- 0:00:55
98000 -- [-350.150] (-351.287) (-349.954) (-349.512) * (-350.145) (-353.120) [-349.955] (-355.115) -- 0:00:55
98500 -- (-349.497) [-349.783] (-349.627) (-348.895) * (-350.608) (-351.891) (-351.060) [-348.497] -- 0:00:54
99000 -- (-353.969) [-351.179] (-349.392) (-349.683) * (-348.691) (-351.578) (-350.637) [-349.557] -- 0:00:54
99500 -- [-349.876] (-348.174) (-349.875) (-349.286) * [-350.842] (-348.589) (-348.863) (-348.781) -- 0:00:54
100000 -- [-348.979] (-348.526) (-351.272) (-348.250) * (-350.356) (-353.824) [-351.537] (-350.448) -- 0:00:54
Average standard deviation of split frequencies: 0.025521
100500 -- [-348.982] (-349.391) (-351.279) (-349.098) * [-350.198] (-351.002) (-348.864) (-350.692) -- 0:00:53
101000 -- [-348.489] (-351.638) (-348.802) (-350.139) * (-350.730) (-348.957) [-349.443] (-349.461) -- 0:00:53
101500 -- (-348.922) (-350.920) (-348.667) [-349.593] * (-350.819) [-349.322] (-350.128) (-351.439) -- 0:00:53
102000 -- (-351.486) (-349.890) (-348.752) [-348.282] * (-352.799) (-350.874) [-350.130] (-350.388) -- 0:00:52
102500 -- (-351.128) (-350.224) (-349.658) [-349.724] * [-349.980] (-350.049) (-349.394) (-348.989) -- 0:00:52
103000 -- (-352.426) (-354.646) (-350.110) [-349.572] * [-350.363] (-348.246) (-349.753) (-348.573) -- 0:00:52
103500 -- (-349.509) [-349.685] (-348.682) (-351.705) * [-349.853] (-351.147) (-350.136) (-352.638) -- 0:01:00
104000 -- (-350.816) (-348.746) (-349.907) [-350.391] * (-356.243) [-349.919] (-350.080) (-351.917) -- 0:01:00
104500 -- (-350.121) (-348.779) (-354.410) [-349.635] * (-350.497) (-349.983) (-351.134) [-348.867] -- 0:00:59
105000 -- (-349.009) (-349.153) [-351.772] (-351.866) * (-348.788) [-349.171] (-350.763) (-349.605) -- 0:00:59
Average standard deviation of split frequencies: 0.024777
105500 -- (-349.627) [-350.676] (-348.421) (-351.048) * (-351.908) [-353.208] (-349.849) (-353.277) -- 0:00:59
106000 -- (-349.318) [-350.006] (-348.144) (-352.117) * (-355.839) [-348.456] (-350.859) (-354.747) -- 0:00:59
106500 -- (-349.296) [-350.313] (-351.521) (-348.651) * (-352.691) (-349.497) (-349.543) [-353.918] -- 0:00:58
107000 -- (-350.674) [-351.307] (-354.197) (-349.029) * (-351.316) [-349.253] (-351.416) (-352.351) -- 0:00:58
107500 -- [-350.557] (-350.077) (-351.596) (-351.433) * (-351.512) [-348.671] (-350.656) (-350.492) -- 0:00:58
108000 -- (-348.075) [-350.274] (-350.913) (-352.322) * (-348.953) [-348.419] (-349.249) (-350.072) -- 0:00:57
108500 -- (-350.232) [-348.441] (-348.947) (-352.901) * [-350.032] (-353.431) (-351.801) (-349.814) -- 0:00:57
109000 -- (-351.453) (-349.579) [-349.799] (-349.246) * [-350.383] (-351.653) (-352.474) (-352.980) -- 0:00:57
109500 -- (-352.111) (-353.780) (-353.368) [-349.997] * [-351.186] (-351.630) (-349.265) (-349.570) -- 0:00:56
110000 -- (-350.026) [-352.024] (-349.109) (-349.550) * (-352.770) (-351.685) [-349.458] (-349.532) -- 0:00:56
Average standard deviation of split frequencies: 0.022419
110500 -- (-351.024) (-349.596) (-349.521) [-351.851] * (-351.371) (-355.445) [-350.274] (-349.847) -- 0:00:56
111000 -- (-352.116) (-349.348) [-350.560] (-350.387) * [-353.110] (-351.893) (-353.358) (-351.341) -- 0:00:56
111500 -- (-353.723) (-352.316) (-349.818) [-350.788] * (-352.581) (-351.271) [-349.165] (-356.556) -- 0:00:55
112000 -- (-350.862) (-349.708) [-347.935] (-349.046) * [-353.326] (-350.748) (-353.411) (-348.368) -- 0:00:55
112500 -- (-348.249) (-348.694) [-349.651] (-351.768) * (-354.410) [-350.243] (-348.418) (-350.509) -- 0:00:55
113000 -- (-348.666) (-355.750) [-350.560] (-355.899) * (-355.987) (-352.431) (-349.180) [-352.724] -- 0:00:54
113500 -- (-349.181) [-350.545] (-351.083) (-355.091) * (-353.014) (-350.437) (-350.658) [-350.157] -- 0:00:54
114000 -- [-348.860] (-350.195) (-355.776) (-348.846) * (-349.162) [-350.134] (-351.711) (-350.744) -- 0:00:54
114500 -- (-350.370) (-348.818) (-349.692) [-350.023] * (-348.591) (-352.304) [-351.612] (-348.830) -- 0:00:54
115000 -- (-350.729) (-351.591) [-350.051] (-350.293) * (-350.506) (-348.643) (-352.168) [-349.750] -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-350.217) (-348.599) [-351.597] (-348.643) * (-350.721) (-350.506) [-351.274] (-349.479) -- 0:00:53
116000 -- (-352.734) [-350.932] (-349.939) (-349.185) * (-349.651) (-348.499) [-349.868] (-348.489) -- 0:00:53
116500 -- (-350.827) (-352.092) [-349.564] (-348.075) * [-350.526] (-349.259) (-349.891) (-348.284) -- 0:00:53
117000 -- (-350.397) (-349.694) [-350.025] (-350.742) * (-350.287) (-349.706) [-348.967] (-351.815) -- 0:00:52
117500 -- (-351.777) (-350.785) [-355.653] (-350.155) * (-349.556) (-352.142) [-350.567] (-349.894) -- 0:00:52
118000 -- (-351.249) (-350.720) (-353.131) [-350.138] * (-350.162) (-352.487) [-351.939] (-350.120) -- 0:00:52
118500 -- [-351.190] (-352.919) (-349.567) (-351.277) * (-348.764) (-352.588) [-353.159] (-351.864) -- 0:00:52
119000 -- (-351.815) (-355.245) [-349.123] (-354.323) * [-350.228] (-351.690) (-349.593) (-349.515) -- 0:00:51
119500 -- [-351.627] (-349.536) (-348.909) (-350.622) * (-353.927) (-352.178) (-349.501) [-352.584] -- 0:00:51
120000 -- (-352.611) (-348.370) [-349.838] (-352.160) * (-353.578) (-352.709) [-349.607] (-349.347) -- 0:00:51
Average standard deviation of split frequencies: 0.024129
120500 -- (-350.346) [-350.598] (-352.263) (-349.793) * (-348.736) (-349.651) [-349.599] (-352.165) -- 0:00:51
121000 -- (-350.950) (-350.686) [-352.323] (-350.345) * [-350.101] (-350.971) (-354.366) (-351.029) -- 0:00:58
121500 -- (-349.518) [-349.829] (-350.424) (-352.085) * (-350.951) [-350.068] (-349.161) (-350.997) -- 0:00:57
122000 -- (-350.866) [-349.182] (-349.854) (-354.670) * (-349.992) (-351.092) [-348.855] (-349.678) -- 0:00:57
122500 -- (-350.072) [-351.050] (-355.407) (-350.037) * (-349.077) (-351.379) (-349.361) [-350.303] -- 0:00:57
123000 -- (-350.610) (-349.684) [-348.445] (-349.158) * [-348.895] (-351.175) (-350.378) (-349.849) -- 0:00:57
123500 -- (-351.286) (-350.804) [-350.839] (-351.600) * (-349.610) [-350.447] (-350.026) (-349.094) -- 0:00:56
124000 -- [-353.018] (-351.501) (-354.035) (-353.589) * (-350.371) (-350.209) (-350.058) [-348.692] -- 0:00:56
124500 -- (-350.067) [-349.703] (-349.982) (-351.803) * (-349.000) [-350.284] (-350.511) (-352.042) -- 0:00:56
125000 -- (-350.795) (-349.275) (-352.274) [-349.940] * [-349.805] (-348.282) (-351.100) (-357.977) -- 0:00:56
Average standard deviation of split frequencies: 0.022008
125500 -- (-349.932) [-350.334] (-350.440) (-349.656) * (-349.608) (-348.660) [-352.098] (-350.484) -- 0:00:55
126000 -- (-354.430) (-349.036) [-349.340] (-349.483) * (-347.972) [-349.070] (-351.676) (-350.375) -- 0:00:55
126500 -- (-350.663) [-348.644] (-349.127) (-348.604) * (-351.942) (-352.678) [-349.889] (-352.536) -- 0:00:55
127000 -- (-351.345) (-354.556) (-351.639) [-351.440] * (-349.216) (-350.004) (-348.994) [-352.051] -- 0:00:54
127500 -- (-348.111) [-349.062] (-352.080) (-353.004) * (-351.983) [-350.890] (-349.258) (-348.505) -- 0:00:54
128000 -- (-349.150) (-349.381) (-348.928) [-349.243] * [-350.049] (-350.259) (-350.227) (-356.157) -- 0:00:54
128500 -- (-348.482) (-351.283) [-349.041] (-350.711) * [-351.498] (-348.714) (-351.020) (-349.480) -- 0:00:54
129000 -- (-348.485) (-350.889) [-348.019] (-349.236) * [-353.160] (-349.692) (-351.897) (-353.677) -- 0:00:54
129500 -- (-349.648) (-348.069) (-351.963) [-351.069] * (-350.705) (-352.107) [-348.959] (-350.950) -- 0:00:53
130000 -- (-349.515) [-348.667] (-349.468) (-349.679) * (-349.899) (-351.659) [-349.587] (-350.321) -- 0:00:53
Average standard deviation of split frequencies: 0.020697
130500 -- (-349.322) [-348.504] (-349.300) (-350.945) * (-349.965) (-349.489) [-348.584] (-351.393) -- 0:00:53
131000 -- (-349.256) [-351.655] (-349.474) (-354.830) * (-352.442) [-350.164] (-349.178) (-349.668) -- 0:00:53
131500 -- (-353.413) (-348.808) [-349.377] (-350.894) * (-350.299) (-350.985) (-350.534) [-348.410] -- 0:00:52
132000 -- (-350.920) (-351.053) (-349.887) [-348.815] * (-349.486) [-350.061] (-349.757) (-353.258) -- 0:00:52
132500 -- (-355.914) (-349.785) [-350.778] (-349.046) * [-351.984] (-349.897) (-348.919) (-356.098) -- 0:00:52
133000 -- (-349.716) [-350.949] (-349.736) (-350.022) * [-348.389] (-352.045) (-349.595) (-351.453) -- 0:00:52
133500 -- [-349.287] (-349.539) (-356.261) (-352.914) * (-348.825) [-350.354] (-351.309) (-350.405) -- 0:00:51
134000 -- (-351.587) [-349.542] (-350.374) (-348.188) * (-349.667) (-349.907) [-349.928] (-349.167) -- 0:00:51
134500 -- [-350.580] (-349.404) (-348.785) (-348.136) * (-348.916) (-355.833) (-348.336) [-348.810] -- 0:00:51
135000 -- (-349.694) (-351.596) (-350.132) [-350.554] * (-349.990) (-350.965) [-348.199] (-350.494) -- 0:00:51
Average standard deviation of split frequencies: 0.018486
135500 -- (-349.521) (-351.369) [-350.793] (-350.389) * [-349.441] (-348.380) (-349.563) (-352.338) -- 0:00:51
136000 -- (-349.005) (-349.278) [-352.813] (-352.774) * (-351.971) (-349.015) (-352.946) [-348.808] -- 0:00:50
136500 -- (-350.796) (-351.751) (-349.594) [-350.361] * (-349.640) (-351.474) (-351.043) [-350.330] -- 0:00:50
137000 -- (-349.289) (-351.587) (-349.020) [-349.878] * (-348.156) [-349.132] (-349.133) (-350.807) -- 0:00:50
137500 -- (-352.933) (-348.859) (-348.492) [-351.370] * (-349.309) [-349.195] (-352.509) (-349.275) -- 0:00:50
138000 -- (-348.880) (-349.001) [-350.682] (-348.778) * (-351.642) (-354.353) (-353.708) [-348.996] -- 0:00:49
138500 -- [-349.203] (-353.147) (-353.438) (-351.011) * (-352.450) (-352.826) (-351.550) [-353.658] -- 0:00:55
139000 -- (-350.718) [-349.606] (-351.104) (-348.845) * (-349.673) [-349.141] (-351.906) (-352.168) -- 0:00:55
139500 -- (-350.726) (-351.048) (-350.837) [-349.275] * (-348.563) (-351.817) (-348.067) [-349.328] -- 0:00:55
140000 -- [-355.281] (-349.859) (-350.061) (-348.766) * (-349.439) (-349.210) (-352.359) [-349.259] -- 0:00:55
Average standard deviation of split frequencies: 0.020852
140500 -- [-352.034] (-349.466) (-351.112) (-348.913) * (-352.913) [-348.515] (-352.449) (-348.469) -- 0:00:55
141000 -- [-351.832] (-349.739) (-351.037) (-348.616) * (-349.949) (-351.548) (-349.137) [-349.670] -- 0:00:54
141500 -- (-351.377) (-348.226) [-350.797] (-348.425) * (-348.162) (-350.286) [-350.450] (-352.426) -- 0:00:54
142000 -- (-349.819) (-349.150) (-351.281) [-349.907] * [-349.228] (-350.567) (-350.280) (-354.286) -- 0:00:54
142500 -- (-351.652) (-348.251) (-349.188) [-349.805] * [-348.217] (-356.763) (-349.461) (-352.760) -- 0:00:54
143000 -- (-353.281) (-348.836) (-351.309) [-353.718] * [-349.862] (-349.739) (-348.432) (-348.836) -- 0:00:53
143500 -- (-350.902) [-350.759] (-350.727) (-352.377) * (-352.022) (-350.394) [-352.416] (-349.236) -- 0:00:53
144000 -- (-350.114) (-350.563) (-352.106) [-350.551] * (-351.519) [-351.067] (-349.069) (-349.658) -- 0:00:53
144500 -- (-350.343) [-353.241] (-349.767) (-349.356) * [-348.780] (-348.551) (-350.812) (-351.403) -- 0:00:53
145000 -- (-350.105) [-350.435] (-348.948) (-347.940) * (-349.100) [-351.593] (-354.933) (-350.676) -- 0:00:53
Average standard deviation of split frequencies: 0.020180
145500 -- (-349.360) (-348.865) (-350.551) [-352.002] * (-350.861) (-353.133) [-349.181] (-352.783) -- 0:00:52
146000 -- (-348.337) [-352.107] (-350.048) (-350.817) * (-348.731) (-348.665) [-349.350] (-350.623) -- 0:00:52
146500 -- [-348.843] (-349.675) (-349.151) (-348.779) * (-348.241) (-350.620) [-349.470] (-358.678) -- 0:00:52
147000 -- (-351.786) (-351.996) [-351.314] (-348.603) * (-348.931) (-349.124) (-349.933) [-351.860] -- 0:00:52
147500 -- (-350.541) [-350.854] (-352.246) (-349.038) * [-350.056] (-351.810) (-352.747) (-349.069) -- 0:00:52
148000 -- (-352.123) (-355.301) (-349.935) [-349.119] * (-349.950) [-349.141] (-353.426) (-349.789) -- 0:00:51
148500 -- (-349.414) (-348.369) [-348.509] (-356.150) * (-353.379) (-350.744) [-349.203] (-349.367) -- 0:00:51
149000 -- [-349.043] (-350.467) (-348.853) (-350.087) * (-349.182) [-349.778] (-351.030) (-349.696) -- 0:00:51
149500 -- (-353.193) [-348.899] (-349.663) (-348.298) * (-350.932) (-353.138) [-348.601] (-348.673) -- 0:00:51
150000 -- (-351.284) (-351.245) [-349.272] (-349.740) * (-349.239) (-351.633) [-351.577] (-348.212) -- 0:00:51
Average standard deviation of split frequencies: 0.021380
150500 -- (-351.435) (-349.657) (-350.220) [-350.348] * (-349.087) (-348.848) [-350.108] (-348.123) -- 0:00:50
151000 -- [-348.837] (-349.029) (-348.434) (-349.831) * (-350.210) (-353.549) [-353.205] (-349.190) -- 0:00:50
151500 -- (-351.491) (-349.592) [-349.509] (-350.263) * [-350.375] (-348.542) (-351.243) (-350.979) -- 0:00:50
152000 -- (-354.349) (-351.628) (-348.502) [-350.005] * (-350.380) [-348.546] (-349.905) (-352.303) -- 0:00:50
152500 -- [-350.774] (-349.296) (-353.789) (-349.511) * (-353.216) (-351.029) [-352.657] (-349.544) -- 0:00:50
153000 -- (-348.314) [-349.850] (-348.321) (-349.530) * (-351.465) (-349.541) (-348.426) [-348.936] -- 0:00:49
153500 -- [-348.308] (-349.998) (-349.045) (-353.500) * (-353.355) [-348.854] (-348.760) (-348.484) -- 0:00:49
154000 -- (-350.155) [-348.578] (-348.419) (-350.567) * (-353.248) (-352.805) [-349.524] (-351.753) -- 0:00:49
154500 -- (-349.569) [-349.284] (-348.079) (-350.984) * [-349.355] (-354.913) (-350.599) (-350.762) -- 0:00:49
155000 -- (-351.441) (-349.118) (-351.313) [-351.701] * [-353.034] (-352.948) (-352.422) (-349.950) -- 0:00:49
Average standard deviation of split frequencies: 0.021656
155500 -- [-349.879] (-350.155) (-350.750) (-351.136) * (-350.774) (-348.534) [-351.623] (-351.255) -- 0:00:54
156000 -- (-352.389) (-349.551) (-348.971) [-349.338] * (-348.958) (-350.311) [-349.266] (-349.855) -- 0:00:54
156500 -- (-348.481) (-351.819) [-348.911] (-349.087) * [-348.962] (-353.171) (-348.064) (-349.935) -- 0:00:53
157000 -- (-350.839) [-349.372] (-351.339) (-348.849) * (-351.589) (-348.456) (-350.613) [-350.778] -- 0:00:53
157500 -- [-349.458] (-350.086) (-349.595) (-348.923) * (-354.103) [-354.047] (-352.648) (-349.503) -- 0:00:53
158000 -- (-349.713) [-350.228] (-349.597) (-349.466) * (-349.027) (-350.947) [-349.180] (-349.741) -- 0:00:53
158500 -- (-351.827) (-352.115) [-354.075] (-348.550) * [-349.438] (-351.294) (-349.679) (-350.304) -- 0:00:53
159000 -- (-352.187) [-348.934] (-351.821) (-350.075) * (-351.185) [-352.631] (-350.334) (-351.689) -- 0:00:52
159500 -- (-349.104) [-356.824] (-351.991) (-356.447) * (-351.192) (-353.710) (-350.983) [-348.221] -- 0:00:52
160000 -- (-348.573) (-352.218) [-350.009] (-352.089) * [-353.648] (-359.030) (-352.296) (-350.121) -- 0:00:52
Average standard deviation of split frequencies: 0.023798
160500 -- (-350.108) (-350.564) [-349.802] (-350.584) * (-352.093) (-356.916) (-350.695) [-350.738] -- 0:00:52
161000 -- (-348.871) (-353.708) (-350.137) [-349.570] * (-351.859) [-349.561] (-353.535) (-351.033) -- 0:00:52
161500 -- (-352.297) [-350.884] (-350.220) (-351.575) * (-352.673) [-349.144] (-353.082) (-352.941) -- 0:00:51
162000 -- [-348.418] (-355.831) (-351.493) (-351.020) * (-350.672) (-353.503) (-350.248) [-350.317] -- 0:00:51
162500 -- (-351.052) (-349.062) (-352.301) [-352.321] * (-351.372) (-352.042) [-348.734] (-351.756) -- 0:00:51
163000 -- [-353.619] (-349.225) (-349.267) (-350.212) * (-349.455) (-349.351) (-350.859) [-350.330] -- 0:00:51
163500 -- (-356.570) [-351.639] (-350.270) (-351.382) * (-356.166) (-350.139) (-354.475) [-350.285] -- 0:00:51
164000 -- (-348.869) (-351.398) (-348.807) [-352.708] * (-352.812) [-349.087] (-348.958) (-354.302) -- 0:00:50
164500 -- [-351.566] (-349.861) (-350.565) (-354.082) * (-350.496) [-348.643] (-348.240) (-356.407) -- 0:00:50
165000 -- (-356.618) (-349.738) (-349.482) [-349.731] * (-350.745) [-350.650] (-350.416) (-350.350) -- 0:00:50
Average standard deviation of split frequencies: 0.022561
165500 -- (-349.859) (-351.390) (-348.697) [-349.759] * (-350.185) (-348.106) (-349.358) [-350.347] -- 0:00:50
166000 -- [-349.356] (-349.740) (-349.246) (-351.203) * [-348.874] (-348.423) (-349.289) (-349.650) -- 0:00:50
166500 -- (-350.424) (-349.727) [-348.881] (-348.846) * (-349.321) [-349.635] (-352.459) (-349.685) -- 0:00:50
167000 -- (-354.111) (-349.822) (-348.995) [-352.284] * (-348.684) (-349.808) [-351.718] (-351.170) -- 0:00:49
167500 -- (-355.459) (-349.526) [-349.140] (-350.245) * (-352.622) (-349.561) [-350.927] (-350.487) -- 0:00:49
168000 -- (-353.471) (-349.145) (-352.511) [-348.568] * [-349.042] (-349.797) (-350.842) (-349.375) -- 0:00:49
168500 -- (-349.360) (-352.288) [-351.981] (-349.534) * (-349.923) (-352.304) [-350.411] (-348.500) -- 0:00:49
169000 -- (-351.309) [-352.913] (-349.333) (-348.702) * (-351.950) (-352.240) (-348.691) [-349.670] -- 0:00:49
169500 -- [-350.833] (-351.432) (-349.408) (-350.054) * [-350.719] (-351.332) (-349.229) (-349.838) -- 0:00:48
170000 -- [-351.026] (-351.758) (-348.816) (-348.498) * [-349.069] (-351.539) (-348.415) (-350.463) -- 0:00:48
Average standard deviation of split frequencies: 0.020563
170500 -- (-356.776) (-349.417) [-349.033] (-349.391) * (-350.374) (-350.983) [-348.436] (-348.742) -- 0:00:48
171000 -- (-354.927) (-351.125) (-349.506) [-350.953] * (-349.003) (-348.345) [-349.046] (-351.372) -- 0:00:48
171500 -- [-354.841] (-353.209) (-355.091) (-353.474) * (-351.366) (-349.248) (-351.468) [-349.985] -- 0:00:48
172000 -- (-351.678) (-352.083) [-348.653] (-350.251) * (-350.725) [-348.077] (-352.141) (-352.460) -- 0:00:48
172500 -- (-352.613) (-354.862) (-348.502) [-348.601] * (-350.398) (-348.849) (-348.674) [-351.439] -- 0:00:47
173000 -- (-356.267) [-351.700] (-348.800) (-349.593) * (-351.529) [-349.333] (-349.870) (-351.700) -- 0:00:52
173500 -- (-350.021) (-355.963) (-348.455) [-350.201] * (-353.286) [-351.474] (-349.794) (-355.816) -- 0:00:52
174000 -- (-348.923) [-350.071] (-349.173) (-351.654) * (-352.673) (-354.938) [-352.092] (-353.611) -- 0:00:52
174500 -- [-349.356] (-352.976) (-350.928) (-349.287) * (-350.555) [-350.855] (-351.852) (-351.235) -- 0:00:52
175000 -- (-353.726) (-350.757) (-353.236) [-348.541] * (-350.673) [-348.527] (-347.900) (-351.577) -- 0:00:51
Average standard deviation of split frequencies: 0.021743
175500 -- (-351.945) (-352.415) (-352.546) [-350.396] * (-350.059) (-356.276) [-349.811] (-353.080) -- 0:00:51
176000 -- (-348.689) (-350.969) [-357.424] (-352.794) * (-349.297) (-349.070) (-350.392) [-351.575] -- 0:00:51
176500 -- (-348.964) (-353.325) [-349.614] (-353.026) * (-352.517) [-349.364] (-349.691) (-350.506) -- 0:00:51
177000 -- (-348.482) (-354.182) [-350.488] (-351.392) * (-354.194) [-353.584] (-349.556) (-349.738) -- 0:00:51
177500 -- (-349.220) [-348.818] (-352.069) (-350.499) * [-350.174] (-354.485) (-350.702) (-348.800) -- 0:00:50
178000 -- [-350.712] (-350.058) (-354.835) (-350.553) * (-350.309) (-349.921) [-352.171] (-348.926) -- 0:00:50
178500 -- [-350.965] (-350.517) (-352.615) (-348.600) * (-349.766) (-350.886) (-348.472) [-351.794] -- 0:00:50
179000 -- (-350.125) [-350.720] (-352.457) (-352.436) * (-350.174) (-349.028) [-350.478] (-352.105) -- 0:00:50
179500 -- (-351.553) [-350.703] (-351.259) (-349.861) * (-357.980) (-351.654) [-349.538] (-353.860) -- 0:00:50
180000 -- (-352.692) (-350.231) [-350.471] (-349.308) * (-355.428) [-352.038] (-350.198) (-348.835) -- 0:00:50
Average standard deviation of split frequencies: 0.021334
180500 -- [-348.709] (-350.565) (-349.096) (-351.224) * (-350.268) (-349.553) (-348.677) [-351.098] -- 0:00:49
181000 -- (-352.241) (-350.139) [-349.382] (-348.995) * (-352.228) (-350.198) [-349.609] (-353.597) -- 0:00:49
181500 -- (-350.130) [-350.445] (-353.664) (-351.306) * (-351.258) [-352.404] (-350.254) (-351.695) -- 0:00:49
182000 -- [-349.220] (-349.297) (-349.282) (-348.835) * (-351.168) (-352.778) (-349.930) [-350.731] -- 0:00:49
182500 -- (-350.185) (-353.507) (-350.676) [-349.933] * (-353.241) (-348.478) [-349.718] (-350.606) -- 0:00:49
183000 -- [-350.464] (-349.323) (-350.466) (-351.389) * (-349.681) (-349.929) (-352.583) [-348.528] -- 0:00:49
183500 -- (-351.549) [-352.811] (-350.396) (-359.828) * [-349.788] (-349.412) (-349.987) (-349.284) -- 0:00:48
184000 -- [-348.000] (-350.789) (-349.445) (-350.294) * (-348.766) (-354.036) [-350.012] (-351.516) -- 0:00:48
184500 -- (-349.265) [-350.233] (-349.672) (-352.592) * (-351.099) [-351.094] (-353.185) (-350.145) -- 0:00:48
185000 -- (-349.866) [-351.382] (-348.822) (-349.691) * (-350.191) (-350.222) (-352.706) [-350.560] -- 0:00:48
Average standard deviation of split frequencies: 0.019853
185500 -- (-350.909) (-353.973) [-349.803] (-348.726) * (-351.850) (-351.340) (-353.395) [-350.930] -- 0:00:48
186000 -- (-353.856) (-351.818) (-350.399) [-350.411] * (-353.625) [-350.621] (-352.018) (-351.894) -- 0:00:48
186500 -- [-349.428] (-351.236) (-352.185) (-350.826) * (-350.661) [-350.004] (-348.463) (-353.124) -- 0:00:47
187000 -- (-350.051) [-352.863] (-348.968) (-349.479) * (-349.582) (-351.787) [-350.584] (-350.197) -- 0:00:47
187500 -- (-351.876) (-355.201) (-351.402) [-348.734] * (-350.738) [-350.197] (-348.800) (-352.537) -- 0:00:47
188000 -- (-351.067) (-352.308) (-350.454) [-350.435] * (-352.140) (-353.508) [-350.756] (-352.849) -- 0:00:47
188500 -- (-355.618) [-350.586] (-351.143) (-356.649) * (-351.683) (-351.971) (-349.712) [-349.921] -- 0:00:47
189000 -- (-350.559) [-352.204] (-349.297) (-353.098) * (-352.344) (-349.231) (-348.749) [-347.884] -- 0:00:47
189500 -- [-349.909] (-349.376) (-351.683) (-349.447) * [-348.981] (-349.361) (-348.464) (-350.604) -- 0:00:47
190000 -- (-350.036) [-349.049] (-351.187) (-348.357) * [-348.683] (-352.576) (-352.476) (-354.795) -- 0:00:51
Average standard deviation of split frequencies: 0.020329
190500 -- (-350.767) (-348.855) (-352.346) [-350.438] * [-350.364] (-353.186) (-350.395) (-349.581) -- 0:00:50
191000 -- (-352.058) (-354.179) [-349.686] (-351.346) * (-356.617) [-352.252] (-350.004) (-352.004) -- 0:00:50
191500 -- [-348.321] (-349.118) (-351.052) (-350.382) * (-349.937) (-357.172) [-348.867] (-350.733) -- 0:00:50
192000 -- (-355.094) (-351.147) [-349.242] (-351.729) * [-349.740] (-353.295) (-350.614) (-353.882) -- 0:00:50
192500 -- (-354.460) (-348.653) (-350.901) [-352.095] * (-350.710) (-350.361) (-350.990) [-348.907] -- 0:00:50
193000 -- (-351.173) [-349.170] (-348.931) (-350.683) * (-349.431) [-350.934] (-353.569) (-350.603) -- 0:00:50
193500 -- [-350.732] (-349.610) (-354.961) (-351.732) * [-351.868] (-349.792) (-349.899) (-348.978) -- 0:00:50
194000 -- (-348.425) (-348.596) [-353.194] (-349.724) * (-350.818) (-349.622) (-350.899) [-352.377] -- 0:00:49
194500 -- (-351.179) (-351.298) [-348.252] (-350.840) * (-350.859) (-348.472) [-349.593] (-350.749) -- 0:00:49
195000 -- [-351.333] (-349.968) (-348.713) (-350.002) * (-351.973) (-349.356) [-352.282] (-350.781) -- 0:00:49
Average standard deviation of split frequencies: 0.020231
195500 -- (-350.431) [-351.710] (-350.166) (-350.344) * (-350.543) (-350.322) (-349.107) [-354.550] -- 0:00:49
196000 -- (-348.607) [-349.215] (-351.285) (-349.313) * (-351.270) (-349.684) [-349.687] (-352.949) -- 0:00:49
196500 -- (-350.097) (-348.658) [-351.560] (-348.678) * [-351.080] (-350.541) (-349.272) (-352.691) -- 0:00:49
197000 -- (-353.112) (-349.280) [-354.067] (-349.239) * (-350.240) (-348.267) [-348.288] (-351.692) -- 0:00:48
197500 -- (-351.057) (-349.953) [-349.702] (-350.505) * (-350.740) [-349.170] (-348.543) (-354.478) -- 0:00:48
198000 -- [-350.910] (-349.526) (-349.775) (-351.258) * (-352.092) (-350.685) (-352.673) [-349.446] -- 0:00:48
198500 -- (-349.602) (-357.282) [-349.123] (-353.742) * (-351.458) [-349.200] (-350.490) (-350.811) -- 0:00:48
199000 -- (-349.236) (-350.023) [-352.470] (-350.082) * (-355.700) (-350.810) (-355.825) [-350.946] -- 0:00:48
199500 -- (-348.848) (-349.504) [-348.900] (-349.329) * [-352.485] (-352.291) (-353.325) (-352.868) -- 0:00:48
200000 -- [-350.009] (-348.194) (-348.765) (-350.349) * (-353.458) (-355.816) [-352.544] (-351.410) -- 0:00:48
Average standard deviation of split frequencies: 0.021419
200500 -- (-350.276) (-348.826) [-350.704] (-349.267) * (-353.698) (-351.703) (-352.188) [-349.478] -- 0:00:47
201000 -- (-349.328) [-351.385] (-349.903) (-351.457) * (-352.579) (-350.890) [-352.749] (-350.403) -- 0:00:47
201500 -- (-353.471) [-350.639] (-354.012) (-349.198) * (-349.283) (-352.316) [-350.029] (-356.041) -- 0:00:47
202000 -- (-350.945) (-350.610) (-350.369) [-348.720] * (-349.411) (-349.558) [-351.972] (-351.313) -- 0:00:47
202500 -- (-351.481) (-351.341) [-349.998] (-350.288) * (-348.838) [-350.728] (-354.551) (-349.270) -- 0:00:47
203000 -- (-353.937) [-350.731] (-348.432) (-349.835) * (-352.862) (-348.936) (-349.301) [-349.125] -- 0:00:47
203500 -- (-349.411) (-350.673) (-351.328) [-348.970] * [-348.943] (-350.408) (-349.353) (-353.616) -- 0:00:46
204000 -- [-348.785] (-348.914) (-351.698) (-350.655) * [-350.724] (-350.356) (-350.595) (-350.018) -- 0:00:46
204500 -- (-349.849) (-348.075) [-350.030] (-351.366) * (-349.832) [-352.430] (-352.132) (-354.616) -- 0:00:46
205000 -- (-349.090) [-350.500] (-350.167) (-351.162) * (-351.228) [-350.945] (-355.715) (-351.540) -- 0:00:46
Average standard deviation of split frequencies: 0.020341
205500 -- (-352.369) (-350.070) (-350.808) [-348.855] * (-350.523) [-351.451] (-350.274) (-348.317) -- 0:00:46
206000 -- (-350.484) (-358.404) [-348.702] (-348.599) * (-349.592) [-351.528] (-351.978) (-348.128) -- 0:00:46
206500 -- [-349.667] (-354.289) (-348.985) (-350.689) * (-348.593) (-351.418) [-351.166] (-349.225) -- 0:00:46
207000 -- (-350.689) [-350.665] (-348.833) (-348.694) * [-349.164] (-351.107) (-349.684) (-351.176) -- 0:00:49
207500 -- [-348.192] (-352.501) (-350.724) (-349.957) * (-349.563) (-351.279) (-350.438) [-350.346] -- 0:00:49
208000 -- (-348.024) [-353.052] (-349.726) (-350.853) * (-353.053) [-355.252] (-352.066) (-349.683) -- 0:00:49
208500 -- (-349.665) (-350.186) (-350.782) [-348.560] * (-349.447) (-351.840) [-350.446] (-349.523) -- 0:00:49
209000 -- (-351.063) [-350.620] (-350.866) (-348.394) * (-349.827) (-349.255) [-348.115] (-355.182) -- 0:00:49
209500 -- (-352.889) (-351.023) (-350.585) [-349.060] * [-352.213] (-350.045) (-353.095) (-356.930) -- 0:00:49
210000 -- [-350.989] (-350.730) (-349.257) (-350.662) * (-348.614) (-348.092) (-349.232) [-350.225] -- 0:00:48
Average standard deviation of split frequencies: 0.020636
210500 -- (-348.886) (-353.566) (-353.156) [-349.225] * (-350.225) [-350.513] (-349.510) (-349.622) -- 0:00:48
211000 -- (-353.034) [-352.878] (-350.774) (-353.466) * (-348.686) (-349.657) (-351.901) [-350.534] -- 0:00:48
211500 -- (-348.939) [-351.445] (-358.167) (-348.657) * (-350.115) [-348.568] (-350.380) (-353.801) -- 0:00:48
212000 -- (-349.872) (-350.927) [-350.514] (-349.671) * (-350.757) (-350.404) [-350.128] (-353.695) -- 0:00:48
212500 -- (-350.805) (-349.888) (-349.549) [-348.249] * (-349.284) [-349.983] (-353.977) (-350.662) -- 0:00:48
213000 -- (-351.153) [-349.519] (-351.787) (-350.069) * (-350.132) (-350.896) (-349.699) [-350.185] -- 0:00:48
213500 -- (-348.503) [-348.952] (-352.689) (-351.293) * (-348.048) [-349.396] (-352.819) (-349.110) -- 0:00:47
214000 -- (-348.291) (-352.268) (-353.834) [-349.830] * (-349.119) (-353.046) (-354.835) [-349.764] -- 0:00:47
214500 -- (-349.687) [-357.405] (-349.539) (-350.227) * (-349.879) (-351.146) (-351.943) [-348.956] -- 0:00:47
215000 -- [-348.117] (-350.515) (-350.414) (-349.671) * (-350.347) (-350.539) [-352.127] (-351.098) -- 0:00:47
Average standard deviation of split frequencies: 0.019399
215500 -- (-349.459) [-350.862] (-348.472) (-349.177) * (-349.229) [-353.465] (-354.356) (-352.458) -- 0:00:47
216000 -- (-348.986) (-353.110) (-349.808) [-349.582] * (-349.853) (-350.066) [-350.745] (-351.584) -- 0:00:47
216500 -- [-350.652] (-350.046) (-354.886) (-349.083) * (-351.138) (-350.589) (-350.335) [-351.646] -- 0:00:47
217000 -- (-350.844) (-349.234) (-352.202) [-349.757] * (-349.732) (-348.159) (-351.266) [-349.951] -- 0:00:46
217500 -- (-352.237) (-349.088) [-352.226] (-348.965) * (-351.059) (-352.520) [-349.737] (-352.300) -- 0:00:46
218000 -- [-352.726] (-350.502) (-349.192) (-350.064) * (-349.574) [-349.390] (-350.348) (-353.425) -- 0:00:46
218500 -- [-350.494] (-351.433) (-350.846) (-350.538) * (-349.907) (-350.073) (-352.030) [-350.055] -- 0:00:46
219000 -- [-352.832] (-348.955) (-352.707) (-349.378) * (-349.169) [-351.788] (-350.982) (-350.537) -- 0:00:46
219500 -- [-351.102] (-349.239) (-349.550) (-348.485) * (-350.683) [-350.385] (-349.648) (-351.438) -- 0:00:46
220000 -- (-350.711) (-352.031) (-348.741) [-351.459] * (-352.642) (-351.798) (-350.129) [-350.105] -- 0:00:46
Average standard deviation of split frequencies: 0.018095
220500 -- (-355.208) (-351.645) (-349.531) [-352.036] * (-351.419) (-350.276) (-349.823) [-349.658] -- 0:00:45
221000 -- (-349.662) (-348.821) (-349.871) [-349.164] * (-349.731) (-351.697) (-349.476) [-350.815] -- 0:00:45
221500 -- (-349.785) (-349.894) (-349.172) [-349.081] * (-349.126) (-352.147) (-350.604) [-348.845] -- 0:00:45
222000 -- (-349.130) (-349.172) [-348.350] (-348.430) * (-348.698) (-349.713) [-350.717] (-352.702) -- 0:00:45
222500 -- [-348.563] (-349.580) (-350.291) (-350.429) * (-350.427) (-354.190) (-351.628) [-350.127] -- 0:00:45
223000 -- (-351.311) (-348.343) [-348.993] (-349.401) * [-348.396] (-348.263) (-348.830) (-348.758) -- 0:00:45
223500 -- (-350.560) [-349.286] (-350.832) (-350.956) * (-348.680) [-350.184] (-354.566) (-352.911) -- 0:00:45
224000 -- (-348.704) (-351.738) [-350.008] (-349.991) * [-353.162] (-349.407) (-350.213) (-352.399) -- 0:00:48
224500 -- (-348.517) (-349.165) [-349.510] (-349.229) * (-351.645) [-350.604] (-351.553) (-352.992) -- 0:00:48
225000 -- (-349.234) (-349.869) (-348.595) [-348.901] * (-351.411) (-350.858) [-353.329] (-351.692) -- 0:00:48
Average standard deviation of split frequencies: 0.018037
225500 -- [-348.444] (-353.626) (-351.969) (-350.625) * (-350.104) [-350.632] (-351.491) (-349.405) -- 0:00:48
226000 -- [-352.336] (-350.917) (-350.114) (-349.930) * [-348.672] (-349.657) (-352.338) (-351.353) -- 0:00:47
226500 -- (-350.148) (-348.467) [-349.100] (-353.060) * (-351.592) [-348.954] (-350.362) (-348.127) -- 0:00:47
227000 -- [-349.963] (-353.372) (-349.940) (-356.104) * [-349.284] (-350.483) (-351.197) (-348.953) -- 0:00:47
227500 -- (-348.902) [-349.695] (-348.086) (-348.411) * (-350.705) (-351.369) [-348.810] (-349.535) -- 0:00:47
228000 -- (-351.038) (-355.498) [-350.963] (-348.515) * (-350.613) (-353.563) (-350.201) [-350.354] -- 0:00:47
228500 -- (-349.711) [-352.054] (-356.693) (-349.936) * (-352.609) (-349.851) (-350.596) [-350.551] -- 0:00:47
229000 -- (-351.560) (-350.782) (-349.343) [-352.302] * [-350.065] (-351.178) (-350.024) (-349.894) -- 0:00:47
229500 -- (-353.299) [-348.882] (-349.869) (-351.006) * (-349.778) (-352.415) (-352.658) [-356.022] -- 0:00:47
230000 -- (-352.987) (-349.279) [-351.725] (-348.978) * (-352.508) (-349.768) [-352.564] (-350.320) -- 0:00:46
Average standard deviation of split frequencies: 0.016950
230500 -- [-352.915] (-350.165) (-354.584) (-351.159) * (-352.385) (-349.926) (-350.501) [-349.048] -- 0:00:46
231000 -- [-348.441] (-350.115) (-350.224) (-349.477) * (-349.482) (-350.218) (-351.581) [-351.154] -- 0:00:46
231500 -- (-349.744) [-348.423] (-350.541) (-351.578) * (-348.339) [-351.294] (-349.754) (-349.259) -- 0:00:46
232000 -- [-349.772] (-348.864) (-350.049) (-354.501) * (-348.666) [-350.337] (-352.164) (-349.099) -- 0:00:46
232500 -- (-350.234) (-348.755) [-348.631] (-351.671) * (-351.947) (-349.668) (-351.684) [-350.553] -- 0:00:46
233000 -- (-348.826) (-349.296) [-348.767] (-352.351) * (-351.224) (-351.428) [-351.827] (-349.691) -- 0:00:46
233500 -- [-350.079] (-351.448) (-352.711) (-350.890) * [-350.226] (-356.698) (-351.136) (-350.481) -- 0:00:45
234000 -- (-350.826) [-351.305] (-354.577) (-348.923) * [-351.150] (-353.860) (-353.510) (-351.108) -- 0:00:45
234500 -- [-353.421] (-351.240) (-349.221) (-348.702) * (-356.381) (-354.015) [-350.961] (-352.740) -- 0:00:45
235000 -- (-352.833) [-349.837] (-349.136) (-348.879) * (-353.260) [-350.119] (-350.849) (-351.638) -- 0:00:45
Average standard deviation of split frequencies: 0.016450
235500 -- (-349.718) (-348.645) [-349.651] (-353.733) * [-358.332] (-350.778) (-350.836) (-348.282) -- 0:00:45
236000 -- (-349.384) (-350.449) (-353.976) [-349.013] * [-350.068] (-354.249) (-354.852) (-348.228) -- 0:00:45
236500 -- [-351.457] (-354.587) (-351.243) (-351.164) * (-349.078) (-353.961) [-355.116] (-350.066) -- 0:00:45
237000 -- (-350.735) (-349.358) [-351.230] (-350.175) * [-348.562] (-351.288) (-349.543) (-350.371) -- 0:00:45
237500 -- (-349.707) (-348.954) (-351.562) [-348.588] * (-348.489) (-354.067) (-351.390) [-350.021] -- 0:00:44
238000 -- (-354.797) (-349.307) (-348.658) [-348.381] * [-348.659] (-351.433) (-350.313) (-350.256) -- 0:00:44
238500 -- (-357.466) [-350.150] (-354.357) (-349.438) * [-348.434] (-351.634) (-348.971) (-352.395) -- 0:00:44
239000 -- (-351.551) (-348.781) [-351.209] (-349.056) * (-349.281) (-351.273) (-349.327) [-349.433] -- 0:00:44
239500 -- (-350.058) (-349.206) (-350.402) [-350.387] * [-349.567] (-350.111) (-349.881) (-349.120) -- 0:00:44
240000 -- (-349.675) [-349.915] (-352.811) (-350.206) * [-350.343] (-350.645) (-354.252) (-349.703) -- 0:00:44
Average standard deviation of split frequencies: 0.016361
240500 -- (-348.883) (-350.954) (-355.987) [-350.592] * (-351.982) (-354.669) (-353.124) [-350.747] -- 0:00:44
241000 -- (-349.182) (-349.882) [-347.954] (-355.349) * (-349.693) (-356.222) [-355.618] (-351.603) -- 0:00:47
241500 -- (-351.935) (-352.562) (-348.888) [-351.291] * [-352.004] (-348.917) (-349.951) (-350.396) -- 0:00:47
242000 -- (-351.672) [-350.856] (-349.319) (-351.328) * (-349.169) [-356.243] (-349.097) (-351.700) -- 0:00:46
242500 -- (-351.521) (-349.209) (-350.653) [-348.808] * [-349.255] (-353.923) (-349.172) (-350.926) -- 0:00:46
243000 -- (-354.449) (-349.530) (-350.017) [-348.561] * (-349.196) (-350.653) [-349.021] (-350.488) -- 0:00:46
243500 -- [-349.670] (-349.190) (-350.092) (-355.751) * [-351.110] (-350.006) (-349.947) (-349.977) -- 0:00:46
244000 -- (-350.901) (-348.069) (-351.342) [-350.538] * [-350.827] (-348.381) (-352.974) (-349.778) -- 0:00:46
244500 -- [-349.161] (-349.593) (-353.457) (-350.211) * (-350.092) [-348.545] (-350.521) (-350.773) -- 0:00:46
245000 -- [-349.401] (-350.230) (-353.547) (-349.746) * [-348.701] (-352.501) (-353.639) (-349.457) -- 0:00:46
Average standard deviation of split frequencies: 0.018036
245500 -- (-349.957) [-350.742] (-350.009) (-356.879) * (-349.399) (-354.811) (-350.357) [-350.896] -- 0:00:46
246000 -- (-349.739) (-349.332) (-349.659) [-350.823] * (-350.160) (-352.015) (-351.418) [-348.896] -- 0:00:45
246500 -- [-348.918] (-351.430) (-349.257) (-348.618) * (-348.867) (-350.117) (-348.666) [-348.130] -- 0:00:45
247000 -- [-351.015] (-349.796) (-350.206) (-351.839) * (-349.421) (-350.099) (-348.778) [-349.438] -- 0:00:45
247500 -- (-353.678) [-348.557] (-348.478) (-348.172) * (-348.766) [-349.822] (-349.988) (-351.333) -- 0:00:45
248000 -- (-351.345) (-349.163) (-348.447) [-352.202] * (-349.985) (-350.273) (-349.025) [-349.957] -- 0:00:45
248500 -- [-352.940] (-349.893) (-350.538) (-349.443) * (-350.934) (-350.071) (-351.202) [-348.392] -- 0:00:45
249000 -- [-349.933] (-349.843) (-350.467) (-348.826) * (-350.901) (-351.175) (-348.889) [-349.953] -- 0:00:45
249500 -- (-349.921) [-351.402] (-353.210) (-350.366) * (-348.417) (-349.639) [-348.937] (-352.976) -- 0:00:45
250000 -- [-348.279] (-350.692) (-351.112) (-349.765) * [-350.773] (-348.860) (-348.679) (-350.202) -- 0:00:45
Average standard deviation of split frequencies: 0.018253
250500 -- (-348.436) [-350.593] (-348.509) (-352.816) * (-350.295) (-349.502) (-353.309) [-349.866] -- 0:00:44
251000 -- (-350.106) [-350.427] (-351.983) (-351.420) * (-348.555) [-357.652] (-351.605) (-350.387) -- 0:00:44
251500 -- [-350.781] (-355.640) (-350.551) (-349.001) * (-352.514) (-352.431) (-350.303) [-350.379] -- 0:00:44
252000 -- (-351.258) [-351.687] (-349.379) (-350.148) * (-351.267) (-351.254) [-351.169] (-348.195) -- 0:00:44
252500 -- (-350.030) (-350.352) [-349.003] (-353.049) * (-348.455) (-351.165) [-351.836] (-350.129) -- 0:00:44
253000 -- [-352.757] (-352.959) (-349.927) (-349.159) * (-349.861) (-349.365) [-350.411] (-362.373) -- 0:00:44
253500 -- (-350.482) [-349.768] (-348.646) (-349.276) * (-352.371) (-352.777) [-350.450] (-353.198) -- 0:00:44
254000 -- (-351.587) (-350.221) (-350.741) [-350.358] * (-348.919) (-353.970) [-351.511] (-349.174) -- 0:00:44
254500 -- [-350.100] (-350.483) (-350.819) (-350.842) * (-349.683) [-351.010] (-352.862) (-348.772) -- 0:00:43
255000 -- (-351.277) (-350.134) (-349.087) [-349.937] * (-350.832) (-348.714) [-351.085] (-349.069) -- 0:00:43
Average standard deviation of split frequencies: 0.018107
255500 -- (-351.586) (-348.871) [-348.291] (-349.628) * [-349.235] (-350.211) (-350.868) (-349.722) -- 0:00:43
256000 -- [-348.612] (-353.111) (-349.954) (-357.025) * (-348.425) (-350.595) [-350.247] (-355.193) -- 0:00:43
256500 -- [-348.729] (-356.057) (-356.247) (-349.746) * (-356.012) [-351.316] (-348.207) (-350.355) -- 0:00:43
257000 -- (-348.729) (-348.868) (-351.003) [-350.800] * [-350.464] (-349.240) (-350.550) (-349.206) -- 0:00:43
257500 -- (-348.799) [-350.172] (-349.259) (-354.958) * [-350.206] (-354.815) (-348.289) (-352.785) -- 0:00:43
258000 -- (-349.995) (-350.830) [-350.580] (-353.154) * [-350.004] (-352.612) (-348.929) (-348.860) -- 0:00:43
258500 -- (-350.449) (-350.666) [-351.848] (-349.794) * (-348.773) (-351.157) (-349.135) [-348.739] -- 0:00:45
259000 -- (-350.773) [-349.601] (-350.434) (-349.951) * [-348.340] (-349.685) (-350.381) (-349.614) -- 0:00:45
259500 -- (-348.166) (-350.938) [-351.914] (-350.193) * [-351.010] (-350.843) (-349.786) (-348.564) -- 0:00:45
260000 -- (-355.905) (-350.123) (-353.105) [-348.826] * (-353.764) (-354.489) [-351.304] (-351.090) -- 0:00:45
Average standard deviation of split frequencies: 0.018297
260500 -- (-351.713) (-349.038) (-351.766) [-348.667] * (-350.500) [-350.446] (-348.749) (-353.579) -- 0:00:45
261000 -- (-349.787) (-350.946) (-351.028) [-348.709] * (-348.814) (-352.121) [-350.152] (-348.831) -- 0:00:45
261500 -- [-351.117] (-349.909) (-348.400) (-348.352) * [-348.115] (-352.511) (-348.488) (-350.521) -- 0:00:45
262000 -- (-355.055) (-348.058) [-348.838] (-351.933) * (-349.993) [-349.442] (-348.530) (-350.095) -- 0:00:45
262500 -- [-350.986] (-349.376) (-350.643) (-353.263) * [-349.302] (-351.353) (-348.484) (-351.507) -- 0:00:44
263000 -- (-353.309) [-351.552] (-351.655) (-352.200) * (-350.821) [-349.738] (-350.573) (-350.353) -- 0:00:44
263500 -- (-351.867) (-349.414) (-350.832) [-350.014] * (-351.567) (-348.774) [-349.487] (-351.964) -- 0:00:44
264000 -- (-351.466) [-350.372] (-350.713) (-350.868) * (-348.721) (-348.962) [-350.524] (-353.532) -- 0:00:44
264500 -- (-349.721) (-349.007) (-352.171) [-351.218] * (-348.140) [-351.548] (-350.281) (-348.196) -- 0:00:44
265000 -- (-353.780) [-351.262] (-353.448) (-351.100) * (-349.499) [-351.697] (-350.515) (-350.727) -- 0:00:44
Average standard deviation of split frequencies: 0.017535
265500 -- (-357.483) [-350.375] (-356.320) (-350.314) * (-349.916) [-354.138] (-353.202) (-349.497) -- 0:00:44
266000 -- (-351.578) (-351.374) (-352.131) [-352.343] * [-349.334] (-353.512) (-352.328) (-352.415) -- 0:00:44
266500 -- (-350.703) [-349.610] (-354.800) (-348.765) * (-348.199) (-351.442) (-349.324) [-348.473] -- 0:00:44
267000 -- [-350.533] (-350.875) (-349.777) (-349.051) * (-349.418) [-351.195] (-349.563) (-350.706) -- 0:00:43
267500 -- (-353.338) (-351.471) [-349.596] (-349.300) * (-353.018) (-349.354) (-350.864) [-350.956] -- 0:00:43
268000 -- [-350.164] (-351.132) (-349.724) (-351.679) * (-349.124) (-350.718) (-352.582) [-351.062] -- 0:00:43
268500 -- (-349.307) [-347.986] (-350.136) (-354.626) * (-349.550) (-349.466) (-348.711) [-352.345] -- 0:00:43
269000 -- (-350.226) [-350.131] (-349.399) (-350.611) * (-349.218) [-348.205] (-349.643) (-349.066) -- 0:00:43
269500 -- (-352.187) [-349.739] (-350.379) (-349.822) * (-351.916) [-349.218] (-351.051) (-350.456) -- 0:00:43
270000 -- (-348.713) [-356.375] (-349.190) (-350.700) * [-351.401] (-358.295) (-350.257) (-354.803) -- 0:00:43
Average standard deviation of split frequencies: 0.018578
270500 -- (-350.797) [-350.758] (-349.439) (-350.491) * (-348.295) [-357.884] (-349.011) (-350.831) -- 0:00:43
271000 -- (-348.511) [-353.206] (-350.787) (-349.965) * (-347.979) (-349.317) (-350.672) [-350.422] -- 0:00:43
271500 -- (-349.236) [-349.481] (-350.856) (-350.569) * (-349.479) (-349.399) (-352.234) [-350.118] -- 0:00:42
272000 -- (-350.716) (-349.121) (-350.864) [-350.285] * (-351.163) (-348.857) [-348.007] (-351.328) -- 0:00:42
272500 -- (-351.953) [-352.243] (-352.352) (-350.186) * (-352.720) (-350.396) [-349.448] (-353.692) -- 0:00:42
273000 -- [-348.396] (-349.318) (-350.368) (-349.222) * [-348.174] (-350.353) (-348.436) (-353.301) -- 0:00:42
273500 -- [-348.861] (-350.483) (-348.428) (-349.999) * (-350.151) (-350.183) (-350.869) [-358.275] -- 0:00:42
274000 -- [-350.947] (-348.337) (-349.506) (-353.914) * [-348.374] (-350.455) (-352.182) (-355.234) -- 0:00:42
274500 -- [-352.341] (-350.507) (-348.663) (-352.029) * [-348.311] (-350.387) (-350.307) (-350.907) -- 0:00:42
275000 -- [-348.889] (-350.648) (-348.429) (-351.710) * (-348.873) [-348.933] (-349.252) (-351.504) -- 0:00:42
Average standard deviation of split frequencies: 0.018608
275500 -- (-348.364) [-352.770] (-348.800) (-349.528) * (-350.987) (-354.132) [-348.539] (-358.403) -- 0:00:44
276000 -- (-348.952) [-356.689] (-350.744) (-349.210) * [-349.158] (-358.243) (-349.598) (-350.913) -- 0:00:44
276500 -- (-350.995) (-348.650) [-348.995] (-349.066) * (-349.534) [-356.887] (-350.321) (-348.128) -- 0:00:44
277000 -- (-349.955) (-349.985) (-349.735) [-350.135] * (-349.267) (-355.818) (-356.466) [-348.229] -- 0:00:44
277500 -- (-352.446) [-351.716] (-355.185) (-348.329) * (-350.624) (-350.747) [-355.518] (-349.050) -- 0:00:44
278000 -- (-352.674) (-348.465) (-351.047) [-348.498] * (-350.664) (-351.042) [-355.426] (-348.493) -- 0:00:44
278500 -- (-350.856) (-353.157) (-350.309) [-353.708] * (-350.348) (-354.376) (-350.012) [-351.724] -- 0:00:44
279000 -- (-350.801) (-352.129) [-351.866] (-353.747) * (-354.810) [-350.301] (-349.725) (-350.039) -- 0:00:43
279500 -- (-352.842) (-350.700) (-352.329) [-349.728] * [-350.663] (-350.318) (-349.732) (-350.249) -- 0:00:43
280000 -- (-349.037) [-347.999] (-355.298) (-351.206) * (-352.975) (-351.019) [-349.703] (-350.652) -- 0:00:43
Average standard deviation of split frequencies: 0.018569
280500 -- [-349.217] (-351.944) (-350.945) (-348.139) * (-350.847) [-352.434] (-354.566) (-350.327) -- 0:00:43
281000 -- [-349.875] (-355.387) (-352.634) (-348.237) * (-349.651) [-351.834] (-351.011) (-352.675) -- 0:00:43
281500 -- (-348.543) [-348.679] (-351.369) (-350.231) * (-350.417) (-352.264) (-348.787) [-349.640] -- 0:00:43
282000 -- (-348.344) (-348.649) (-350.671) [-350.173] * (-349.499) (-349.042) (-349.456) [-351.043] -- 0:00:43
282500 -- [-349.105] (-349.867) (-348.901) (-349.790) * (-349.229) [-348.989] (-349.761) (-350.580) -- 0:00:43
283000 -- (-351.043) (-353.738) [-349.423] (-351.986) * [-350.005] (-350.530) (-348.939) (-350.234) -- 0:00:43
283500 -- (-348.920) (-350.753) [-349.116] (-348.956) * (-348.996) (-350.006) [-349.179] (-355.483) -- 0:00:42
284000 -- (-349.947) (-350.749) (-348.707) [-351.752] * (-349.143) (-350.460) (-351.206) [-349.343] -- 0:00:42
284500 -- (-352.567) (-349.881) [-352.310] (-352.192) * (-350.108) (-352.476) [-350.962] (-349.541) -- 0:00:42
285000 -- (-351.835) (-349.454) [-352.514] (-351.375) * [-350.903] (-350.181) (-348.079) (-352.788) -- 0:00:42
Average standard deviation of split frequencies: 0.018497
285500 -- [-348.523] (-348.948) (-350.055) (-351.358) * [-349.449] (-350.888) (-348.117) (-351.766) -- 0:00:42
286000 -- (-349.383) [-349.547] (-351.455) (-350.702) * [-350.722] (-350.689) (-348.199) (-350.082) -- 0:00:42
286500 -- [-348.963] (-350.853) (-350.718) (-350.282) * (-350.791) (-348.986) [-349.123] (-354.516) -- 0:00:42
287000 -- (-348.665) [-349.314] (-349.695) (-354.522) * [-351.034] (-350.324) (-348.465) (-348.907) -- 0:00:42
287500 -- (-351.372) (-352.873) (-352.874) [-355.786] * (-354.572) (-349.762) (-348.353) [-349.368] -- 0:00:42
288000 -- [-347.917] (-351.134) (-350.334) (-348.838) * (-350.179) (-351.355) (-349.628) [-350.054] -- 0:00:42
288500 -- [-350.736] (-351.695) (-349.153) (-349.568) * (-349.642) (-348.504) (-348.168) [-350.879] -- 0:00:41
289000 -- [-351.289] (-349.745) (-350.071) (-350.582) * (-350.391) (-351.223) (-348.131) [-348.614] -- 0:00:41
289500 -- (-354.396) (-350.825) [-350.399] (-348.988) * (-349.189) [-354.945] (-350.658) (-350.515) -- 0:00:41
290000 -- [-352.957] (-354.048) (-348.914) (-349.887) * (-353.109) (-349.787) (-350.087) [-348.153] -- 0:00:41
Average standard deviation of split frequencies: 0.018508
290500 -- (-351.763) (-352.405) [-354.123] (-351.681) * (-348.520) [-352.116] (-354.981) (-350.742) -- 0:00:41
291000 -- (-351.685) (-348.727) [-349.633] (-349.165) * (-348.199) (-350.736) [-351.856] (-349.489) -- 0:00:41
291500 -- (-349.927) (-348.637) [-352.269] (-351.026) * (-350.316) (-354.645) [-351.381] (-350.147) -- 0:00:41
292000 -- (-353.899) (-350.509) [-350.005] (-350.488) * (-355.910) [-349.276] (-350.958) (-350.205) -- 0:00:41
292500 -- (-350.962) (-348.578) (-350.835) [-350.327] * (-349.128) (-350.140) [-349.296] (-349.263) -- 0:00:43
293000 -- (-351.988) (-349.928) (-349.082) [-348.690] * [-349.691] (-351.432) (-353.946) (-349.000) -- 0:00:43
293500 -- (-349.736) (-349.861) [-350.376] (-352.750) * (-349.792) [-349.788] (-350.461) (-351.555) -- 0:00:43
294000 -- (-348.170) [-349.778] (-352.074) (-351.729) * (-351.044) (-353.350) (-350.948) [-349.030] -- 0:00:43
294500 -- (-349.088) (-352.322) [-350.508] (-351.001) * (-352.941) [-350.093] (-349.068) (-350.282) -- 0:00:43
295000 -- (-348.566) [-348.604] (-353.538) (-352.908) * (-349.107) (-349.242) (-348.230) [-348.329] -- 0:00:43
Average standard deviation of split frequencies: 0.017430
295500 -- (-352.457) [-351.326] (-353.254) (-350.970) * (-348.650) (-350.615) (-350.813) [-348.485] -- 0:00:42
296000 -- (-351.408) (-351.156) [-350.851] (-351.176) * (-350.949) (-349.185) (-351.836) [-348.158] -- 0:00:42
296500 -- (-351.072) [-350.063] (-349.398) (-350.608) * (-351.174) [-348.993] (-350.013) (-348.980) -- 0:00:42
297000 -- (-353.491) (-349.473) (-349.625) [-349.934] * [-351.052] (-350.877) (-348.619) (-357.498) -- 0:00:42
297500 -- [-352.488] (-351.974) (-348.788) (-348.381) * (-349.802) (-349.151) (-348.758) [-348.631] -- 0:00:42
298000 -- [-349.165] (-352.821) (-348.005) (-349.047) * [-348.961] (-349.417) (-356.584) (-350.955) -- 0:00:42
298500 -- (-349.617) [-349.937] (-349.203) (-354.110) * (-350.809) [-352.696] (-351.373) (-349.888) -- 0:00:42
299000 -- [-349.645] (-354.481) (-349.363) (-348.641) * (-349.142) (-351.509) (-351.338) [-352.364] -- 0:00:42
299500 -- [-349.487] (-350.243) (-348.558) (-351.348) * [-351.382] (-350.722) (-349.572) (-352.057) -- 0:00:42
300000 -- (-350.476) [-349.100] (-349.980) (-348.381) * (-350.371) (-348.529) [-351.276] (-348.406) -- 0:00:42
Average standard deviation of split frequencies: 0.017062
300500 -- (-355.041) (-348.099) [-349.830] (-348.517) * (-353.041) (-352.119) (-354.031) [-348.531] -- 0:00:41
301000 -- (-351.802) (-348.944) (-348.418) [-350.756] * (-351.217) [-348.880] (-354.069) (-348.039) -- 0:00:41
301500 -- (-348.931) [-348.895] (-348.909) (-354.263) * (-354.431) (-351.188) [-352.203] (-348.562) -- 0:00:41
302000 -- (-350.341) [-350.742] (-351.520) (-354.205) * (-348.680) (-350.117) (-350.602) [-351.234] -- 0:00:41
302500 -- [-349.025] (-348.909) (-358.354) (-356.120) * (-348.829) [-353.309] (-351.062) (-350.155) -- 0:00:41
303000 -- [-354.177] (-351.754) (-350.589) (-351.455) * (-350.557) (-349.389) (-352.634) [-348.052] -- 0:00:41
303500 -- (-351.998) [-350.476] (-350.244) (-352.291) * (-349.852) [-349.042] (-351.325) (-352.058) -- 0:00:41
304000 -- (-350.239) [-348.240] (-348.296) (-357.585) * (-353.462) [-351.901] (-357.377) (-349.248) -- 0:00:41
304500 -- (-350.781) (-350.926) [-350.474] (-348.712) * [-350.588] (-359.517) (-356.119) (-349.361) -- 0:00:41
305000 -- (-349.726) (-351.659) [-351.439] (-349.151) * (-348.877) (-358.455) (-351.429) [-350.369] -- 0:00:41
Average standard deviation of split frequencies: 0.017374
305500 -- (-351.305) [-351.279] (-350.195) (-349.634) * (-348.973) (-353.594) [-350.297] (-352.829) -- 0:00:40
306000 -- (-350.952) (-350.784) [-351.067] (-351.849) * (-348.277) [-351.071] (-351.093) (-350.588) -- 0:00:40
306500 -- [-349.499] (-348.839) (-348.787) (-351.052) * (-351.840) (-351.091) [-352.153] (-352.935) -- 0:00:40
307000 -- (-350.791) (-350.462) (-348.547) [-350.377] * (-351.334) [-351.543] (-351.542) (-350.138) -- 0:00:40
307500 -- (-349.518) [-350.351] (-351.856) (-352.382) * (-350.038) (-348.816) [-348.254] (-351.006) -- 0:00:40
308000 -- (-348.965) (-353.472) (-349.234) [-351.952] * (-350.773) [-349.601] (-351.168) (-351.401) -- 0:00:40
308500 -- (-348.748) (-351.841) [-348.300] (-350.033) * (-349.242) (-349.807) [-350.020] (-350.106) -- 0:00:40
309000 -- [-348.732] (-349.284) (-348.229) (-349.558) * (-352.092) (-349.447) [-349.200] (-349.552) -- 0:00:40
309500 -- [-349.744] (-350.843) (-352.020) (-348.472) * (-352.871) (-349.040) (-351.508) [-351.765] -- 0:00:42
310000 -- [-352.835] (-350.845) (-349.760) (-350.060) * (-355.532) (-350.448) (-350.064) [-349.077] -- 0:00:42
Average standard deviation of split frequencies: 0.016438
310500 -- [-349.831] (-351.073) (-348.829) (-351.297) * (-350.051) (-354.662) [-350.154] (-349.622) -- 0:00:42
311000 -- (-358.742) (-349.957) [-349.340] (-352.147) * (-354.468) [-352.365] (-351.258) (-354.668) -- 0:00:42
311500 -- (-348.645) (-358.257) [-351.999] (-350.558) * (-352.391) (-350.256) (-349.912) [-351.552] -- 0:00:41
312000 -- (-350.309) (-354.931) (-350.148) [-349.300] * (-351.704) [-348.778] (-353.223) (-349.510) -- 0:00:41
312500 -- (-349.413) (-350.454) [-352.325] (-349.286) * (-354.482) (-352.075) (-351.710) [-349.887] -- 0:00:41
313000 -- (-348.909) [-349.722] (-350.828) (-349.730) * (-349.588) [-349.898] (-351.472) (-352.927) -- 0:00:41
313500 -- (-348.788) (-352.405) (-350.743) [-349.077] * [-348.700] (-351.368) (-351.535) (-350.648) -- 0:00:41
314000 -- [-349.901] (-353.282) (-349.275) (-348.512) * (-353.524) [-355.066] (-349.451) (-350.168) -- 0:00:41
314500 -- (-351.411) (-352.190) (-353.957) [-348.300] * (-350.131) (-351.919) [-349.814] (-353.159) -- 0:00:41
315000 -- [-352.910] (-350.969) (-348.571) (-349.884) * (-350.545) (-351.424) [-351.141] (-349.205) -- 0:00:41
Average standard deviation of split frequencies: 0.016907
315500 -- (-350.315) [-349.594] (-350.980) (-353.114) * (-351.348) (-350.011) (-351.102) [-350.248] -- 0:00:41
316000 -- (-350.585) [-348.710] (-349.252) (-358.369) * (-351.325) (-348.434) (-353.663) [-348.670] -- 0:00:41
316500 -- (-350.680) (-352.528) [-350.498] (-355.184) * (-350.648) (-350.857) [-351.930] (-348.342) -- 0:00:41
317000 -- [-350.130] (-349.665) (-348.489) (-349.649) * (-350.764) [-350.676] (-350.118) (-349.411) -- 0:00:40
317500 -- (-352.724) (-351.940) (-350.899) [-349.538] * [-354.350] (-350.620) (-349.976) (-348.515) -- 0:00:40
318000 -- [-350.485] (-349.819) (-348.709) (-349.623) * [-349.306] (-350.273) (-348.305) (-353.453) -- 0:00:40
318500 -- (-350.567) (-352.443) (-348.874) [-350.189] * [-349.720] (-348.935) (-350.000) (-349.931) -- 0:00:40
319000 -- [-351.063] (-352.358) (-356.813) (-349.923) * (-349.759) [-348.816] (-350.220) (-351.803) -- 0:00:40
319500 -- (-353.195) [-351.747] (-351.605) (-351.368) * (-348.844) [-348.532] (-348.987) (-351.809) -- 0:00:40
320000 -- (-349.564) [-350.534] (-353.916) (-353.223) * (-351.139) [-348.522] (-353.719) (-348.183) -- 0:00:40
Average standard deviation of split frequencies: 0.016603
320500 -- (-350.103) (-351.593) (-354.610) [-353.721] * [-349.314] (-349.461) (-348.738) (-349.074) -- 0:00:40
321000 -- [-349.952] (-355.082) (-350.698) (-351.099) * (-348.308) [-350.801] (-353.285) (-350.201) -- 0:00:40
321500 -- [-350.852] (-349.309) (-350.473) (-349.935) * (-348.844) [-351.820] (-349.499) (-348.747) -- 0:00:40
322000 -- [-350.970] (-353.808) (-349.874) (-350.413) * (-350.065) [-351.680] (-349.525) (-351.368) -- 0:00:40
322500 -- (-348.312) [-350.672] (-350.813) (-352.390) * (-349.263) (-353.419) [-348.644] (-353.949) -- 0:00:39
323000 -- (-350.040) (-349.778) (-353.120) [-348.850] * [-348.980] (-353.324) (-354.460) (-348.404) -- 0:00:39
323500 -- (-352.760) (-351.188) [-351.554] (-349.878) * (-348.770) (-349.444) [-349.266] (-350.969) -- 0:00:39
324000 -- (-349.901) (-348.557) (-350.669) [-350.014] * (-350.918) (-352.042) (-351.158) [-350.594] -- 0:00:39
324500 -- (-349.784) (-350.837) [-349.489] (-351.013) * (-349.698) (-350.712) (-350.530) [-349.141] -- 0:00:39
325000 -- (-349.011) (-351.531) [-348.304] (-354.039) * (-351.297) [-352.471] (-349.577) (-350.237) -- 0:00:39
Average standard deviation of split frequencies: 0.016710
325500 -- [-350.677] (-353.520) (-348.569) (-350.071) * (-350.066) (-348.819) (-350.780) [-352.084] -- 0:00:39
326000 -- (-350.435) [-349.377] (-348.624) (-354.061) * [-351.385] (-350.021) (-351.210) (-349.070) -- 0:00:39
326500 -- (-349.543) (-350.310) [-349.880] (-352.613) * (-348.209) (-348.523) (-353.685) [-351.639] -- 0:00:39
327000 -- [-352.120] (-354.242) (-348.169) (-351.546) * (-352.700) [-349.971] (-350.359) (-351.631) -- 0:00:41
327500 -- (-350.288) (-351.327) [-349.745] (-352.453) * [-349.502] (-351.065) (-351.058) (-350.823) -- 0:00:41
328000 -- (-349.590) [-351.416] (-350.135) (-350.717) * [-351.083] (-349.780) (-348.780) (-350.379) -- 0:00:40
328500 -- (-349.588) (-348.929) (-354.368) [-351.318] * (-351.383) [-352.954] (-350.231) (-349.974) -- 0:00:40
329000 -- (-348.716) (-349.476) [-352.952] (-351.819) * (-349.201) (-349.420) (-348.830) [-349.026] -- 0:00:40
329500 -- (-348.570) (-349.107) [-349.823] (-352.988) * (-350.859) (-352.610) [-349.191] (-351.061) -- 0:00:40
330000 -- (-348.524) (-349.752) [-353.653] (-350.373) * (-354.537) (-349.683) [-352.189] (-352.933) -- 0:00:40
Average standard deviation of split frequencies: 0.016437
330500 -- (-349.825) (-348.699) [-348.912] (-354.686) * (-348.261) (-355.410) [-348.921] (-350.947) -- 0:00:40
331000 -- (-349.250) [-348.130] (-349.291) (-349.499) * (-349.227) [-348.322] (-349.339) (-349.873) -- 0:00:40
331500 -- (-350.962) (-352.774) [-351.304] (-349.624) * (-351.016) (-349.369) [-349.421] (-349.924) -- 0:00:40
332000 -- [-349.663] (-356.420) (-348.809) (-357.639) * [-351.774] (-349.139) (-353.047) (-348.844) -- 0:00:40
332500 -- [-348.893] (-351.250) (-350.111) (-351.674) * (-348.731) (-351.063) (-352.521) [-349.725] -- 0:00:40
333000 -- (-349.475) [-351.717] (-348.942) (-350.522) * (-348.554) [-348.771] (-350.890) (-353.356) -- 0:00:40
333500 -- (-349.839) [-348.886] (-349.165) (-350.411) * [-352.589] (-350.626) (-348.931) (-352.118) -- 0:00:39
334000 -- [-349.359] (-350.973) (-349.929) (-356.392) * [-354.582] (-349.561) (-350.535) (-350.479) -- 0:00:39
334500 -- (-353.230) [-348.188] (-352.917) (-351.154) * (-352.471) [-352.630] (-353.664) (-352.718) -- 0:00:39
335000 -- (-352.628) (-352.751) [-348.702] (-349.240) * (-355.872) (-353.855) [-351.861] (-349.466) -- 0:00:39
Average standard deviation of split frequencies: 0.015511
335500 -- [-353.211] (-353.428) (-354.291) (-348.098) * (-349.381) (-351.090) (-348.879) [-349.781] -- 0:00:39
336000 -- (-354.830) (-349.217) (-349.584) [-351.200] * [-352.680] (-349.418) (-349.230) (-349.546) -- 0:00:39
336500 -- [-349.480] (-351.098) (-350.739) (-349.245) * [-358.084] (-354.356) (-350.163) (-348.870) -- 0:00:39
337000 -- (-350.710) [-349.553] (-353.734) (-352.261) * (-349.742) (-351.532) (-355.861) [-349.062] -- 0:00:39
337500 -- (-349.932) [-349.088] (-350.032) (-350.124) * (-353.746) (-354.900) [-352.722] (-351.250) -- 0:00:39
338000 -- [-351.275] (-348.913) (-351.725) (-348.146) * (-353.097) (-354.623) (-350.349) [-348.703] -- 0:00:39
338500 -- (-350.362) [-349.947] (-348.451) (-348.564) * (-348.931) (-353.200) [-354.738] (-350.055) -- 0:00:39
339000 -- [-350.766] (-351.953) (-348.530) (-350.479) * (-349.088) (-351.573) (-352.098) [-349.405] -- 0:00:38
339500 -- (-351.184) (-349.580) [-348.607] (-351.818) * [-348.847] (-350.433) (-351.943) (-347.986) -- 0:00:38
340000 -- (-349.016) (-349.689) [-348.807] (-349.494) * (-350.720) (-355.980) (-354.209) [-349.053] -- 0:00:38
Average standard deviation of split frequencies: 0.016442
340500 -- (-354.092) [-350.560] (-349.912) (-349.737) * [-351.879] (-353.514) (-351.141) (-349.016) -- 0:00:38
341000 -- (-349.613) (-353.586) [-348.250] (-349.831) * [-349.944] (-348.670) (-353.408) (-352.466) -- 0:00:38
341500 -- (-349.834) (-349.765) [-348.289] (-348.475) * [-348.183] (-350.247) (-348.473) (-351.694) -- 0:00:38
342000 -- (-348.995) (-351.024) [-351.319] (-348.596) * (-351.457) (-351.054) (-349.817) [-351.516] -- 0:00:38
342500 -- (-349.151) [-352.271] (-350.323) (-349.047) * (-352.292) (-348.577) (-352.737) [-349.235] -- 0:00:38
343000 -- (-348.211) [-352.245] (-349.628) (-349.378) * (-349.878) (-350.009) (-352.476) [-350.822] -- 0:00:38
343500 -- (-349.326) (-350.017) [-348.813] (-350.724) * (-349.070) (-350.015) (-352.054) [-348.414] -- 0:00:38
344000 -- [-351.690] (-351.579) (-349.424) (-349.269) * (-349.961) (-349.731) (-350.704) [-349.001] -- 0:00:40
344500 -- [-350.679] (-349.512) (-348.148) (-352.326) * [-348.738] (-355.316) (-352.849) (-352.461) -- 0:00:39
345000 -- (-350.112) (-348.878) [-350.119] (-350.913) * (-348.771) [-348.274] (-349.120) (-351.999) -- 0:00:39
Average standard deviation of split frequencies: 0.015441
345500 -- [-350.018] (-358.167) (-350.254) (-351.004) * (-349.776) [-352.085] (-352.452) (-349.693) -- 0:00:39
346000 -- (-349.115) [-351.527] (-351.064) (-353.108) * (-350.885) (-352.026) (-351.644) [-349.424] -- 0:00:39
346500 -- (-351.379) (-352.908) (-352.542) [-349.419] * (-351.247) [-351.308] (-350.339) (-349.702) -- 0:00:39
347000 -- (-352.802) (-351.142) [-352.776] (-350.585) * [-351.237] (-350.135) (-352.625) (-348.902) -- 0:00:39
347500 -- (-350.968) (-350.147) [-352.275] (-350.318) * (-350.855) [-351.253] (-349.655) (-352.151) -- 0:00:39
348000 -- (-351.050) [-349.154] (-355.015) (-350.338) * (-352.344) [-349.517] (-349.241) (-352.862) -- 0:00:39
348500 -- (-348.868) (-351.520) (-353.709) [-349.355] * (-348.754) (-350.047) [-348.999] (-350.688) -- 0:00:39
349000 -- [-348.097] (-348.813) (-352.773) (-350.014) * (-350.182) (-349.499) [-349.729] (-351.312) -- 0:00:39
349500 -- [-350.486] (-348.543) (-352.380) (-350.883) * (-348.339) (-348.662) [-349.692] (-358.323) -- 0:00:39
350000 -- (-354.527) [-349.767] (-349.418) (-349.435) * (-349.535) [-351.908] (-351.560) (-351.457) -- 0:00:39
Average standard deviation of split frequencies: 0.015086
350500 -- (-353.678) (-350.498) [-348.411] (-349.239) * (-352.209) [-349.291] (-348.867) (-349.357) -- 0:00:38
351000 -- (-348.283) (-351.001) (-348.614) [-349.195] * (-349.220) (-350.656) [-349.751] (-349.925) -- 0:00:38
351500 -- [-350.677] (-350.215) (-349.855) (-349.740) * (-348.933) (-351.771) (-352.750) [-350.305] -- 0:00:38
352000 -- [-349.785] (-349.130) (-351.089) (-349.877) * (-351.171) (-348.776) (-352.065) [-349.335] -- 0:00:38
352500 -- (-350.774) (-349.792) (-350.218) [-348.271] * (-351.833) [-350.581] (-351.061) (-349.502) -- 0:00:38
353000 -- (-350.543) (-349.202) (-351.928) [-348.312] * (-353.817) (-354.332) (-349.055) [-349.363] -- 0:00:38
353500 -- [-352.327] (-354.521) (-353.120) (-348.373) * [-349.556] (-352.547) (-348.065) (-350.512) -- 0:00:38
354000 -- (-356.083) (-353.183) [-348.344] (-349.248) * (-350.691) (-351.289) (-349.877) [-350.905] -- 0:00:38
354500 -- (-349.881) (-350.480) (-349.098) [-348.169] * (-348.890) (-349.448) (-350.365) [-349.091] -- 0:00:38
355000 -- [-350.414] (-349.834) (-352.100) (-351.172) * (-352.572) (-352.185) (-351.157) [-348.661] -- 0:00:38
Average standard deviation of split frequencies: 0.015669
355500 -- (-351.740) [-348.609] (-352.781) (-349.125) * (-352.869) (-351.426) (-350.764) [-350.649] -- 0:00:38
356000 -- (-348.645) [-349.301] (-351.532) (-351.586) * (-348.588) (-353.362) [-349.476] (-350.598) -- 0:00:37
356500 -- [-348.919] (-349.951) (-351.004) (-350.203) * [-350.124] (-348.489) (-350.847) (-350.268) -- 0:00:37
357000 -- (-348.196) (-350.077) (-349.993) [-348.365] * (-352.255) [-349.700] (-350.795) (-350.648) -- 0:00:37
357500 -- (-348.129) [-351.791] (-352.365) (-349.074) * (-353.031) [-348.971] (-352.812) (-350.364) -- 0:00:37
358000 -- (-350.188) [-349.826] (-351.369) (-349.671) * (-354.190) (-352.695) (-354.684) [-349.182] -- 0:00:37
358500 -- [-350.046] (-349.174) (-354.832) (-350.856) * (-349.218) (-350.602) (-347.977) [-350.493] -- 0:00:37
359000 -- [-350.039] (-349.535) (-350.134) (-350.815) * (-348.414) (-352.022) [-349.322] (-348.467) -- 0:00:37
359500 -- (-351.868) [-349.802] (-351.207) (-348.690) * (-349.439) [-348.257] (-351.927) (-348.820) -- 0:00:37
360000 -- (-348.110) (-350.091) (-349.888) [-350.218] * (-348.636) [-348.458] (-353.254) (-355.764) -- 0:00:37
Average standard deviation of split frequencies: 0.016069
360500 -- (-348.304) (-352.038) [-348.018] (-350.080) * (-348.607) [-348.706] (-351.138) (-352.208) -- 0:00:37
361000 -- (-348.851) (-348.735) (-350.620) [-352.170] * (-351.405) [-349.615] (-352.322) (-349.391) -- 0:00:37
361500 -- (-353.052) (-348.769) (-352.059) [-352.747] * (-350.176) [-348.582] (-350.942) (-349.464) -- 0:00:38
362000 -- [-352.334] (-355.662) (-352.908) (-349.793) * (-349.412) (-349.325) (-354.957) [-354.006] -- 0:00:38
362500 -- (-351.500) [-351.851] (-352.587) (-348.941) * (-349.733) (-350.152) (-350.171) [-349.031] -- 0:00:38
363000 -- (-348.421) [-350.460] (-353.459) (-348.842) * (-349.089) [-350.583] (-348.305) (-348.850) -- 0:00:38
363500 -- (-350.452) (-350.545) [-352.521] (-349.440) * (-351.434) [-350.408] (-348.655) (-348.635) -- 0:00:38
364000 -- (-352.266) [-348.396] (-348.922) (-350.075) * (-349.727) (-349.752) (-352.431) [-349.142] -- 0:00:38
364500 -- [-353.120] (-356.130) (-350.650) (-349.680) * [-348.876] (-348.738) (-350.929) (-349.082) -- 0:00:38
365000 -- [-348.893] (-355.675) (-351.075) (-348.714) * (-349.359) (-350.270) [-349.833] (-349.029) -- 0:00:38
Average standard deviation of split frequencies: 0.016820
365500 -- (-350.793) [-353.660] (-350.947) (-349.030) * (-350.388) (-349.960) [-349.898] (-348.956) -- 0:00:38
366000 -- [-349.880] (-351.845) (-350.421) (-351.328) * (-351.081) [-348.501] (-352.975) (-348.310) -- 0:00:38
366500 -- [-351.003] (-349.760) (-351.455) (-348.927) * (-348.465) [-348.875] (-353.388) (-351.183) -- 0:00:38
367000 -- (-350.759) (-351.148) (-350.481) [-348.954] * [-350.679] (-349.232) (-352.104) (-350.196) -- 0:00:37
367500 -- [-351.242] (-349.214) (-353.959) (-350.284) * (-351.923) [-350.088] (-350.512) (-348.569) -- 0:00:37
368000 -- (-353.303) (-348.965) (-350.181) [-351.576] * (-349.626) [-350.101] (-349.482) (-350.377) -- 0:00:37
368500 -- [-352.577] (-351.985) (-351.939) (-349.537) * [-348.809] (-349.312) (-353.758) (-352.050) -- 0:00:37
369000 -- (-350.100) (-349.437) (-349.425) [-349.506] * (-349.289) [-349.046] (-351.266) (-351.466) -- 0:00:37
369500 -- (-354.229) (-350.163) [-350.550] (-350.548) * [-349.816] (-354.015) (-350.084) (-358.038) -- 0:00:37
370000 -- (-350.948) (-349.985) (-351.126) [-348.861] * (-350.491) (-351.536) [-348.205] (-352.072) -- 0:00:37
Average standard deviation of split frequencies: 0.017487
370500 -- (-352.244) (-352.612) [-349.175] (-349.599) * [-352.192] (-350.342) (-351.777) (-351.884) -- 0:00:37
371000 -- [-348.668] (-352.119) (-348.647) (-349.759) * [-350.462] (-348.997) (-349.712) (-350.699) -- 0:00:37
371500 -- (-352.674) (-349.822) (-349.295) [-348.186] * (-350.107) (-349.052) (-348.835) [-350.391] -- 0:00:37
372000 -- (-357.865) (-351.290) (-348.506) [-349.434] * (-354.977) (-351.282) [-350.071] (-349.297) -- 0:00:37
372500 -- (-353.508) [-349.167] (-348.952) (-348.637) * (-350.171) (-352.359) [-350.969] (-349.023) -- 0:00:37
373000 -- (-354.455) (-353.879) (-348.004) [-349.003] * (-353.534) (-350.977) (-349.845) [-350.262] -- 0:00:36
373500 -- (-350.818) [-349.622] (-349.591) (-350.709) * (-352.566) (-349.937) [-349.182] (-351.518) -- 0:00:36
374000 -- (-350.894) [-350.288] (-350.894) (-352.154) * (-349.004) (-350.073) (-348.107) [-350.971] -- 0:00:36
374500 -- [-348.656] (-352.076) (-349.344) (-349.387) * (-354.205) [-348.633] (-348.415) (-353.004) -- 0:00:36
375000 -- (-351.099) (-358.138) [-349.040] (-351.230) * (-349.504) (-350.826) (-348.544) [-350.391] -- 0:00:36
Average standard deviation of split frequencies: 0.015635
375500 -- (-349.663) (-350.201) (-349.796) [-351.010] * [-348.862] (-349.556) (-349.130) (-353.698) -- 0:00:36
376000 -- (-354.078) [-350.860] (-349.594) (-349.110) * (-348.349) (-350.571) [-349.722] (-355.820) -- 0:00:36
376500 -- (-352.900) (-350.468) [-350.996] (-352.302) * [-348.329] (-349.127) (-351.006) (-350.250) -- 0:00:36
377000 -- (-349.442) (-353.317) (-349.852) [-351.651] * (-350.285) [-353.965] (-350.402) (-351.138) -- 0:00:36
377500 -- (-349.748) [-350.048] (-351.194) (-349.836) * (-352.699) [-349.130] (-352.435) (-348.310) -- 0:00:36
378000 -- [-348.920] (-352.376) (-348.360) (-356.744) * (-351.695) (-348.351) [-348.741] (-352.311) -- 0:00:36
378500 -- [-351.036] (-352.455) (-349.792) (-349.530) * (-351.087) (-349.768) [-352.549] (-351.929) -- 0:00:37
379000 -- (-351.253) (-354.335) [-352.468] (-349.006) * [-348.956] (-348.451) (-354.381) (-350.408) -- 0:00:37
379500 -- (-349.006) (-353.315) [-351.244] (-349.289) * (-352.913) (-349.385) [-352.540] (-349.124) -- 0:00:37
380000 -- [-349.587] (-349.275) (-354.339) (-350.385) * (-352.160) (-352.671) [-353.692] (-350.439) -- 0:00:37
Average standard deviation of split frequencies: 0.017569
380500 -- (-348.041) (-352.389) (-349.993) [-348.627] * (-349.990) (-353.782) [-351.889] (-347.944) -- 0:00:37
381000 -- (-348.272) [-354.620] (-353.338) (-350.266) * (-350.670) [-351.608] (-349.547) (-349.781) -- 0:00:37
381500 -- (-349.150) (-348.897) [-351.680] (-349.461) * (-350.863) (-351.805) [-351.210] (-351.385) -- 0:00:37
382000 -- (-349.255) (-354.419) [-349.937] (-351.402) * (-351.749) (-353.360) [-354.079] (-349.622) -- 0:00:37
382500 -- (-353.137) (-350.005) [-351.581] (-351.106) * (-350.941) (-354.853) (-352.361) [-349.864] -- 0:00:37
383000 -- (-351.798) [-352.396] (-348.442) (-349.192) * (-354.221) (-350.721) [-349.854] (-348.294) -- 0:00:37
383500 -- (-349.220) (-350.594) [-348.616] (-348.457) * (-350.352) (-349.925) (-351.598) [-350.404] -- 0:00:36
384000 -- [-352.168] (-348.737) (-351.411) (-351.103) * (-350.090) (-349.942) (-349.084) [-348.762] -- 0:00:36
384500 -- (-348.758) (-351.389) [-350.578] (-348.827) * (-352.155) (-352.431) [-349.952] (-349.667) -- 0:00:36
385000 -- [-349.536] (-350.166) (-349.132) (-351.885) * (-352.375) (-357.946) [-348.807] (-351.382) -- 0:00:36
Average standard deviation of split frequencies: 0.016411
385500 -- (-348.938) (-351.762) (-352.303) [-348.714] * (-349.013) [-351.965] (-348.956) (-356.371) -- 0:00:36
386000 -- [-349.137] (-348.881) (-350.844) (-353.949) * (-348.124) [-353.636] (-348.064) (-351.491) -- 0:00:36
386500 -- (-351.227) [-353.249] (-350.239) (-349.854) * [-348.894] (-349.992) (-357.028) (-349.005) -- 0:00:36
387000 -- (-350.814) (-349.463) [-354.878] (-350.622) * [-348.500] (-349.097) (-349.817) (-348.995) -- 0:00:36
387500 -- (-350.448) (-349.818) (-350.930) [-350.024] * [-350.251] (-351.003) (-354.401) (-349.810) -- 0:00:36
388000 -- (-351.160) (-348.864) (-350.807) [-349.621] * [-349.390] (-353.604) (-353.504) (-350.213) -- 0:00:36
388500 -- (-350.783) [-350.797] (-350.357) (-355.811) * [-351.117] (-349.559) (-351.825) (-351.040) -- 0:00:36
389000 -- (-352.289) (-353.436) (-350.543) [-348.914] * (-352.388) (-350.013) (-349.453) [-349.032] -- 0:00:36
389500 -- [-349.011] (-349.831) (-352.094) (-349.064) * (-348.954) (-354.034) (-350.458) [-352.103] -- 0:00:36
390000 -- (-349.423) (-349.540) (-349.342) [-349.147] * (-350.992) (-350.960) [-349.002] (-348.516) -- 0:00:35
Average standard deviation of split frequencies: 0.016592
390500 -- (-349.805) [-348.242] (-349.238) (-350.731) * [-350.748] (-349.568) (-350.034) (-349.014) -- 0:00:35
391000 -- [-349.228] (-348.369) (-349.354) (-351.890) * (-349.307) (-352.297) (-351.037) [-349.748] -- 0:00:35
391500 -- (-353.270) (-348.818) [-348.452] (-351.177) * (-349.498) (-348.861) (-356.122) [-349.934] -- 0:00:35
392000 -- [-349.351] (-349.609) (-350.274) (-350.536) * (-349.544) [-349.391] (-351.506) (-348.523) -- 0:00:35
392500 -- [-349.228] (-349.039) (-348.361) (-351.335) * (-349.000) (-350.443) [-349.078] (-350.001) -- 0:00:35
393000 -- (-348.398) (-349.892) [-349.946] (-350.216) * (-348.883) (-348.455) [-349.584] (-350.185) -- 0:00:35
393500 -- (-349.744) (-350.600) (-350.071) [-352.347] * (-349.188) (-348.207) [-348.675] (-350.126) -- 0:00:35
394000 -- (-349.736) (-353.899) [-351.264] (-353.234) * [-351.081] (-348.785) (-355.019) (-349.883) -- 0:00:35
394500 -- (-352.621) [-348.324] (-349.054) (-352.094) * (-350.547) [-349.704] (-348.072) (-349.447) -- 0:00:35
395000 -- [-348.589] (-348.997) (-353.883) (-352.159) * [-348.609] (-350.208) (-349.512) (-350.332) -- 0:00:35
Average standard deviation of split frequencies: 0.016443
395500 -- (-348.647) (-349.191) [-350.245] (-350.105) * (-351.410) (-349.914) [-348.300] (-351.432) -- 0:00:35
396000 -- (-348.972) (-350.326) (-348.136) [-349.101] * (-349.687) (-352.034) [-349.736] (-352.278) -- 0:00:36
396500 -- (-349.585) (-353.258) (-349.373) [-350.276] * (-355.190) [-350.297] (-348.576) (-350.725) -- 0:00:36
397000 -- (-349.892) (-349.125) (-350.781) [-350.538] * (-355.372) (-353.091) [-349.145] (-348.449) -- 0:00:36
397500 -- [-348.463] (-350.468) (-348.379) (-353.130) * [-350.943] (-351.523) (-349.082) (-352.250) -- 0:00:36
398000 -- (-349.241) [-349.692] (-348.130) (-350.726) * (-350.405) [-349.465] (-350.842) (-352.006) -- 0:00:36
398500 -- (-351.221) (-352.548) [-348.836] (-350.584) * (-348.378) (-350.035) [-350.095] (-349.053) -- 0:00:36
399000 -- [-350.365] (-349.170) (-349.292) (-353.751) * (-349.197) (-352.307) [-348.924] (-349.849) -- 0:00:36
399500 -- (-354.454) (-351.503) [-348.271] (-349.199) * (-348.277) (-350.800) (-350.886) [-350.507] -- 0:00:36
400000 -- (-350.248) (-352.815) (-349.745) [-349.827] * (-352.794) (-350.014) (-349.303) [-349.807] -- 0:00:36
Average standard deviation of split frequencies: 0.015589
400500 -- [-348.927] (-351.584) (-348.873) (-354.682) * (-351.763) (-349.618) [-351.284] (-350.703) -- 0:00:35
401000 -- [-348.759] (-355.022) (-349.576) (-352.842) * [-350.544] (-349.221) (-356.118) (-350.229) -- 0:00:35
401500 -- (-350.375) [-348.807] (-349.609) (-352.237) * (-351.299) (-348.602) (-351.756) [-350.197] -- 0:00:35
402000 -- (-349.190) [-349.633] (-351.504) (-350.453) * [-349.727] (-350.080) (-350.655) (-351.917) -- 0:00:35
402500 -- (-348.979) [-350.047] (-348.886) (-351.941) * (-348.732) [-351.800] (-350.380) (-350.078) -- 0:00:35
403000 -- (-349.720) [-353.268] (-351.066) (-349.021) * [-348.514] (-351.108) (-352.933) (-350.563) -- 0:00:35
403500 -- [-350.679] (-349.382) (-348.938) (-350.012) * (-350.029) [-351.375] (-353.273) (-350.062) -- 0:00:35
404000 -- [-350.145] (-351.203) (-348.774) (-351.034) * [-349.979] (-350.095) (-348.755) (-351.595) -- 0:00:35
404500 -- (-354.020) (-349.010) [-349.208] (-348.204) * (-349.151) (-352.129) [-355.591] (-349.614) -- 0:00:35
405000 -- (-350.411) (-352.370) [-352.621] (-350.053) * (-348.466) (-350.352) (-350.199) [-350.360] -- 0:00:35
Average standard deviation of split frequencies: 0.015167
405500 -- (-349.751) (-350.907) [-349.579] (-353.349) * (-351.941) [-349.155] (-354.951) (-354.030) -- 0:00:35
406000 -- [-350.753] (-349.674) (-348.393) (-348.962) * (-349.353) [-348.659] (-350.118) (-349.453) -- 0:00:35
406500 -- (-348.946) [-348.099] (-350.029) (-351.472) * [-351.222] (-348.563) (-348.975) (-355.009) -- 0:00:35
407000 -- (-348.327) (-349.822) (-351.095) [-352.358] * (-354.776) (-352.247) (-349.828) [-353.771] -- 0:00:34
407500 -- [-349.170] (-350.221) (-349.892) (-352.632) * (-352.562) (-350.417) (-348.958) [-350.694] -- 0:00:34
408000 -- (-348.505) (-348.366) (-351.888) [-348.403] * (-354.694) (-350.950) (-350.324) [-349.357] -- 0:00:34
408500 -- (-351.151) [-348.216] (-349.980) (-350.483) * (-352.200) (-356.306) [-352.164] (-350.235) -- 0:00:34
409000 -- (-352.364) (-348.754) [-349.886] (-350.721) * (-351.122) (-357.580) [-350.227] (-353.782) -- 0:00:34
409500 -- [-353.735] (-350.237) (-349.704) (-349.349) * (-349.822) (-350.454) [-350.247] (-350.550) -- 0:00:34
410000 -- (-350.521) [-351.537] (-352.704) (-349.014) * (-348.208) (-349.463) [-349.758] (-349.974) -- 0:00:34
Average standard deviation of split frequencies: 0.014277
410500 -- (-352.132) (-350.544) (-352.482) [-350.851] * (-348.513) (-349.797) [-348.698] (-350.552) -- 0:00:34
411000 -- (-353.018) (-356.068) (-350.040) [-354.847] * [-349.576] (-350.336) (-348.157) (-347.999) -- 0:00:34
411500 -- (-348.967) [-353.668] (-349.723) (-353.646) * (-348.778) (-352.304) [-348.741] (-350.364) -- 0:00:34
412000 -- (-351.343) [-350.688] (-348.860) (-350.387) * (-349.055) (-351.551) [-348.662] (-351.073) -- 0:00:34
412500 -- (-351.375) (-351.071) [-350.478] (-350.403) * (-349.496) [-348.968] (-351.829) (-350.587) -- 0:00:35
413000 -- (-351.253) [-352.840] (-352.153) (-349.402) * (-349.568) (-349.226) [-350.382] (-350.480) -- 0:00:35
413500 -- (-351.607) [-351.309] (-348.913) (-351.101) * (-349.004) (-352.899) (-348.472) [-355.380] -- 0:00:35
414000 -- (-353.139) [-349.263] (-351.142) (-349.849) * (-350.154) (-349.792) (-348.404) [-349.785] -- 0:00:35
414500 -- (-348.680) (-356.029) [-349.310] (-350.837) * (-351.121) (-348.107) [-351.488] (-349.382) -- 0:00:35
415000 -- (-350.573) [-351.368] (-349.965) (-353.671) * (-349.579) (-348.864) [-349.336] (-351.209) -- 0:00:35
Average standard deviation of split frequencies: 0.013332
415500 -- [-350.433] (-352.270) (-353.474) (-349.648) * (-350.622) (-348.924) [-349.317] (-351.355) -- 0:00:35
416000 -- [-349.274] (-349.377) (-351.426) (-350.267) * (-353.871) (-351.341) (-352.261) [-349.590] -- 0:00:35
416500 -- (-348.619) (-349.777) (-354.965) [-350.063] * (-349.763) [-355.511] (-355.110) (-349.991) -- 0:00:35
417000 -- (-349.671) [-348.740] (-349.212) (-348.646) * [-350.754] (-352.757) (-349.601) (-349.837) -- 0:00:34
417500 -- (-350.084) (-351.236) [-349.426] (-348.092) * (-351.270) (-351.059) [-352.957] (-348.727) -- 0:00:34
418000 -- (-350.198) (-348.684) (-349.389) [-348.854] * (-353.594) (-349.451) [-351.637] (-353.540) -- 0:00:34
418500 -- (-351.038) (-348.193) [-348.501] (-348.506) * (-349.175) (-351.806) (-350.494) [-350.617] -- 0:00:34
419000 -- [-350.505] (-349.677) (-350.931) (-351.194) * (-351.641) [-352.452] (-349.945) (-354.608) -- 0:00:34
419500 -- [-350.163] (-350.100) (-349.762) (-349.050) * (-348.913) (-347.978) (-350.293) [-351.586] -- 0:00:34
420000 -- (-349.608) [-349.283] (-352.752) (-349.788) * [-348.984] (-349.394) (-349.871) (-353.309) -- 0:00:34
Average standard deviation of split frequencies: 0.013517
420500 -- (-351.649) (-350.814) [-351.062] (-353.137) * [-348.458] (-348.448) (-353.553) (-350.681) -- 0:00:34
421000 -- (-352.577) (-348.767) (-358.735) [-352.979] * (-348.915) (-349.722) (-350.205) [-350.098] -- 0:00:34
421500 -- (-351.594) [-353.605] (-354.193) (-350.558) * [-350.785] (-349.924) (-349.291) (-350.290) -- 0:00:34
422000 -- (-352.932) (-348.616) (-352.886) [-348.357] * (-348.907) (-349.165) [-349.217] (-352.031) -- 0:00:34
422500 -- [-351.617] (-350.169) (-354.523) (-348.143) * [-351.389] (-351.296) (-351.365) (-351.848) -- 0:00:34
423000 -- (-349.602) (-350.562) (-349.009) [-349.357] * (-351.994) [-351.189] (-352.861) (-351.857) -- 0:00:34
423500 -- (-349.700) [-351.172] (-349.848) (-350.460) * (-355.773) (-353.047) [-351.212] (-351.961) -- 0:00:34
424000 -- (-350.955) (-350.184) (-351.530) [-350.357] * (-355.554) (-349.276) [-349.756] (-350.957) -- 0:00:33
424500 -- [-350.286] (-349.692) (-348.618) (-349.446) * (-354.519) [-353.383] (-351.738) (-349.408) -- 0:00:33
425000 -- (-355.258) [-349.974] (-348.640) (-349.832) * (-352.325) (-349.131) (-355.399) [-348.765] -- 0:00:33
Average standard deviation of split frequencies: 0.013210
425500 -- (-351.841) [-348.758] (-348.536) (-349.380) * (-351.483) [-352.233] (-354.011) (-348.878) -- 0:00:33
426000 -- (-353.959) [-350.718] (-349.880) (-348.914) * (-350.449) (-354.857) [-350.718] (-353.280) -- 0:00:33
426500 -- (-350.561) (-348.568) (-348.046) [-349.625] * [-350.655] (-352.755) (-350.014) (-352.378) -- 0:00:33
427000 -- (-351.953) (-349.250) (-348.773) [-349.368] * (-348.962) (-348.845) (-348.532) [-352.746] -- 0:00:33
427500 -- (-350.283) (-349.362) [-348.670] (-352.598) * (-350.935) (-348.502) [-348.989] (-349.162) -- 0:00:33
428000 -- (-349.924) [-350.796] (-348.009) (-357.064) * (-349.182) [-348.366] (-351.859) (-348.284) -- 0:00:33
428500 -- (-351.178) (-352.064) (-352.488) [-349.507] * [-350.325] (-353.480) (-353.551) (-350.139) -- 0:00:33
429000 -- (-353.280) (-355.205) [-349.394] (-349.208) * (-358.726) (-355.498) [-348.462] (-349.259) -- 0:00:34
429500 -- (-348.934) (-353.995) [-350.072] (-352.350) * [-353.142] (-349.356) (-348.096) (-352.663) -- 0:00:34
430000 -- (-349.602) (-352.602) (-351.939) [-351.078] * (-353.461) [-352.256] (-350.072) (-350.791) -- 0:00:34
Average standard deviation of split frequencies: 0.012793
430500 -- (-347.824) (-351.422) (-351.149) [-350.713] * (-355.586) (-348.975) [-350.691] (-349.848) -- 0:00:34
431000 -- (-349.616) [-350.856] (-348.632) (-355.362) * (-349.392) (-352.137) [-348.774] (-351.455) -- 0:00:34
431500 -- (-354.863) [-349.958] (-354.407) (-349.480) * [-348.984] (-349.101) (-350.271) (-351.102) -- 0:00:34
432000 -- (-353.549) (-349.519) (-350.064) [-348.815] * (-348.518) [-348.632] (-348.747) (-348.664) -- 0:00:34
432500 -- (-352.918) (-349.760) (-349.431) [-349.326] * [-349.113] (-348.647) (-353.291) (-349.638) -- 0:00:34
433000 -- (-348.414) (-350.860) (-349.295) [-349.396] * (-349.428) (-348.315) (-350.025) [-351.103] -- 0:00:34
433500 -- (-349.626) (-348.512) (-348.430) [-354.415] * (-350.647) (-351.185) [-348.726] (-348.743) -- 0:00:33
434000 -- (-349.810) [-349.994] (-348.952) (-353.190) * (-350.851) (-349.361) (-351.568) [-349.115] -- 0:00:33
434500 -- (-349.720) (-351.770) [-348.976] (-349.751) * (-348.436) (-348.701) [-350.916] (-351.339) -- 0:00:33
435000 -- [-353.230] (-349.051) (-351.801) (-351.392) * (-352.537) [-349.554] (-349.855) (-353.097) -- 0:00:33
Average standard deviation of split frequencies: 0.012434
435500 -- (-356.645) (-352.999) (-350.865) [-349.674] * (-353.898) (-349.910) [-348.592] (-348.827) -- 0:00:33
436000 -- [-349.256] (-350.353) (-348.588) (-349.688) * (-354.544) (-348.199) [-349.411] (-351.043) -- 0:00:33
436500 -- (-352.140) [-350.447] (-353.688) (-348.507) * (-354.978) (-348.252) [-348.004] (-350.495) -- 0:00:33
437000 -- (-352.393) (-354.838) (-348.786) [-350.668] * (-356.101) (-348.356) (-352.018) [-350.725] -- 0:00:33
437500 -- (-349.012) (-348.125) (-349.870) [-350.761] * (-348.263) [-352.672] (-348.548) (-352.711) -- 0:00:33
438000 -- (-348.700) (-350.521) [-351.783] (-349.186) * (-352.059) (-353.517) [-353.694] (-354.844) -- 0:00:33
438500 -- (-351.211) (-350.180) (-351.822) [-350.808] * (-352.682) (-351.237) (-350.565) [-350.889] -- 0:00:33
439000 -- (-349.046) [-349.371] (-349.861) (-349.701) * (-350.949) (-353.718) [-349.172] (-349.008) -- 0:00:33
439500 -- (-353.158) (-349.922) (-349.592) [-348.853] * (-351.053) (-352.965) (-352.733) [-350.523] -- 0:00:33
440000 -- (-355.078) [-352.002] (-351.078) (-353.560) * (-352.074) (-351.379) [-350.753] (-348.889) -- 0:00:33
Average standard deviation of split frequencies: 0.012302
440500 -- (-350.968) [-350.651] (-350.454) (-352.229) * (-350.096) [-350.608] (-349.927) (-350.842) -- 0:00:33
441000 -- (-350.188) (-352.360) (-349.459) [-347.943] * (-355.078) [-349.159] (-352.423) (-349.794) -- 0:00:32
441500 -- [-350.284] (-348.878) (-350.067) (-350.913) * (-353.750) (-349.223) [-349.220] (-351.704) -- 0:00:32
442000 -- [-351.174] (-350.473) (-351.878) (-348.677) * (-352.956) [-348.262] (-348.868) (-349.833) -- 0:00:32
442500 -- [-348.229] (-348.853) (-351.338) (-348.634) * (-350.118) [-348.535] (-349.990) (-351.538) -- 0:00:32
443000 -- (-348.404) (-349.276) (-350.192) [-348.491] * (-349.000) (-352.333) [-350.805] (-349.906) -- 0:00:32
443500 -- [-348.941] (-348.647) (-349.480) (-352.110) * [-349.748] (-350.374) (-349.105) (-352.832) -- 0:00:32
444000 -- (-349.120) (-348.304) [-350.843] (-350.715) * (-348.203) (-351.820) (-349.883) [-351.496] -- 0:00:32
444500 -- [-349.997] (-351.906) (-348.736) (-349.691) * [-351.619] (-348.849) (-349.351) (-349.547) -- 0:00:32
445000 -- (-348.363) (-348.382) (-350.234) [-348.446] * (-351.844) [-349.986] (-349.196) (-348.707) -- 0:00:33
Average standard deviation of split frequencies: 0.011164
445500 -- (-349.294) (-349.878) [-349.809] (-348.746) * (-350.939) [-348.851] (-350.039) (-351.984) -- 0:00:33
446000 -- (-349.828) (-352.379) (-352.709) [-348.339] * (-350.625) [-350.668] (-352.168) (-355.358) -- 0:00:33
446500 -- [-349.176] (-351.694) (-353.315) (-348.680) * [-351.589] (-350.731) (-350.162) (-350.537) -- 0:00:33
447000 -- (-348.598) [-349.165] (-353.080) (-359.023) * (-348.440) [-348.241] (-348.921) (-350.042) -- 0:00:33
447500 -- (-349.171) (-353.789) [-353.655] (-353.200) * (-353.692) (-353.035) (-350.961) [-347.856] -- 0:00:33
448000 -- [-352.366] (-354.513) (-353.974) (-349.576) * [-351.198] (-352.878) (-349.396) (-349.104) -- 0:00:33
448500 -- (-348.348) [-350.063] (-349.150) (-351.865) * [-350.116] (-348.164) (-350.284) (-348.581) -- 0:00:33
449000 -- (-353.075) (-351.406) [-350.204] (-353.929) * (-351.834) (-350.516) [-348.154] (-351.957) -- 0:00:33
449500 -- (-351.896) [-349.948] (-350.169) (-351.941) * [-354.274] (-352.030) (-351.855) (-353.218) -- 0:00:33
450000 -- (-353.066) (-348.527) [-348.189] (-353.912) * [-349.477] (-352.409) (-350.331) (-356.800) -- 0:00:33
Average standard deviation of split frequencies: 0.011375
450500 -- (-348.882) (-350.800) [-349.001] (-349.501) * (-352.196) (-353.171) [-348.677] (-350.181) -- 0:00:32
451000 -- (-350.461) (-349.433) (-349.025) [-349.244] * (-352.844) [-348.841] (-348.663) (-349.125) -- 0:00:32
451500 -- (-351.691) (-348.625) (-351.921) [-349.244] * (-350.699) [-354.002] (-349.574) (-351.271) -- 0:00:32
452000 -- (-351.292) (-349.663) (-354.128) [-353.316] * [-350.304] (-348.908) (-350.305) (-354.436) -- 0:00:32
452500 -- [-348.775] (-349.245) (-349.834) (-349.629) * [-354.036] (-350.884) (-349.678) (-360.070) -- 0:00:32
453000 -- (-348.782) (-350.466) [-349.951] (-350.097) * (-350.312) (-351.820) [-347.893] (-349.726) -- 0:00:32
453500 -- (-355.354) (-356.741) [-349.170] (-351.012) * (-351.783) (-350.215) [-350.422] (-350.875) -- 0:00:32
454000 -- (-350.369) [-350.527] (-349.965) (-351.558) * (-349.308) [-348.188] (-353.336) (-348.964) -- 0:00:32
454500 -- (-350.623) [-349.736] (-350.051) (-349.010) * (-351.540) (-351.711) [-350.842] (-350.372) -- 0:00:32
455000 -- (-350.111) [-352.204] (-349.674) (-350.806) * (-349.232) (-352.075) [-353.544] (-351.429) -- 0:00:32
Average standard deviation of split frequencies: 0.011178
455500 -- [-351.339] (-353.518) (-353.598) (-350.258) * (-349.798) [-353.251] (-351.355) (-350.868) -- 0:00:32
456000 -- (-353.532) (-348.292) (-349.506) [-350.171] * (-349.211) (-349.143) [-350.834] (-348.297) -- 0:00:32
456500 -- (-356.064) (-348.981) (-350.286) [-351.206] * (-350.850) [-348.345] (-351.380) (-348.690) -- 0:00:32
457000 -- (-349.307) (-350.388) [-350.974] (-348.515) * (-351.534) [-349.539] (-348.919) (-349.283) -- 0:00:32
457500 -- (-349.502) (-349.033) (-349.367) [-348.940] * (-350.242) (-351.902) [-352.917] (-349.276) -- 0:00:32
458000 -- (-348.543) [-349.634] (-349.427) (-349.965) * [-351.287] (-351.644) (-350.756) (-349.945) -- 0:00:31
458500 -- [-348.900] (-348.526) (-349.447) (-350.132) * (-349.816) [-352.954] (-350.446) (-353.816) -- 0:00:31
459000 -- [-351.442] (-350.373) (-350.134) (-349.516) * (-351.973) (-351.707) (-348.430) [-348.334] -- 0:00:31
459500 -- (-349.835) [-348.256] (-354.196) (-350.942) * (-349.481) (-352.430) (-349.990) [-350.391] -- 0:00:31
460000 -- [-349.146] (-349.058) (-349.650) (-348.731) * (-349.765) (-350.098) (-348.953) [-353.658] -- 0:00:31
Average standard deviation of split frequencies: 0.011001
460500 -- (-349.175) [-348.321] (-350.409) (-350.700) * [-349.742] (-355.008) (-349.395) (-350.001) -- 0:00:31
461000 -- (-351.053) [-349.022] (-349.498) (-350.687) * (-351.432) [-348.386] (-350.104) (-350.688) -- 0:00:31
461500 -- (-355.665) (-353.228) (-350.653) [-349.654] * (-352.059) (-352.551) [-351.788] (-353.790) -- 0:00:32
462000 -- [-352.852] (-348.833) (-357.560) (-351.426) * (-350.636) [-350.166] (-348.237) (-350.687) -- 0:00:32
462500 -- (-349.415) (-348.990) [-348.970] (-350.546) * (-353.463) (-351.240) [-352.192] (-350.716) -- 0:00:32
463000 -- (-352.801) [-349.182] (-354.779) (-350.411) * (-349.924) (-352.398) (-348.641) [-349.046] -- 0:00:32
463500 -- (-348.339) [-350.261] (-354.055) (-350.006) * [-349.869] (-354.393) (-350.329) (-349.423) -- 0:00:32
464000 -- (-352.240) (-348.764) [-352.662] (-350.783) * (-350.731) [-349.851] (-348.343) (-348.993) -- 0:00:32
464500 -- (-348.345) (-352.353) [-351.286] (-348.507) * (-350.292) (-349.535) (-351.354) [-350.059] -- 0:00:32
465000 -- (-348.228) (-348.677) (-350.514) [-349.450] * (-350.071) [-352.060] (-355.491) (-351.398) -- 0:00:32
Average standard deviation of split frequencies: 0.010056
465500 -- (-348.574) (-350.612) [-349.904] (-349.407) * [-351.274] (-348.048) (-351.478) (-351.531) -- 0:00:32
466000 -- (-351.768) [-351.591] (-351.442) (-348.454) * [-350.769] (-349.039) (-351.301) (-351.161) -- 0:00:32
466500 -- [-349.908] (-348.655) (-349.301) (-348.756) * (-349.572) [-350.190] (-352.946) (-353.156) -- 0:00:32
467000 -- (-349.615) (-350.499) [-349.951] (-350.991) * (-349.083) (-349.729) (-352.749) [-352.647] -- 0:00:31
467500 -- (-349.406) (-350.973) (-350.487) [-351.005] * [-348.272] (-348.954) (-349.911) (-352.322) -- 0:00:31
468000 -- [-351.112] (-349.884) (-352.405) (-349.158) * (-348.805) [-349.190] (-348.727) (-354.453) -- 0:00:31
468500 -- (-357.048) (-353.917) [-348.285] (-350.082) * [-350.813] (-351.329) (-349.966) (-351.013) -- 0:00:31
469000 -- (-353.729) [-350.946] (-350.155) (-349.103) * (-351.280) (-349.503) (-351.038) [-349.237] -- 0:00:31
469500 -- (-350.737) (-349.950) [-349.194] (-356.084) * (-350.276) (-353.148) [-349.301] (-349.603) -- 0:00:31
470000 -- [-349.465] (-353.846) (-348.202) (-349.938) * [-348.709] (-355.787) (-350.785) (-349.269) -- 0:00:31
Average standard deviation of split frequencies: 0.010454
470500 -- (-350.594) [-350.753] (-348.255) (-354.545) * (-350.655) [-351.348] (-352.330) (-348.190) -- 0:00:31
471000 -- (-349.244) (-350.528) (-348.249) [-355.051] * (-350.720) [-349.303] (-352.004) (-348.290) -- 0:00:31
471500 -- (-351.213) [-349.010] (-349.728) (-349.347) * (-350.208) (-349.238) (-351.015) [-348.992] -- 0:00:31
472000 -- (-351.030) (-350.144) (-351.279) [-350.947] * (-350.154) [-350.838] (-350.485) (-349.434) -- 0:00:31
472500 -- [-350.077] (-350.485) (-348.045) (-350.995) * (-349.535) (-350.536) [-349.327] (-349.888) -- 0:00:31
473000 -- [-350.923] (-350.654) (-348.842) (-349.118) * (-348.825) [-350.871] (-354.244) (-350.990) -- 0:00:31
473500 -- [-350.539] (-350.670) (-348.523) (-349.487) * (-352.255) [-352.580] (-351.552) (-352.981) -- 0:00:31
474000 -- (-350.631) (-352.983) (-350.215) [-350.955] * [-348.474] (-350.168) (-349.870) (-349.443) -- 0:00:31
474500 -- (-351.976) (-356.098) (-350.660) [-350.046] * (-352.709) (-352.573) (-349.939) [-351.866] -- 0:00:31
475000 -- (-352.510) (-349.959) (-348.890) [-350.889] * (-350.352) [-351.421] (-350.518) (-349.073) -- 0:00:30
Average standard deviation of split frequencies: 0.011079
475500 -- (-354.188) [-349.610] (-348.380) (-348.105) * (-352.013) [-350.977] (-350.455) (-355.010) -- 0:00:30
476000 -- (-351.909) (-350.873) (-348.825) [-350.905] * [-349.741] (-349.801) (-354.187) (-350.917) -- 0:00:30
476500 -- [-351.412] (-349.300) (-354.514) (-355.587) * (-349.547) (-351.245) (-351.968) [-353.014] -- 0:00:30
477000 -- (-352.679) [-352.162] (-348.823) (-354.280) * (-349.598) (-350.692) [-349.117] (-351.326) -- 0:00:30
477500 -- (-351.126) [-349.145] (-351.350) (-356.410) * (-350.452) [-348.649] (-351.062) (-348.642) -- 0:00:30
478000 -- (-352.863) (-353.602) [-350.522] (-357.322) * (-349.680) (-350.469) [-348.921] (-348.606) -- 0:00:30
478500 -- [-349.968] (-348.275) (-349.658) (-348.899) * (-351.190) (-353.251) [-350.474] (-351.197) -- 0:00:31
479000 -- (-351.224) (-348.167) [-348.787] (-351.014) * (-349.869) (-352.190) (-350.355) [-351.927] -- 0:00:31
479500 -- (-357.082) (-350.353) [-351.759] (-350.639) * (-352.372) (-349.058) [-351.028] (-351.685) -- 0:00:31
480000 -- (-350.170) [-351.978] (-349.490) (-350.380) * (-348.556) (-350.860) (-350.387) [-348.434] -- 0:00:31
Average standard deviation of split frequencies: 0.010615
480500 -- (-350.715) (-350.960) [-348.974] (-351.179) * [-354.975] (-349.442) (-352.457) (-349.997) -- 0:00:31
481000 -- (-349.298) [-350.204] (-349.697) (-351.578) * (-349.889) (-349.284) [-350.388] (-359.202) -- 0:00:31
481500 -- (-353.482) (-349.840) [-351.193] (-351.824) * [-351.912] (-348.882) (-349.707) (-361.251) -- 0:00:31
482000 -- (-351.111) (-355.355) (-355.765) [-350.464] * (-352.536) (-348.563) [-348.371] (-349.193) -- 0:00:31
482500 -- (-350.257) (-353.836) [-348.644] (-351.628) * (-351.060) (-348.661) [-349.387] (-350.885) -- 0:00:31
483000 -- (-348.361) (-349.368) (-353.216) [-348.987] * (-355.884) [-349.138] (-351.354) (-348.571) -- 0:00:31
483500 -- (-351.593) (-350.142) (-348.268) [-349.918] * [-350.576] (-349.317) (-351.886) (-348.199) -- 0:00:30
484000 -- (-352.186) (-350.571) [-352.879] (-347.942) * (-350.468) (-348.668) [-349.334] (-349.280) -- 0:00:30
484500 -- (-352.361) (-350.210) [-355.036] (-349.472) * (-348.808) (-354.423) (-349.850) [-349.175] -- 0:00:30
485000 -- (-348.242) (-351.016) [-350.512] (-351.958) * [-349.998] (-350.383) (-350.721) (-352.837) -- 0:00:30
Average standard deviation of split frequencies: 0.010454
485500 -- (-359.237) (-351.624) [-348.936] (-351.964) * (-349.853) (-348.561) [-350.046] (-350.830) -- 0:00:30
486000 -- (-354.470) [-348.889] (-349.607) (-351.424) * (-354.617) (-351.195) (-351.853) [-348.651] -- 0:00:30
486500 -- (-348.637) [-349.663] (-352.261) (-353.649) * (-348.941) (-351.894) (-353.102) [-351.454] -- 0:00:30
487000 -- (-351.251) [-349.911] (-350.352) (-349.834) * (-352.109) (-350.278) [-351.795] (-351.256) -- 0:00:30
487500 -- (-349.861) (-348.654) [-349.684] (-348.872) * (-350.461) [-348.806] (-352.807) (-349.675) -- 0:00:30
488000 -- (-349.582) (-350.940) (-350.318) [-348.764] * (-350.715) [-348.973] (-349.224) (-353.859) -- 0:00:30
488500 -- [-350.297] (-353.365) (-349.171) (-351.474) * (-352.285) (-350.565) [-350.148] (-350.213) -- 0:00:30
489000 -- (-351.515) (-350.672) (-350.563) [-349.062] * [-348.355] (-349.694) (-350.216) (-348.773) -- 0:00:30
489500 -- (-353.130) (-354.096) (-349.753) [-348.611] * (-351.531) (-349.106) (-352.809) [-350.016] -- 0:00:30
490000 -- (-350.730) [-350.144] (-349.704) (-349.069) * (-354.614) (-352.586) [-350.503] (-348.301) -- 0:00:30
Average standard deviation of split frequencies: 0.010988
490500 -- [-353.825] (-351.220) (-349.405) (-350.908) * (-350.435) (-352.595) (-348.194) [-348.900] -- 0:00:30
491000 -- (-351.362) (-352.853) (-351.664) [-349.142] * (-349.534) (-353.642) (-349.718) [-350.099] -- 0:00:30
491500 -- [-349.266] (-348.892) (-348.592) (-350.248) * (-349.151) [-350.688] (-349.884) (-350.576) -- 0:00:30
492000 -- [-348.856] (-349.844) (-349.741) (-348.349) * [-349.610] (-350.829) (-349.299) (-349.901) -- 0:00:29
492500 -- (-350.194) (-349.264) [-348.237] (-348.349) * (-349.644) (-354.026) (-349.866) [-350.052] -- 0:00:29
493000 -- (-350.690) [-350.352] (-353.332) (-351.553) * [-350.274] (-352.106) (-354.166) (-348.459) -- 0:00:29
493500 -- (-348.560) (-354.819) [-350.857] (-349.903) * [-349.029] (-348.698) (-349.899) (-351.004) -- 0:00:29
494000 -- (-349.239) (-349.334) [-348.826] (-350.864) * (-348.414) (-348.510) (-350.273) [-349.658] -- 0:00:29
494500 -- [-351.011] (-348.481) (-350.674) (-351.329) * (-349.308) (-351.178) (-350.356) [-349.612] -- 0:00:29
495000 -- (-348.395) (-353.275) (-351.799) [-352.293] * [-349.197] (-349.228) (-351.456) (-348.304) -- 0:00:29
Average standard deviation of split frequencies: 0.010989
495500 -- (-356.206) (-348.966) (-348.476) [-351.328] * (-350.181) [-353.349] (-351.581) (-353.355) -- 0:00:30
496000 -- [-349.351] (-347.970) (-349.525) (-349.498) * (-349.521) (-349.038) (-352.059) [-352.476] -- 0:00:30
496500 -- (-349.003) (-353.931) [-350.116] (-348.983) * (-350.204) (-349.466) [-349.264] (-350.967) -- 0:00:30
497000 -- (-350.539) [-349.913] (-348.988) (-348.212) * [-349.597] (-350.852) (-348.429) (-350.867) -- 0:00:30
497500 -- (-353.856) (-348.974) (-351.436) [-349.093] * (-350.259) [-353.761] (-348.384) (-349.415) -- 0:00:30
498000 -- (-353.627) [-351.406] (-349.084) (-348.871) * (-349.708) (-354.802) [-349.410] (-350.875) -- 0:00:30
498500 -- (-353.233) (-349.049) [-349.012] (-350.283) * [-348.662] (-352.005) (-361.230) (-351.155) -- 0:00:30
499000 -- (-351.523) (-351.467) [-349.562] (-353.654) * (-348.858) [-348.745] (-351.220) (-348.784) -- 0:00:30
499500 -- (-354.706) [-351.582] (-348.419) (-352.136) * (-348.514) [-350.896] (-350.703) (-352.418) -- 0:00:30
500000 -- (-350.984) [-348.546] (-348.556) (-353.345) * (-350.433) (-350.904) [-348.822] (-352.236) -- 0:00:30
Average standard deviation of split frequencies: 0.010181
500500 -- (-352.666) (-353.300) [-349.914] (-352.347) * (-348.598) [-349.263] (-349.017) (-348.039) -- 0:00:29
501000 -- (-354.354) (-353.814) [-350.421] (-348.524) * (-350.260) (-349.223) [-349.869] (-350.554) -- 0:00:29
501500 -- [-356.636] (-351.426) (-351.909) (-349.449) * [-351.211] (-348.520) (-357.655) (-351.177) -- 0:00:29
502000 -- (-348.160) (-349.686) [-349.705] (-351.683) * (-351.768) [-350.596] (-349.790) (-351.080) -- 0:00:29
502500 -- (-350.505) (-349.764) (-349.325) [-350.436] * (-352.672) (-348.975) (-351.389) [-350.897] -- 0:00:29
503000 -- [-350.432] (-348.948) (-350.966) (-349.855) * [-349.375] (-354.625) (-352.728) (-354.946) -- 0:00:29
503500 -- (-348.577) (-349.617) (-350.365) [-348.709] * (-350.748) [-350.115] (-353.232) (-351.422) -- 0:00:29
504000 -- (-348.766) [-351.720] (-349.495) (-349.246) * (-351.720) (-351.410) [-349.431] (-351.906) -- 0:00:29
504500 -- [-349.368] (-352.466) (-349.287) (-351.306) * (-349.496) (-352.003) [-351.581] (-352.950) -- 0:00:29
505000 -- (-350.038) (-353.094) [-349.878] (-352.115) * [-352.094] (-352.789) (-349.256) (-349.820) -- 0:00:29
Average standard deviation of split frequencies: 0.009782
505500 -- (-348.323) (-349.287) (-348.478) [-349.918] * (-358.932) (-349.973) [-354.950] (-351.529) -- 0:00:29
506000 -- (-352.127) [-350.451] (-351.752) (-351.548) * [-348.534] (-350.669) (-348.943) (-348.893) -- 0:00:29
506500 -- (-350.968) [-353.082] (-348.635) (-349.820) * (-348.366) [-350.110] (-349.999) (-351.665) -- 0:00:29
507000 -- (-349.634) [-348.151] (-350.328) (-349.356) * (-350.651) (-349.114) [-350.777] (-352.299) -- 0:00:29
507500 -- (-349.587) (-350.090) (-356.520) [-351.555] * (-350.666) (-351.921) [-349.764] (-351.062) -- 0:00:29
508000 -- [-349.556] (-351.600) (-353.279) (-351.443) * (-353.824) (-351.919) [-348.944] (-351.361) -- 0:00:29
508500 -- (-351.296) (-351.538) [-350.100] (-350.731) * (-348.120) [-349.054] (-353.363) (-351.860) -- 0:00:28
509000 -- (-349.249) (-349.385) (-349.784) [-353.434] * (-349.152) (-350.054) (-351.617) [-350.473] -- 0:00:28
509500 -- (-348.449) (-350.241) [-349.991] (-350.506) * (-351.808) (-353.827) [-349.395] (-351.221) -- 0:00:28
510000 -- (-351.335) (-350.415) [-351.433] (-350.717) * (-352.070) [-351.035] (-350.073) (-350.171) -- 0:00:28
Average standard deviation of split frequencies: 0.009231
510500 -- (-350.097) (-349.306) [-349.677] (-350.961) * (-351.809) [-352.801] (-348.728) (-351.157) -- 0:00:28
511000 -- (-349.033) (-350.304) (-352.509) [-348.621] * (-349.050) (-350.096) (-349.161) [-350.871] -- 0:00:28
511500 -- (-351.456) [-348.728] (-348.446) (-348.735) * [-348.888] (-352.216) (-350.048) (-350.945) -- 0:00:28
512000 -- (-351.247) (-349.555) (-349.547) [-352.518] * (-349.233) (-353.441) (-349.686) [-349.885] -- 0:00:28
512500 -- [-349.503] (-351.234) (-349.941) (-352.732) * (-352.186) (-349.242) (-348.884) [-350.383] -- 0:00:29
513000 -- [-350.324] (-352.009) (-349.312) (-352.974) * [-349.613] (-348.714) (-349.038) (-352.125) -- 0:00:29
513500 -- (-350.281) [-349.355] (-351.581) (-350.540) * (-353.105) (-351.446) (-349.356) [-351.751] -- 0:00:29
514000 -- (-349.591) [-351.154] (-349.483) (-349.345) * (-350.439) (-350.014) [-350.046] (-356.512) -- 0:00:29
514500 -- (-349.818) [-349.954] (-348.610) (-353.504) * [-350.096] (-351.263) (-348.755) (-353.285) -- 0:00:29
515000 -- (-349.315) (-350.501) (-348.257) [-349.379] * (-354.436) [-349.754] (-349.716) (-349.706) -- 0:00:29
Average standard deviation of split frequencies: 0.009193
515500 -- [-349.768] (-349.636) (-350.885) (-348.251) * (-350.275) [-349.176] (-352.968) (-353.324) -- 0:00:29
516000 -- [-349.162] (-351.542) (-349.790) (-348.705) * [-350.085] (-349.336) (-352.283) (-352.173) -- 0:00:29
516500 -- (-350.232) (-351.213) (-349.724) [-350.448] * (-349.199) [-350.086] (-349.360) (-348.680) -- 0:00:29
517000 -- (-354.390) (-352.622) (-349.709) [-349.186] * (-349.978) [-348.592] (-350.080) (-349.384) -- 0:00:28
517500 -- (-353.940) (-353.448) (-349.921) [-348.972] * (-350.402) (-347.828) [-348.628] (-349.110) -- 0:00:28
518000 -- (-350.782) [-353.429] (-349.811) (-349.856) * (-351.707) [-349.239] (-348.778) (-348.715) -- 0:00:28
518500 -- (-353.906) (-350.301) [-353.314] (-351.490) * (-352.928) [-349.545] (-351.879) (-352.621) -- 0:00:28
519000 -- (-348.238) (-351.099) [-350.513] (-349.846) * (-353.615) (-350.498) (-350.650) [-350.620] -- 0:00:28
519500 -- (-350.209) (-353.222) (-351.539) [-348.934] * (-349.005) (-350.645) (-351.062) [-350.987] -- 0:00:28
520000 -- (-349.134) (-350.646) (-349.762) [-348.417] * [-349.222] (-350.855) (-349.951) (-351.990) -- 0:00:28
Average standard deviation of split frequencies: 0.009235
520500 -- (-349.765) [-352.858] (-356.657) (-348.990) * [-349.477] (-352.309) (-351.563) (-348.781) -- 0:00:28
521000 -- [-350.532] (-349.031) (-352.176) (-352.981) * [-349.347] (-353.498) (-352.103) (-348.841) -- 0:00:28
521500 -- (-350.396) (-353.527) [-352.063] (-351.546) * (-349.546) [-352.156] (-349.263) (-348.762) -- 0:00:28
522000 -- [-350.479] (-349.655) (-352.387) (-349.025) * (-351.490) (-350.168) [-351.403] (-353.040) -- 0:00:28
522500 -- (-349.201) (-349.097) (-351.527) [-349.166] * (-348.048) (-348.732) (-350.144) [-349.110] -- 0:00:28
523000 -- (-350.449) (-350.512) [-352.622] (-349.522) * (-348.915) (-350.520) [-350.753] (-349.652) -- 0:00:28
523500 -- [-353.733] (-349.683) (-352.586) (-351.245) * [-348.546] (-348.487) (-348.682) (-350.495) -- 0:00:28
524000 -- (-348.768) (-351.823) (-350.310) [-349.032] * (-350.039) [-350.681] (-349.321) (-351.665) -- 0:00:28
524500 -- [-349.053] (-350.334) (-351.755) (-348.118) * (-348.665) [-348.364] (-350.380) (-352.138) -- 0:00:28
525000 -- (-349.297) [-351.908] (-350.020) (-351.639) * (-349.683) [-351.186] (-349.913) (-351.670) -- 0:00:28
Average standard deviation of split frequencies: 0.008906
525500 -- (-351.516) [-353.806] (-351.142) (-354.520) * (-352.496) (-352.073) [-349.287] (-355.457) -- 0:00:27
526000 -- (-349.864) (-354.251) (-349.634) [-351.421] * (-348.265) (-351.113) [-348.262] (-352.001) -- 0:00:27
526500 -- (-350.617) (-352.971) (-350.938) [-349.955] * [-351.928] (-349.156) (-348.416) (-350.603) -- 0:00:27
527000 -- (-351.280) (-350.574) [-349.776] (-348.780) * (-350.890) (-349.456) (-350.913) [-350.455] -- 0:00:27
527500 -- (-352.068) (-349.001) [-349.692] (-349.451) * [-356.170] (-350.202) (-350.538) (-348.251) -- 0:00:27
528000 -- (-352.981) [-350.363] (-353.746) (-349.738) * (-353.514) (-349.217) (-351.957) [-348.543] -- 0:00:27
528500 -- (-352.989) [-350.509] (-349.651) (-350.196) * (-348.867) (-349.627) (-348.899) [-351.011] -- 0:00:27
529000 -- (-349.742) (-349.020) [-352.078] (-350.807) * (-348.988) (-348.952) (-349.999) [-351.449] -- 0:00:27
529500 -- [-352.014] (-349.629) (-353.233) (-349.172) * [-349.613] (-349.636) (-347.988) (-348.455) -- 0:00:28
530000 -- (-351.343) [-349.236] (-349.590) (-351.504) * (-354.611) [-350.029] (-349.273) (-349.846) -- 0:00:28
Average standard deviation of split frequencies: 0.008883
530500 -- (-349.433) [-350.528] (-350.581) (-349.111) * (-354.081) [-349.689] (-349.617) (-351.351) -- 0:00:28
531000 -- (-352.134) [-356.167] (-352.899) (-349.185) * (-348.534) [-348.516] (-349.887) (-349.412) -- 0:00:28
531500 -- (-348.779) (-353.281) [-352.928] (-349.089) * (-350.534) (-349.236) (-351.718) [-350.555] -- 0:00:28
532000 -- [-348.901] (-350.108) (-350.794) (-348.373) * (-352.439) (-351.428) (-352.804) [-349.522] -- 0:00:28
532500 -- (-350.086) (-350.177) (-348.767) [-349.094] * (-349.523) (-352.222) (-349.605) [-349.396] -- 0:00:28
533000 -- (-353.100) (-351.724) [-351.278] (-354.793) * (-351.975) (-351.990) [-349.306] (-350.674) -- 0:00:28
533500 -- (-354.217) (-349.733) (-348.903) [-356.015] * (-351.224) (-350.256) (-349.560) [-349.057] -- 0:00:27
534000 -- (-350.315) [-349.936] (-348.546) (-349.300) * (-351.404) (-348.287) [-349.168] (-349.923) -- 0:00:27
534500 -- (-352.400) (-349.525) (-352.164) [-349.849] * [-350.284] (-351.403) (-350.873) (-349.718) -- 0:00:27
535000 -- (-354.474) (-348.953) (-349.643) [-354.059] * (-349.711) (-349.695) [-349.338] (-352.595) -- 0:00:27
Average standard deviation of split frequencies: 0.008795
535500 -- [-349.087] (-348.776) (-353.879) (-351.763) * (-349.038) (-350.367) (-348.557) [-349.135] -- 0:00:27
536000 -- (-349.372) (-350.437) (-353.199) [-349.291] * (-348.843) (-352.673) [-352.609] (-350.583) -- 0:00:27
536500 -- (-353.517) (-351.475) [-352.957] (-350.051) * (-355.920) [-350.243] (-348.717) (-350.018) -- 0:00:27
537000 -- (-355.667) (-351.475) (-354.110) [-349.365] * (-353.444) (-350.269) [-349.983] (-350.496) -- 0:00:27
537500 -- (-353.553) (-352.633) [-351.281] (-354.499) * [-350.057] (-349.074) (-349.669) (-352.987) -- 0:00:27
538000 -- [-350.514] (-356.663) (-349.079) (-350.139) * [-350.199] (-351.181) (-351.001) (-356.503) -- 0:00:27
538500 -- [-349.647] (-351.192) (-348.699) (-349.503) * (-350.459) [-349.049] (-352.168) (-349.744) -- 0:00:27
539000 -- (-350.077) (-352.525) [-349.945] (-351.556) * (-350.163) (-352.557) [-349.140] (-353.063) -- 0:00:27
539500 -- (-349.341) (-351.300) (-349.826) [-350.647] * [-349.285] (-349.382) (-348.749) (-358.467) -- 0:00:27
540000 -- (-349.509) [-348.938] (-351.071) (-350.368) * (-350.085) [-352.228] (-348.783) (-350.037) -- 0:00:27
Average standard deviation of split frequencies: 0.009591
540500 -- (-348.523) (-348.675) [-348.289] (-353.569) * (-353.941) (-350.393) (-348.560) [-349.270] -- 0:00:27
541000 -- (-348.753) (-351.335) [-350.363] (-350.340) * [-355.526] (-351.971) (-352.318) (-349.695) -- 0:00:27
541500 -- (-348.952) (-351.705) (-353.715) [-349.604] * (-353.451) (-351.177) (-349.891) [-348.458] -- 0:00:27
542000 -- (-350.693) (-351.741) (-349.617) [-348.761] * (-350.929) (-350.941) [-351.583] (-349.242) -- 0:00:27
542500 -- [-351.332] (-351.718) (-349.588) (-349.342) * (-354.375) (-349.629) (-350.582) [-349.733] -- 0:00:26
543000 -- [-351.354] (-349.094) (-349.701) (-348.924) * (-348.503) (-348.810) [-350.419] (-353.894) -- 0:00:26
543500 -- (-350.411) [-351.232] (-350.009) (-348.145) * (-349.776) (-350.050) [-348.834] (-349.532) -- 0:00:26
544000 -- (-351.623) (-350.411) (-350.016) [-349.596] * (-352.557) [-351.598] (-348.077) (-349.925) -- 0:00:26
544500 -- (-349.267) [-348.664] (-352.240) (-350.422) * (-350.816) (-349.614) [-348.530] (-350.355) -- 0:00:26
545000 -- (-350.585) (-351.914) [-355.919] (-355.525) * (-349.113) (-348.628) (-349.708) [-350.516] -- 0:00:26
Average standard deviation of split frequencies: 0.009227
545500 -- (-351.267) (-349.424) [-352.214] (-349.522) * (-348.998) (-349.840) (-350.926) [-349.950] -- 0:00:26
546000 -- [-350.790] (-349.421) (-353.990) (-349.971) * [-350.400] (-350.208) (-350.586) (-350.017) -- 0:00:26
546500 -- [-350.615] (-351.888) (-353.672) (-349.115) * (-352.674) [-349.737] (-350.835) (-349.182) -- 0:00:26
547000 -- (-350.415) (-350.403) [-350.366] (-351.430) * [-352.976] (-350.899) (-348.588) (-351.344) -- 0:00:27
547500 -- (-348.508) (-350.371) (-352.896) [-351.300] * (-353.694) (-351.240) [-349.444] (-350.907) -- 0:00:27
548000 -- (-350.314) [-350.192] (-349.063) (-351.935) * (-355.191) (-351.685) [-348.739] (-349.704) -- 0:00:27
548500 -- (-349.999) (-350.138) [-352.999] (-353.142) * (-349.761) (-351.047) (-350.929) [-354.529] -- 0:00:27
549000 -- (-348.726) (-350.830) [-353.795] (-351.354) * (-354.565) (-351.133) [-349.543] (-349.955) -- 0:00:27
549500 -- (-354.714) (-348.978) [-351.400] (-349.796) * (-351.770) (-352.678) [-349.390] (-352.490) -- 0:00:27
550000 -- (-349.823) [-348.493] (-352.249) (-349.999) * (-356.692) (-351.410) (-353.752) [-349.578] -- 0:00:27
Average standard deviation of split frequencies: 0.009042
550500 -- (-349.482) (-349.399) [-350.002] (-349.465) * (-354.409) (-349.947) [-350.911] (-350.834) -- 0:00:26
551000 -- (-351.975) (-350.646) [-349.062] (-350.870) * (-349.611) (-351.332) (-353.918) [-350.160] -- 0:00:26
551500 -- [-349.141] (-351.831) (-349.316) (-351.418) * (-348.524) (-348.884) (-351.435) [-348.528] -- 0:00:26
552000 -- (-348.614) (-352.731) [-350.141] (-350.012) * (-350.106) (-353.850) (-349.855) [-349.192] -- 0:00:26
552500 -- (-349.150) (-348.865) [-349.862] (-362.106) * (-350.274) (-349.332) (-349.035) [-352.411] -- 0:00:26
553000 -- (-348.869) (-353.220) (-349.789) [-348.490] * (-348.351) (-349.585) (-349.130) [-350.012] -- 0:00:26
553500 -- (-348.477) [-349.200] (-353.916) (-349.103) * (-356.664) [-350.686] (-348.718) (-350.695) -- 0:00:26
554000 -- (-349.231) [-349.391] (-348.527) (-349.864) * (-348.779) (-351.521) [-349.385] (-349.544) -- 0:00:26
554500 -- [-351.243] (-351.450) (-348.314) (-350.407) * (-350.030) (-349.201) (-352.814) [-348.215] -- 0:00:26
555000 -- (-351.626) (-352.578) (-349.060) [-349.927] * (-350.620) (-348.489) (-357.653) [-349.112] -- 0:00:26
Average standard deviation of split frequencies: 0.009476
555500 -- (-352.136) (-357.329) [-351.909] (-351.793) * (-350.218) (-348.400) (-355.720) [-354.927] -- 0:00:26
556000 -- (-352.923) (-351.898) (-348.867) [-350.641] * [-352.847] (-349.646) (-350.899) (-353.462) -- 0:00:26
556500 -- (-353.063) (-349.197) [-347.957] (-350.657) * (-352.677) (-351.107) [-348.219] (-349.833) -- 0:00:26
557000 -- (-350.693) (-348.223) (-356.457) [-348.803] * (-349.104) (-358.156) [-350.146] (-349.650) -- 0:00:26
557500 -- [-351.917] (-348.829) (-350.586) (-350.764) * [-351.530] (-352.548) (-352.827) (-350.681) -- 0:00:26
558000 -- (-349.153) [-349.866] (-348.959) (-355.295) * (-349.812) [-354.161] (-349.779) (-348.891) -- 0:00:26
558500 -- [-349.002] (-350.934) (-350.350) (-351.036) * (-352.028) (-349.280) (-353.947) [-349.123] -- 0:00:26
559000 -- (-349.920) [-347.977] (-349.321) (-353.515) * (-348.426) (-348.298) (-350.548) [-349.463] -- 0:00:26
559500 -- [-351.535] (-348.475) (-349.221) (-351.497) * (-349.763) (-349.830) [-348.770] (-351.983) -- 0:00:25
560000 -- (-352.074) (-350.171) [-350.334] (-350.152) * [-355.032] (-352.515) (-349.410) (-349.954) -- 0:00:25
Average standard deviation of split frequencies: 0.010139
560500 -- (-351.275) (-349.785) (-348.848) [-349.678] * (-349.395) [-350.273] (-348.684) (-350.975) -- 0:00:25
561000 -- (-350.686) (-351.659) (-348.641) [-349.011] * (-351.790) [-349.281] (-348.023) (-350.049) -- 0:00:25
561500 -- (-350.525) (-350.019) (-348.702) [-351.040] * [-351.577] (-349.712) (-351.316) (-351.204) -- 0:00:25
562000 -- (-351.971) (-348.693) [-350.803] (-349.341) * (-354.007) (-352.093) [-352.050] (-351.236) -- 0:00:25
562500 -- [-349.766] (-348.573) (-352.095) (-349.150) * (-349.006) [-349.030] (-348.420) (-353.851) -- 0:00:25
563000 -- (-349.809) [-348.664] (-350.466) (-352.301) * (-350.563) (-352.785) (-351.178) [-348.128] -- 0:00:25
563500 -- (-348.856) (-349.112) (-356.682) [-348.553] * (-351.228) (-350.360) (-351.577) [-348.522] -- 0:00:25
564000 -- [-350.615] (-351.929) (-352.467) (-349.774) * (-348.321) (-348.509) (-348.750) [-348.836] -- 0:00:26
564500 -- (-349.503) (-350.131) [-350.193] (-356.017) * (-348.254) (-351.242) [-351.042] (-352.087) -- 0:00:26
565000 -- (-351.391) [-351.382] (-353.888) (-351.059) * (-353.962) (-349.506) (-352.523) [-352.946] -- 0:00:26
Average standard deviation of split frequencies: 0.010435
565500 -- [-349.386] (-353.273) (-350.066) (-350.356) * (-350.881) [-348.969] (-349.032) (-351.081) -- 0:00:26
566000 -- (-350.845) (-349.422) [-349.602] (-349.099) * (-350.113) (-355.893) (-349.516) [-348.348] -- 0:00:26
566500 -- (-348.403) (-349.174) (-350.625) [-351.177] * [-351.670] (-354.701) (-351.008) (-348.319) -- 0:00:26
567000 -- (-351.725) (-350.482) (-351.115) [-353.320] * (-350.466) (-351.247) (-349.773) [-348.915] -- 0:00:25
567500 -- (-352.434) (-353.487) [-349.154] (-351.505) * (-348.082) [-349.677] (-351.139) (-349.694) -- 0:00:25
568000 -- (-349.998) (-349.725) (-348.376) [-350.562] * [-349.739] (-349.612) (-348.926) (-349.258) -- 0:00:25
568500 -- (-351.846) (-350.304) [-350.058] (-352.041) * (-351.065) (-349.807) [-349.476] (-349.460) -- 0:00:25
569000 -- [-350.450] (-349.754) (-350.800) (-349.872) * (-350.783) (-348.263) (-348.430) [-349.105] -- 0:00:25
569500 -- (-352.054) (-350.785) [-348.974] (-351.167) * (-349.401) [-348.319] (-349.590) (-351.844) -- 0:00:25
570000 -- (-349.674) [-350.162] (-350.475) (-352.729) * (-349.203) [-350.391] (-350.988) (-353.290) -- 0:00:25
Average standard deviation of split frequencies: 0.010496
570500 -- [-349.829] (-353.032) (-350.137) (-349.131) * (-352.417) (-348.220) (-353.918) [-348.950] -- 0:00:25
571000 -- (-349.999) (-352.588) (-352.175) [-349.379] * [-351.438] (-349.323) (-350.590) (-350.807) -- 0:00:25
571500 -- (-348.069) (-348.909) [-351.841] (-350.305) * (-352.409) (-348.277) [-349.816] (-348.282) -- 0:00:25
572000 -- (-350.270) [-350.418] (-354.264) (-352.259) * (-351.681) (-353.015) (-352.067) [-352.846] -- 0:00:25
572500 -- (-349.754) [-349.230] (-349.110) (-351.714) * (-352.764) (-348.231) [-351.829] (-350.076) -- 0:00:25
573000 -- (-350.866) (-356.887) (-349.996) [-351.555] * (-350.590) (-352.507) (-350.278) [-351.982] -- 0:00:25
573500 -- (-349.683) (-349.078) (-350.130) [-350.934] * (-354.014) [-351.026] (-351.862) (-350.062) -- 0:00:25
574000 -- (-348.428) (-350.953) (-349.214) [-349.857] * (-351.214) (-349.753) [-349.634] (-349.771) -- 0:00:25
574500 -- [-349.929] (-350.694) (-348.929) (-352.227) * (-351.362) (-350.669) [-349.278] (-353.004) -- 0:00:25
575000 -- (-350.285) (-351.362) [-349.785] (-351.737) * [-351.025] (-349.672) (-351.624) (-352.568) -- 0:00:25
Average standard deviation of split frequencies: 0.010639
575500 -- [-351.259] (-351.157) (-348.710) (-350.673) * (-350.409) [-350.362] (-350.200) (-350.300) -- 0:00:25
576000 -- (-351.724) (-350.275) [-349.579] (-351.752) * (-350.732) [-349.066] (-352.827) (-352.160) -- 0:00:25
576500 -- (-352.602) (-348.984) [-348.462] (-352.937) * (-349.500) [-348.458] (-348.627) (-351.381) -- 0:00:24
577000 -- (-348.010) (-351.635) [-350.431] (-350.240) * (-350.124) (-350.590) (-348.588) [-350.351] -- 0:00:24
577500 -- (-347.953) (-354.660) (-349.817) [-348.857] * [-348.814] (-349.855) (-349.420) (-348.781) -- 0:00:24
578000 -- (-348.223) (-348.563) (-349.195) [-348.951] * (-349.863) [-351.496] (-352.264) (-350.588) -- 0:00:24
578500 -- (-350.322) (-348.804) [-350.850] (-349.887) * [-349.480] (-352.139) (-350.210) (-349.769) -- 0:00:24
579000 -- (-354.500) (-351.055) (-350.069) [-349.116] * (-349.846) (-351.749) (-349.686) [-352.476] -- 0:00:24
579500 -- (-350.201) [-349.569] (-348.980) (-351.847) * (-349.469) [-350.494] (-352.677) (-351.310) -- 0:00:24
580000 -- (-351.139) (-350.126) [-350.313] (-348.001) * (-355.154) [-350.803] (-357.866) (-348.648) -- 0:00:24
Average standard deviation of split frequencies: 0.010888
580500 -- (-352.133) (-351.742) (-349.968) [-349.402] * (-352.266) (-349.634) [-352.904] (-349.600) -- 0:00:24
581000 -- [-350.613] (-350.149) (-349.365) (-352.484) * (-349.711) (-349.155) [-353.275] (-349.351) -- 0:00:24
581500 -- [-349.436] (-352.414) (-349.895) (-349.722) * (-351.714) (-348.746) [-349.472] (-351.523) -- 0:00:25
582000 -- [-352.008] (-356.142) (-348.497) (-352.255) * (-351.837) (-351.445) [-352.931] (-350.189) -- 0:00:25
582500 -- (-348.653) [-351.169] (-349.656) (-353.713) * [-350.872] (-350.256) (-349.027) (-349.206) -- 0:00:25
583000 -- (-349.635) (-355.297) (-349.479) [-350.466] * [-348.229] (-354.559) (-352.422) (-348.493) -- 0:00:25
583500 -- [-350.359] (-351.373) (-350.176) (-352.643) * (-349.807) (-348.926) (-351.844) [-349.878] -- 0:00:24
584000 -- (-351.990) [-347.855] (-354.088) (-352.990) * (-348.890) (-348.199) (-351.701) [-349.547] -- 0:00:24
584500 -- [-350.069] (-352.981) (-348.425) (-349.442) * (-349.524) [-348.657] (-347.974) (-350.340) -- 0:00:24
585000 -- (-350.644) [-349.084] (-350.176) (-351.215) * (-350.218) [-348.592] (-348.778) (-350.186) -- 0:00:24
Average standard deviation of split frequencies: 0.009985
585500 -- (-349.864) [-348.803] (-350.508) (-350.054) * (-350.896) [-348.797] (-348.715) (-350.883) -- 0:00:24
586000 -- (-348.281) [-348.561] (-353.943) (-349.898) * (-349.931) (-348.084) [-348.509] (-350.254) -- 0:00:24
586500 -- [-349.329] (-349.839) (-348.660) (-352.759) * (-349.919) [-349.473] (-355.584) (-348.367) -- 0:00:24
587000 -- (-348.142) [-351.490] (-348.984) (-350.679) * (-350.328) [-354.070] (-349.908) (-353.625) -- 0:00:24
587500 -- (-350.641) (-353.475) (-348.391) [-348.590] * (-350.290) (-352.795) [-355.639] (-352.910) -- 0:00:24
588000 -- [-348.734] (-352.273) (-347.979) (-349.321) * [-349.492] (-355.453) (-349.944) (-356.179) -- 0:00:24
588500 -- [-351.401] (-351.406) (-350.349) (-348.724) * (-349.622) (-350.284) (-348.617) [-353.348] -- 0:00:24
589000 -- (-352.639) (-349.797) (-351.243) [-349.544] * (-351.257) (-351.353) [-351.433] (-349.276) -- 0:00:24
589500 -- [-351.598] (-352.553) (-352.906) (-350.162) * (-350.289) (-352.647) [-349.839] (-351.383) -- 0:00:24
590000 -- (-350.032) (-351.807) (-348.431) [-350.498] * (-349.655) (-353.500) (-348.522) [-352.473] -- 0:00:24
Average standard deviation of split frequencies: 0.009859
590500 -- (-351.069) (-350.335) (-350.013) [-350.985] * (-350.807) (-350.147) (-349.497) [-349.601] -- 0:00:24
591000 -- (-350.089) [-349.982] (-353.009) (-351.734) * (-349.590) [-350.470] (-350.844) (-350.051) -- 0:00:24
591500 -- (-349.390) (-349.243) [-351.463] (-350.307) * [-348.723] (-349.772) (-350.176) (-359.229) -- 0:00:24
592000 -- (-349.377) [-352.014] (-349.655) (-350.661) * (-350.786) (-350.238) [-353.732] (-352.632) -- 0:00:24
592500 -- (-349.897) (-353.307) (-350.122) [-353.386] * (-351.232) [-350.534] (-348.756) (-349.964) -- 0:00:24
593000 -- [-354.216] (-351.580) (-350.520) (-351.993) * [-349.358] (-350.774) (-349.779) (-351.122) -- 0:00:24
593500 -- (-354.868) (-348.789) [-350.127] (-349.961) * (-349.020) (-352.089) [-350.250] (-353.751) -- 0:00:23
594000 -- (-351.374) (-350.237) [-349.711] (-351.602) * (-349.220) (-352.306) (-350.621) [-350.614] -- 0:00:23
594500 -- (-352.219) (-349.799) [-349.900] (-348.596) * (-352.985) (-351.902) [-350.982] (-348.809) -- 0:00:23
595000 -- (-350.365) (-349.168) [-348.365] (-348.333) * (-350.155) (-349.650) (-348.885) [-347.956] -- 0:00:23
Average standard deviation of split frequencies: 0.009212
595500 -- [-353.700] (-349.436) (-349.875) (-349.723) * (-349.624) (-349.726) (-349.223) [-349.497] -- 0:00:23
596000 -- (-350.149) (-351.490) (-354.894) [-350.450] * (-349.748) (-351.228) (-349.061) [-355.275] -- 0:00:23
596500 -- [-351.756] (-351.453) (-353.361) (-349.361) * (-349.324) (-349.069) [-349.166] (-348.352) -- 0:00:23
597000 -- [-348.484] (-354.160) (-349.894) (-348.885) * [-348.572] (-349.019) (-350.275) (-348.452) -- 0:00:23
597500 -- (-351.374) [-348.316] (-349.350) (-348.412) * (-353.553) [-355.387] (-350.242) (-350.582) -- 0:00:23
598000 -- [-356.319] (-355.327) (-349.638) (-349.328) * (-348.064) (-349.759) (-349.928) [-348.771] -- 0:00:23
598500 -- [-349.205] (-349.733) (-349.510) (-348.933) * [-349.857] (-350.017) (-351.184) (-348.989) -- 0:00:24
599000 -- (-352.435) [-352.290] (-350.982) (-350.406) * (-348.553) [-348.990] (-350.429) (-348.579) -- 0:00:24
599500 -- [-349.247] (-350.393) (-348.431) (-348.848) * [-350.768] (-350.290) (-352.867) (-349.380) -- 0:00:24
600000 -- (-349.351) (-349.467) [-350.004] (-349.160) * (-351.488) (-349.497) (-352.983) [-351.949] -- 0:00:24
Average standard deviation of split frequencies: 0.008494
600500 -- (-350.383) [-349.175] (-349.017) (-348.948) * (-350.640) [-349.436] (-348.448) (-350.621) -- 0:00:23
601000 -- [-349.218] (-352.156) (-348.289) (-348.791) * (-353.537) [-349.595] (-351.699) (-348.905) -- 0:00:23
601500 -- [-349.010] (-350.676) (-349.658) (-349.417) * (-350.457) (-350.051) (-349.596) [-352.242] -- 0:00:23
602000 -- (-350.138) (-353.534) (-349.497) [-350.788] * [-352.892] (-350.248) (-348.852) (-353.257) -- 0:00:23
602500 -- (-351.820) [-351.558] (-349.951) (-350.926) * (-353.460) (-353.790) (-351.747) [-349.962] -- 0:00:23
603000 -- [-350.661] (-354.666) (-348.696) (-350.252) * (-350.247) (-350.182) (-349.010) [-352.846] -- 0:00:23
603500 -- [-349.068] (-351.481) (-348.039) (-348.169) * (-350.873) (-351.857) (-351.199) [-350.061] -- 0:00:23
604000 -- [-349.931] (-349.642) (-348.946) (-348.263) * (-349.941) [-350.001] (-349.779) (-351.027) -- 0:00:23
604500 -- (-349.511) (-349.591) (-349.956) [-349.661] * [-350.900] (-349.853) (-348.578) (-353.170) -- 0:00:23
605000 -- (-348.353) [-350.193] (-350.254) (-351.153) * [-349.634] (-350.809) (-350.776) (-351.253) -- 0:00:23
Average standard deviation of split frequencies: 0.008465
605500 -- (-348.611) (-350.579) (-349.378) [-350.172] * (-349.086) (-351.661) [-348.779] (-351.052) -- 0:00:23
606000 -- (-350.220) (-348.616) [-350.101] (-350.376) * (-353.998) (-349.152) [-348.342] (-353.447) -- 0:00:23
606500 -- (-349.790) (-349.093) (-349.732) [-349.017] * (-352.367) [-348.434] (-349.999) (-354.748) -- 0:00:23
607000 -- (-349.140) (-350.313) (-350.082) [-349.546] * (-353.632) (-349.875) (-349.691) [-350.002] -- 0:00:23
607500 -- (-349.022) [-350.847] (-350.350) (-348.481) * (-350.369) (-349.348) (-348.971) [-348.132] -- 0:00:23
608000 -- (-350.284) (-348.566) [-350.173] (-348.722) * (-349.073) (-348.807) [-348.511] (-350.877) -- 0:00:23
608500 -- [-348.238] (-349.988) (-350.111) (-350.454) * (-349.329) [-349.007] (-348.985) (-350.655) -- 0:00:23
609000 -- [-352.490] (-351.137) (-349.356) (-351.355) * [-349.362] (-350.096) (-349.064) (-349.305) -- 0:00:23
609500 -- (-349.938) (-350.503) (-349.316) [-351.181] * (-350.192) [-351.539] (-350.556) (-350.201) -- 0:00:23
610000 -- [-349.070] (-349.373) (-348.414) (-351.075) * (-350.605) (-351.276) (-349.247) [-348.323] -- 0:00:23
Average standard deviation of split frequencies: 0.008219
610500 -- (-348.797) [-348.525] (-350.503) (-350.588) * (-350.805) [-348.972] (-349.378) (-348.868) -- 0:00:22
611000 -- (-351.062) (-349.861) [-349.270] (-351.329) * [-349.595] (-354.330) (-348.379) (-349.191) -- 0:00:22
611500 -- (-348.960) (-349.063) (-349.275) [-351.561] * (-350.670) (-349.430) [-348.510] (-351.259) -- 0:00:22
612000 -- (-349.165) [-353.817] (-350.971) (-350.684) * (-352.635) (-349.706) (-352.465) [-352.447] -- 0:00:22
612500 -- [-350.406] (-353.053) (-349.259) (-349.789) * (-350.490) [-348.802] (-349.035) (-350.941) -- 0:00:22
613000 -- (-349.565) (-355.132) [-349.779] (-350.285) * [-349.350] (-350.357) (-349.047) (-351.088) -- 0:00:22
613500 -- (-350.529) (-348.798) [-350.743] (-353.704) * [-349.916] (-356.002) (-349.010) (-349.670) -- 0:00:22
614000 -- [-350.317] (-348.687) (-350.234) (-351.896) * (-349.312) (-350.211) [-350.216] (-350.628) -- 0:00:22
614500 -- (-348.743) (-353.359) [-349.530] (-350.427) * [-351.777] (-353.736) (-350.484) (-352.714) -- 0:00:23
615000 -- (-351.199) (-349.225) (-349.891) [-353.679] * [-349.546] (-351.115) (-351.333) (-349.676) -- 0:00:23
Average standard deviation of split frequencies: 0.007700
615500 -- (-349.252) [-349.975] (-349.105) (-351.050) * (-349.683) [-349.654] (-348.777) (-351.773) -- 0:00:23
616000 -- (-348.093) (-356.202) [-350.626] (-348.791) * (-354.323) (-352.085) [-349.337] (-348.862) -- 0:00:23
616500 -- [-349.318] (-350.779) (-351.663) (-350.666) * [-353.407] (-348.932) (-351.390) (-348.254) -- 0:00:23
617000 -- (-349.334) (-349.597) (-353.353) [-348.641] * (-352.039) (-349.160) (-350.670) [-348.506] -- 0:00:22
617500 -- [-348.415] (-350.932) (-354.032) (-350.584) * (-349.556) (-349.014) (-353.208) [-350.609] -- 0:00:22
618000 -- (-348.740) [-350.284] (-352.067) (-349.191) * (-349.344) (-351.388) (-353.681) [-348.807] -- 0:00:22
618500 -- (-348.081) (-349.678) (-349.531) [-349.325] * [-349.542] (-351.066) (-355.165) (-350.173) -- 0:00:22
619000 -- (-352.434) (-349.053) [-349.564] (-348.689) * (-348.865) [-350.746] (-353.626) (-351.721) -- 0:00:22
619500 -- (-349.649) (-349.863) [-349.519] (-348.221) * (-349.508) [-348.810] (-350.351) (-350.090) -- 0:00:22
620000 -- (-348.877) [-348.904] (-349.786) (-348.154) * [-348.660] (-349.661) (-352.821) (-350.013) -- 0:00:22
Average standard deviation of split frequencies: 0.007215
620500 -- [-348.454] (-349.265) (-351.532) (-350.395) * (-348.823) (-349.937) (-348.682) [-351.709] -- 0:00:22
621000 -- [-350.719] (-350.250) (-349.843) (-350.843) * (-348.187) [-350.347] (-349.226) (-349.524) -- 0:00:22
621500 -- [-350.217] (-353.103) (-350.038) (-351.308) * (-349.865) (-348.945) (-349.321) [-349.892] -- 0:00:22
622000 -- (-349.758) [-350.724] (-349.869) (-349.715) * (-350.928) [-349.759] (-348.232) (-350.477) -- 0:00:22
622500 -- (-352.681) (-348.727) (-350.441) [-348.307] * (-352.603) (-351.165) (-349.280) [-351.239] -- 0:00:22
623000 -- (-349.653) (-354.119) (-350.157) [-349.216] * (-352.068) (-352.394) [-349.773] (-350.662) -- 0:00:22
623500 -- (-349.188) (-352.202) [-348.689] (-350.573) * [-350.005] (-355.329) (-348.878) (-349.821) -- 0:00:22
624000 -- (-351.631) [-349.984] (-348.915) (-351.802) * (-350.222) [-352.682] (-350.501) (-351.639) -- 0:00:22
624500 -- (-356.286) [-348.668] (-349.213) (-350.513) * (-354.164) (-351.755) [-348.729] (-352.232) -- 0:00:22
625000 -- [-348.686] (-349.591) (-350.131) (-348.763) * (-351.770) (-349.949) [-350.233] (-348.414) -- 0:00:22
Average standard deviation of split frequencies: 0.007342
625500 -- (-351.695) [-348.298] (-350.905) (-349.398) * (-348.383) [-348.808] (-349.667) (-350.550) -- 0:00:22
626000 -- [-352.102] (-352.093) (-348.461) (-349.124) * (-349.410) (-348.717) (-349.686) [-351.232] -- 0:00:22
626500 -- (-353.547) (-351.035) [-349.186] (-349.238) * (-350.615) [-352.291] (-350.662) (-352.806) -- 0:00:22
627000 -- [-349.177] (-351.105) (-349.636) (-351.129) * (-350.759) (-350.857) (-355.491) [-352.214] -- 0:00:22
627500 -- (-349.245) (-349.780) (-349.024) [-350.442] * (-351.188) [-349.769] (-350.717) (-351.122) -- 0:00:21
628000 -- (-349.956) (-348.973) [-352.209] (-349.748) * (-351.726) [-349.450] (-349.477) (-351.131) -- 0:00:21
628500 -- (-349.753) [-348.374] (-351.570) (-350.625) * (-349.500) (-352.377) (-350.474) [-349.729] -- 0:00:21
629000 -- (-352.818) [-349.313] (-348.911) (-350.063) * (-350.460) (-353.564) [-351.440] (-349.580) -- 0:00:21
629500 -- (-349.678) [-350.779] (-354.103) (-350.021) * (-348.883) (-351.323) [-348.068] (-350.624) -- 0:00:21
630000 -- (-350.334) (-349.760) (-350.430) [-351.183] * (-350.146) (-358.314) (-351.172) [-350.648] -- 0:00:21
Average standard deviation of split frequencies: 0.007288
630500 -- (-349.798) (-349.250) (-349.734) [-348.115] * [-349.067] (-351.202) (-349.951) (-351.075) -- 0:00:21
631000 -- (-350.016) [-350.374] (-352.236) (-350.732) * (-351.128) (-349.445) (-349.116) [-349.106] -- 0:00:21
631500 -- (-351.651) [-353.199] (-354.681) (-350.233) * (-350.460) (-348.754) [-349.065] (-350.743) -- 0:00:21
632000 -- [-351.586] (-349.742) (-349.706) (-356.696) * (-349.858) (-349.461) [-351.874] (-352.663) -- 0:00:22
632500 -- (-349.424) (-348.200) [-349.942] (-350.291) * (-349.440) [-352.701] (-349.903) (-350.363) -- 0:00:22
633000 -- (-351.115) [-348.583] (-350.147) (-352.422) * (-349.875) (-349.849) [-351.745] (-348.784) -- 0:00:22
633500 -- (-349.762) (-350.574) [-351.820] (-348.174) * (-348.412) (-350.743) (-350.789) [-348.417] -- 0:00:21
634000 -- (-351.176) [-352.198] (-348.913) (-349.630) * (-351.345) (-349.907) [-349.511] (-349.287) -- 0:00:21
634500 -- (-351.589) (-351.303) (-349.333) [-349.166] * [-353.048] (-348.552) (-350.160) (-351.056) -- 0:00:21
635000 -- [-348.733] (-351.022) (-348.735) (-349.444) * (-349.973) (-348.954) (-353.833) [-351.434] -- 0:00:21
Average standard deviation of split frequencies: 0.006717
635500 -- [-348.969] (-349.619) (-349.001) (-348.705) * (-353.623) [-350.232] (-351.895) (-351.778) -- 0:00:21
636000 -- (-351.374) (-351.938) [-350.582] (-350.146) * (-349.490) (-350.438) [-350.684] (-352.331) -- 0:00:21
636500 -- (-349.973) (-355.032) [-349.907] (-350.661) * (-351.094) (-350.293) [-349.597] (-349.389) -- 0:00:21
637000 -- [-348.880] (-352.593) (-350.426) (-349.158) * (-350.054) (-350.311) (-351.919) [-353.843] -- 0:00:21
637500 -- [-349.512] (-348.913) (-348.559) (-349.781) * (-349.204) (-350.775) [-351.789] (-349.171) -- 0:00:21
638000 -- (-349.046) [-348.857] (-353.793) (-353.897) * (-348.339) (-352.086) (-349.066) [-351.586] -- 0:00:21
638500 -- (-349.801) [-350.673] (-349.133) (-354.486) * (-348.631) [-349.957] (-352.090) (-349.699) -- 0:00:21
639000 -- (-348.834) (-353.332) [-352.394] (-352.822) * (-349.734) [-355.870] (-352.358) (-349.594) -- 0:00:21
639500 -- (-348.451) (-348.053) [-350.181] (-350.620) * (-348.659) [-348.718] (-348.976) (-348.625) -- 0:00:21
640000 -- (-350.235) [-351.352] (-351.046) (-350.630) * (-350.443) [-350.667] (-349.564) (-350.184) -- 0:00:21
Average standard deviation of split frequencies: 0.006806
640500 -- (-350.059) (-350.386) [-352.152] (-349.037) * (-349.126) (-353.521) [-348.986] (-349.376) -- 0:00:21
641000 -- [-351.522] (-353.437) (-350.444) (-350.701) * (-350.726) (-348.964) [-351.315] (-350.596) -- 0:00:21
641500 -- [-348.829] (-349.753) (-353.660) (-351.199) * (-350.751) [-351.292] (-348.486) (-351.428) -- 0:00:21
642000 -- (-350.649) (-351.868) [-350.666] (-349.931) * (-352.200) [-349.377] (-354.450) (-350.287) -- 0:00:21
642500 -- (-353.734) (-350.544) [-347.992] (-349.344) * (-350.676) (-349.241) (-351.010) [-349.147] -- 0:00:21
643000 -- (-348.840) (-349.812) (-348.828) [-348.994] * (-354.453) (-349.499) [-352.662] (-353.510) -- 0:00:21
643500 -- [-349.067] (-357.171) (-351.427) (-349.677) * (-348.180) (-349.258) [-347.985] (-350.803) -- 0:00:21
644000 -- (-351.549) [-349.746] (-349.026) (-348.838) * (-349.500) (-350.584) [-348.155] (-351.394) -- 0:00:21
644500 -- (-349.730) [-349.132] (-349.129) (-353.778) * (-348.388) [-348.990] (-348.725) (-353.287) -- 0:00:20
645000 -- (-349.612) [-350.910] (-347.993) (-349.103) * (-351.329) (-356.152) [-353.393] (-351.865) -- 0:00:20
Average standard deviation of split frequencies: 0.006704
645500 -- (-349.615) (-349.167) [-347.831] (-349.489) * (-349.750) (-349.054) (-350.815) [-349.546] -- 0:00:20
646000 -- (-348.647) [-348.852] (-351.408) (-348.057) * (-350.856) (-350.280) [-349.660] (-349.206) -- 0:00:20
646500 -- (-349.231) [-349.290] (-348.813) (-349.896) * (-349.685) (-348.357) [-350.254] (-353.570) -- 0:00:20
647000 -- (-349.425) [-349.372] (-353.843) (-351.523) * (-349.413) [-348.322] (-351.192) (-350.991) -- 0:00:20
647500 -- (-349.161) (-355.868) [-351.621] (-349.790) * (-348.367) (-352.530) (-353.006) [-350.642] -- 0:00:20
648000 -- (-349.622) (-349.988) [-349.274] (-353.807) * (-349.190) [-354.250] (-350.721) (-352.883) -- 0:00:20
648500 -- [-349.015] (-353.409) (-349.127) (-350.263) * (-349.393) (-348.536) [-348.517] (-350.193) -- 0:00:20
649000 -- (-350.858) (-351.462) (-348.315) [-350.301] * (-350.609) (-349.533) (-351.902) [-349.683] -- 0:00:21
649500 -- (-351.541) (-350.601) [-351.025] (-354.084) * (-348.004) (-349.442) (-348.235) [-348.635] -- 0:00:21
650000 -- (-351.610) [-349.786] (-349.426) (-351.050) * (-350.291) (-348.726) (-348.930) [-350.226] -- 0:00:21
Average standard deviation of split frequencies: 0.007064
650500 -- (-353.660) (-349.573) [-349.518] (-349.354) * (-352.308) (-351.080) (-351.073) [-348.241] -- 0:00:20
651000 -- (-353.212) [-349.062] (-352.692) (-349.355) * (-350.917) (-350.620) (-353.464) [-349.324] -- 0:00:20
651500 -- (-350.089) (-350.256) (-350.546) [-349.948] * [-352.085] (-348.636) (-352.162) (-351.295) -- 0:00:20
652000 -- (-349.342) (-349.460) (-350.786) [-350.879] * (-351.486) [-349.874] (-349.297) (-354.801) -- 0:00:20
652500 -- (-351.278) [-348.675] (-349.466) (-353.833) * (-349.320) (-352.433) [-348.684] (-351.640) -- 0:00:20
653000 -- (-352.421) [-349.190] (-351.498) (-353.021) * (-350.252) [-349.130] (-349.943) (-352.614) -- 0:00:20
653500 -- (-351.787) (-348.224) (-350.061) [-349.896] * (-353.127) (-349.962) (-349.037) [-348.922] -- 0:00:20
654000 -- [-351.578] (-348.062) (-352.978) (-349.592) * (-351.718) (-348.648) [-348.742] (-350.692) -- 0:00:20
654500 -- [-348.980] (-348.853) (-356.720) (-348.693) * (-355.648) (-349.774) (-349.466) [-351.232] -- 0:00:20
655000 -- (-354.164) (-348.577) [-351.718] (-351.468) * (-350.467) (-349.244) [-349.184] (-353.195) -- 0:00:20
Average standard deviation of split frequencies: 0.006288
655500 -- (-350.713) (-351.363) [-350.017] (-351.191) * (-348.566) (-349.083) (-353.388) [-349.512] -- 0:00:20
656000 -- (-349.553) [-348.746] (-349.136) (-350.223) * [-349.800] (-348.053) (-354.053) (-348.838) -- 0:00:20
656500 -- (-348.637) [-349.262] (-352.304) (-349.084) * (-349.069) (-350.989) [-351.398] (-349.261) -- 0:00:20
657000 -- (-348.905) (-350.714) [-349.285] (-348.862) * (-349.668) [-348.752] (-351.638) (-349.672) -- 0:00:20
657500 -- [-349.407] (-350.953) (-352.169) (-348.481) * [-348.746] (-349.674) (-352.608) (-351.622) -- 0:00:20
658000 -- (-350.656) (-349.554) [-349.279] (-348.450) * (-349.508) (-351.487) [-350.120] (-351.239) -- 0:00:20
658500 -- (-351.470) [-348.183] (-351.155) (-348.997) * (-348.778) [-349.656] (-350.845) (-353.800) -- 0:00:20
659000 -- (-349.335) [-349.211] (-352.241) (-349.973) * (-349.180) [-351.844] (-351.114) (-350.928) -- 0:00:20
659500 -- [-351.122] (-352.972) (-348.256) (-348.933) * (-348.561) [-348.934] (-353.939) (-349.410) -- 0:00:20
660000 -- (-354.802) (-350.788) (-349.101) [-352.502] * (-350.863) (-350.404) (-351.715) [-349.455] -- 0:00:20
Average standard deviation of split frequencies: 0.006377
660500 -- (-363.131) (-350.686) (-349.673) [-353.787] * (-349.317) (-349.035) (-353.870) [-348.714] -- 0:00:20
661000 -- (-351.741) [-351.536] (-350.927) (-350.910) * [-349.866] (-348.760) (-351.513) (-351.930) -- 0:00:20
661500 -- [-349.627] (-350.959) (-351.993) (-355.549) * (-350.284) (-349.004) [-350.337] (-350.656) -- 0:00:19
662000 -- (-348.377) [-354.734] (-353.220) (-349.437) * [-349.037] (-349.381) (-352.471) (-349.930) -- 0:00:19
662500 -- (-352.800) (-353.285) (-351.405) [-353.109] * (-348.321) [-348.447] (-348.007) (-348.493) -- 0:00:19
663000 -- (-350.553) [-350.909] (-352.414) (-348.578) * [-350.381] (-349.471) (-349.050) (-352.933) -- 0:00:19
663500 -- (-350.841) (-351.510) [-349.912] (-352.621) * (-354.454) (-353.698) (-350.253) [-353.875] -- 0:00:19
664000 -- (-350.437) [-351.263] (-349.830) (-350.649) * [-349.969] (-349.410) (-349.278) (-353.828) -- 0:00:19
664500 -- [-350.360] (-350.967) (-350.539) (-353.252) * (-348.829) (-351.950) [-348.858] (-350.295) -- 0:00:19
665000 -- [-350.478] (-353.227) (-351.756) (-352.281) * [-349.773] (-349.971) (-348.880) (-353.269) -- 0:00:19
Average standard deviation of split frequencies: 0.006016
665500 -- (-350.693) (-351.489) [-355.308] (-349.487) * (-348.108) (-353.994) (-349.316) [-349.478] -- 0:00:19
666000 -- (-352.219) [-348.196] (-359.282) (-352.286) * [-349.112] (-349.838) (-349.528) (-350.779) -- 0:00:20
666500 -- [-352.200] (-349.392) (-349.629) (-355.332) * (-352.494) [-348.770] (-352.311) (-351.836) -- 0:00:20
667000 -- (-350.891) [-352.238] (-352.089) (-351.415) * (-348.601) [-352.088] (-354.087) (-350.480) -- 0:00:19
667500 -- (-349.151) (-351.628) (-351.411) [-351.330] * (-348.568) (-349.571) (-350.360) [-348.871] -- 0:00:19
668000 -- [-349.991] (-350.887) (-354.430) (-349.716) * (-351.188) (-352.001) [-348.821] (-354.005) -- 0:00:19
668500 -- (-350.352) (-349.518) [-351.056] (-348.823) * (-351.806) (-349.953) [-349.418] (-352.852) -- 0:00:19
669000 -- [-348.888] (-352.902) (-349.638) (-351.002) * (-350.804) [-349.257] (-349.640) (-351.662) -- 0:00:19
669500 -- [-348.946] (-349.842) (-348.525) (-349.415) * (-353.985) (-350.361) (-350.804) [-348.392] -- 0:00:19
670000 -- (-350.747) [-354.294] (-349.314) (-350.789) * (-348.754) [-348.431] (-349.807) (-349.502) -- 0:00:19
Average standard deviation of split frequencies: 0.005975
670500 -- (-353.580) [-348.463] (-350.684) (-350.797) * (-352.678) (-349.780) [-349.160] (-349.375) -- 0:00:19
671000 -- (-353.656) [-348.856] (-348.585) (-351.566) * (-350.023) (-349.946) (-350.726) [-349.174] -- 0:00:19
671500 -- [-354.387] (-350.634) (-352.193) (-351.259) * (-349.902) [-348.630] (-352.122) (-349.371) -- 0:00:19
672000 -- (-349.634) [-350.197] (-349.116) (-349.888) * [-349.543] (-351.241) (-349.801) (-349.204) -- 0:00:19
672500 -- (-353.434) (-349.345) [-357.589] (-348.764) * [-350.359] (-349.882) (-349.205) (-350.753) -- 0:00:19
673000 -- (-348.390) (-351.976) (-349.558) [-353.195] * (-350.221) (-348.736) [-352.405] (-352.119) -- 0:00:19
673500 -- (-349.520) [-352.218] (-348.665) (-351.201) * (-350.401) [-348.483] (-349.521) (-348.966) -- 0:00:19
674000 -- (-349.700) [-352.527] (-348.370) (-351.951) * (-350.800) [-349.226] (-351.714) (-352.126) -- 0:00:19
674500 -- (-349.582) [-353.348] (-350.406) (-350.050) * [-351.676] (-349.378) (-350.400) (-349.385) -- 0:00:19
675000 -- (-351.572) (-350.637) [-351.495] (-349.468) * (-349.210) (-350.579) (-351.490) [-349.375] -- 0:00:19
Average standard deviation of split frequencies: 0.005666
675500 -- (-349.601) (-348.350) [-348.890] (-348.967) * [-349.493] (-352.009) (-348.759) (-349.243) -- 0:00:19
676000 -- [-348.537] (-350.026) (-350.227) (-353.053) * (-353.685) (-349.288) [-348.812] (-350.929) -- 0:00:19
676500 -- (-348.560) [-349.150] (-350.883) (-352.451) * (-350.142) (-349.967) [-349.246] (-350.283) -- 0:00:19
677000 -- (-349.000) (-350.592) (-351.537) [-348.694] * (-352.432) (-353.967) [-348.915] (-348.925) -- 0:00:19
677500 -- [-348.866] (-348.185) (-351.353) (-348.762) * (-349.559) (-349.194) (-348.701) [-353.420] -- 0:00:19
678000 -- (-348.116) (-348.297) (-352.284) [-352.492] * [-353.800] (-350.318) (-349.493) (-352.204) -- 0:00:18
678500 -- [-350.372] (-348.860) (-352.446) (-349.439) * [-352.856] (-350.622) (-350.283) (-349.250) -- 0:00:18
679000 -- (-350.480) [-349.879] (-351.756) (-357.088) * [-352.550] (-349.214) (-348.646) (-351.078) -- 0:00:18
679500 -- (-354.064) (-348.948) (-351.229) [-350.493] * (-354.497) (-349.458) (-352.264) [-350.332] -- 0:00:18
680000 -- (-351.354) [-351.257] (-350.134) (-351.640) * (-354.824) (-352.543) [-352.999] (-351.270) -- 0:00:18
Average standard deviation of split frequencies: 0.005757
680500 -- (-351.306) (-351.233) [-349.169] (-349.664) * [-350.596] (-350.204) (-354.353) (-351.894) -- 0:00:18
681000 -- [-348.659] (-353.661) (-350.570) (-350.512) * (-348.729) [-348.611] (-350.733) (-354.418) -- 0:00:18
681500 -- (-350.417) (-354.921) (-353.519) [-350.322] * [-352.026] (-351.484) (-351.129) (-350.295) -- 0:00:18
682000 -- (-352.063) (-348.940) (-354.238) [-350.146] * (-350.866) (-349.093) [-354.074] (-351.113) -- 0:00:18
682500 -- (-349.109) (-350.481) (-351.782) [-349.099] * (-354.439) (-352.199) [-352.478] (-350.851) -- 0:00:18
683000 -- (-348.205) (-351.541) (-349.948) [-348.443] * (-350.129) (-352.232) [-351.430] (-348.578) -- 0:00:18
683500 -- (-350.257) [-349.092] (-349.772) (-348.368) * (-353.266) (-349.776) [-348.762] (-349.155) -- 0:00:18
684000 -- (-349.614) [-349.806] (-350.324) (-349.355) * [-351.340] (-348.829) (-349.683) (-353.005) -- 0:00:18
684500 -- (-356.373) [-350.281] (-353.963) (-350.327) * [-353.284] (-350.329) (-350.990) (-352.212) -- 0:00:18
685000 -- [-352.539] (-350.450) (-348.915) (-350.119) * (-352.049) [-349.030] (-349.922) (-349.886) -- 0:00:18
Average standard deviation of split frequencies: 0.005412
685500 -- (-353.419) [-350.207] (-349.726) (-350.456) * (-351.374) (-351.205) [-348.974] (-355.642) -- 0:00:18
686000 -- (-357.620) (-351.241) [-351.530] (-354.011) * [-349.533] (-352.091) (-349.343) (-356.391) -- 0:00:18
686500 -- (-353.854) (-352.935) [-349.698] (-351.927) * (-351.985) [-350.533] (-348.818) (-349.640) -- 0:00:18
687000 -- [-349.694] (-352.749) (-348.989) (-352.341) * (-350.830) (-349.667) (-350.941) [-349.208] -- 0:00:18
687500 -- (-349.021) (-355.828) (-354.806) [-349.279] * [-350.867] (-354.055) (-350.464) (-348.875) -- 0:00:18
688000 -- (-348.674) [-355.716] (-352.002) (-348.322) * (-349.674) (-350.905) (-351.161) [-349.974] -- 0:00:18
688500 -- (-348.793) [-352.871] (-351.929) (-349.681) * (-351.588) (-351.007) [-349.877] (-350.564) -- 0:00:18
689000 -- (-348.452) [-351.319] (-356.375) (-352.733) * (-352.175) (-350.618) [-350.502] (-349.510) -- 0:00:18
689500 -- (-353.455) (-352.269) (-352.909) [-348.047] * (-351.979) (-351.782) [-349.742] (-349.586) -- 0:00:18
690000 -- [-350.259] (-349.949) (-352.722) (-348.390) * (-352.455) (-350.501) (-355.302) [-349.364] -- 0:00:18
Average standard deviation of split frequencies: 0.005581
690500 -- [-349.084] (-349.531) (-349.453) (-348.130) * [-354.723] (-351.163) (-354.376) (-349.780) -- 0:00:18
691000 -- (-350.788) [-351.326] (-352.329) (-351.232) * [-355.036] (-353.367) (-350.004) (-351.415) -- 0:00:18
691500 -- (-349.425) (-350.464) [-349.743] (-350.347) * [-351.768] (-350.728) (-349.656) (-350.685) -- 0:00:18
692000 -- (-348.217) [-348.853] (-353.164) (-348.023) * (-349.305) [-349.048] (-349.146) (-351.988) -- 0:00:18
692500 -- (-351.232) (-351.496) [-351.887] (-349.453) * (-352.151) (-348.565) [-353.589] (-350.801) -- 0:00:18
693000 -- [-350.889] (-349.433) (-351.674) (-350.081) * (-350.123) (-348.055) [-354.033] (-350.169) -- 0:00:18
693500 -- (-349.061) (-349.433) [-348.212] (-348.985) * (-349.968) (-349.836) (-350.569) [-349.172] -- 0:00:18
694000 -- (-348.948) [-351.947] (-352.998) (-349.218) * [-349.186] (-350.513) (-350.400) (-353.894) -- 0:00:18
694500 -- (-351.605) (-350.092) (-352.884) [-353.099] * (-349.554) (-350.713) [-349.988] (-350.974) -- 0:00:18
695000 -- (-352.956) [-349.118] (-351.842) (-348.519) * [-350.846] (-351.185) (-350.402) (-349.032) -- 0:00:17
Average standard deviation of split frequencies: 0.005897
695500 -- (-348.927) (-353.048) [-351.007] (-350.597) * (-350.283) (-351.941) (-351.975) [-349.703] -- 0:00:17
696000 -- [-348.077] (-348.224) (-352.786) (-351.473) * [-349.164] (-352.570) (-349.361) (-352.015) -- 0:00:17
696500 -- (-349.129) (-348.443) (-353.069) [-349.997] * [-349.986] (-351.370) (-349.233) (-348.761) -- 0:00:17
697000 -- (-350.615) (-349.177) [-354.697] (-349.232) * (-348.137) (-355.357) (-351.868) [-349.057] -- 0:00:17
697500 -- (-350.691) (-348.832) (-350.742) [-349.209] * (-349.505) (-352.415) (-350.453) [-350.260] -- 0:00:17
698000 -- (-348.647) (-352.424) (-349.094) [-349.667] * [-348.586] (-350.990) (-350.944) (-348.322) -- 0:00:17
698500 -- [-348.876] (-352.918) (-349.284) (-349.625) * (-349.282) (-353.639) (-354.217) [-349.703] -- 0:00:17
699000 -- [-351.167] (-351.619) (-353.732) (-352.158) * (-351.641) (-352.688) (-350.647) [-349.283] -- 0:00:17
699500 -- (-350.479) [-350.599] (-352.923) (-351.504) * (-348.846) (-351.512) [-354.275] (-352.066) -- 0:00:17
700000 -- (-352.313) (-350.662) [-348.299] (-351.878) * [-349.540] (-355.365) (-349.046) (-352.131) -- 0:00:17
Average standard deviation of split frequencies: 0.005778
700500 -- [-350.544] (-355.636) (-348.058) (-352.524) * (-350.615) (-350.783) (-350.252) [-350.021] -- 0:00:17
701000 -- (-350.709) (-354.505) [-351.072] (-351.598) * (-349.437) (-349.969) (-353.411) [-352.384] -- 0:00:17
701500 -- [-348.503] (-355.257) (-350.185) (-350.015) * [-349.684] (-350.101) (-348.480) (-353.630) -- 0:00:17
702000 -- (-348.163) (-351.292) (-353.186) [-352.414] * (-348.980) (-349.503) [-350.296] (-349.518) -- 0:00:17
702500 -- [-348.060] (-350.655) (-349.329) (-349.916) * (-351.323) [-348.330] (-352.947) (-351.038) -- 0:00:17
703000 -- (-348.667) [-355.245] (-349.624) (-348.768) * (-352.191) (-348.663) (-349.807) [-350.249] -- 0:00:17
703500 -- [-348.647] (-349.190) (-350.892) (-348.493) * [-351.923] (-348.448) (-353.577) (-349.229) -- 0:00:17
704000 -- [-351.709] (-348.601) (-350.542) (-351.031) * (-353.036) (-348.457) (-352.615) [-350.442] -- 0:00:17
704500 -- (-356.555) (-349.729) [-352.083] (-354.552) * (-353.475) [-349.616] (-350.053) (-348.223) -- 0:00:17
705000 -- [-350.377] (-348.721) (-352.200) (-352.869) * (-349.960) [-350.035] (-348.531) (-349.727) -- 0:00:17
Average standard deviation of split frequencies: 0.006088
705500 -- (-354.775) [-352.081] (-349.952) (-349.777) * (-350.001) (-349.688) (-349.114) [-349.004] -- 0:00:17
706000 -- (-352.347) [-349.607] (-351.170) (-352.343) * (-348.982) (-350.934) [-352.683] (-351.153) -- 0:00:17
706500 -- (-351.262) [-353.293] (-351.465) (-353.464) * (-355.866) (-351.074) [-350.775] (-349.646) -- 0:00:17
707000 -- (-349.147) (-355.560) [-349.077] (-348.940) * [-354.061] (-349.495) (-353.097) (-350.381) -- 0:00:17
707500 -- [-349.055] (-350.847) (-351.020) (-348.940) * (-350.300) (-351.111) (-350.947) [-349.452] -- 0:00:17
708000 -- (-349.260) (-349.919) (-350.960) [-350.443] * (-348.889) [-349.335] (-349.504) (-353.499) -- 0:00:17
708500 -- (-351.828) [-352.698] (-349.547) (-350.049) * (-349.353) (-350.994) [-352.141] (-356.507) -- 0:00:17
709000 -- (-350.136) (-349.642) (-350.751) [-352.033] * (-349.876) (-350.725) [-348.723] (-352.145) -- 0:00:17
709500 -- (-350.099) [-350.603] (-350.354) (-349.968) * (-351.097) (-351.400) [-348.589] (-351.824) -- 0:00:17
710000 -- (-352.843) (-350.973) (-348.484) [-350.469] * (-350.343) (-351.643) [-348.976] (-349.708) -- 0:00:17
Average standard deviation of split frequencies: 0.005859
710500 -- (-348.943) (-350.633) (-349.050) [-350.121] * (-350.383) (-351.123) (-352.060) [-349.234] -- 0:00:17
711000 -- (-348.945) [-350.191] (-348.920) (-350.275) * (-350.518) (-350.436) [-349.598] (-349.868) -- 0:00:17
711500 -- [-348.810] (-349.981) (-349.596) (-352.022) * (-349.240) (-349.326) (-350.267) [-350.601] -- 0:00:17
712000 -- (-349.987) [-348.039] (-348.998) (-351.655) * (-349.041) (-349.115) [-349.422] (-348.574) -- 0:00:16
712500 -- (-351.468) [-348.323] (-351.228) (-352.177) * (-350.088) (-350.366) [-349.727] (-347.960) -- 0:00:16
713000 -- [-349.263] (-349.116) (-349.787) (-348.601) * (-349.639) (-348.219) [-348.435] (-349.898) -- 0:00:16
713500 -- (-356.727) (-348.476) (-351.711) [-349.078] * (-348.778) (-351.967) (-349.566) [-349.139] -- 0:00:16
714000 -- (-350.039) [-351.884] (-349.000) (-349.469) * (-351.955) (-351.562) [-350.349] (-350.109) -- 0:00:16
714500 -- (-352.185) [-352.381] (-349.600) (-349.385) * (-352.203) (-351.628) [-351.014] (-350.148) -- 0:00:16
715000 -- (-353.294) [-349.560] (-349.525) (-352.090) * (-351.111) (-350.708) [-348.699] (-351.646) -- 0:00:16
Average standard deviation of split frequencies: 0.006197
715500 -- (-351.638) (-348.395) (-352.269) [-348.874] * (-352.921) [-351.143] (-349.801) (-350.138) -- 0:00:16
716000 -- [-349.840] (-351.048) (-350.327) (-349.333) * (-350.375) (-348.945) (-351.520) [-352.485] -- 0:00:16
716500 -- (-353.668) (-352.153) (-350.961) [-349.556] * (-350.314) (-351.403) [-348.872] (-351.061) -- 0:00:16
717000 -- (-354.437) (-349.196) [-348.813] (-349.859) * (-348.650) [-349.318] (-349.150) (-349.375) -- 0:00:16
717500 -- (-353.941) (-358.433) [-349.461] (-350.528) * (-348.038) (-350.730) [-352.580] (-349.641) -- 0:00:16
718000 -- (-349.728) (-350.676) (-349.605) [-348.985] * (-348.933) [-350.300] (-353.636) (-350.952) -- 0:00:16
718500 -- (-356.651) (-350.672) (-350.378) [-351.787] * (-348.525) (-351.838) [-351.529] (-348.466) -- 0:00:16
719000 -- (-348.453) (-349.468) [-348.894] (-350.667) * [-350.326] (-349.395) (-348.785) (-349.780) -- 0:00:16
719500 -- (-349.617) [-349.187] (-351.982) (-352.914) * (-350.403) (-350.914) [-348.550] (-349.417) -- 0:00:16
720000 -- (-354.955) [-348.818] (-352.535) (-349.274) * (-351.637) (-349.442) [-349.485] (-349.366) -- 0:00:16
Average standard deviation of split frequencies: 0.006118
720500 -- (-353.516) (-350.531) (-349.566) [-351.004] * (-349.486) [-352.807] (-353.361) (-349.668) -- 0:00:16
721000 -- (-348.567) (-354.368) [-349.757] (-350.550) * (-349.225) (-351.106) (-351.235) [-349.636] -- 0:00:16
721500 -- (-355.273) (-351.237) (-347.967) [-350.845] * (-349.242) (-353.211) (-351.034) [-349.976] -- 0:00:16
722000 -- (-350.178) (-348.521) (-348.294) [-349.457] * (-349.521) (-352.196) (-352.349) [-352.944] -- 0:00:16
722500 -- (-348.313) [-349.074] (-350.493) (-352.303) * (-350.593) (-350.526) [-348.447] (-350.291) -- 0:00:16
723000 -- [-348.488] (-351.794) (-348.953) (-350.382) * (-352.297) (-349.602) [-350.156] (-353.691) -- 0:00:16
723500 -- (-350.905) [-350.315] (-349.571) (-349.878) * (-348.630) [-349.218] (-350.087) (-349.044) -- 0:00:16
724000 -- (-350.299) [-352.442] (-350.279) (-351.322) * (-347.997) (-348.972) [-350.106] (-348.914) -- 0:00:16
724500 -- (-349.169) (-349.539) (-350.286) [-351.128] * (-348.802) [-349.686] (-351.168) (-353.899) -- 0:00:16
725000 -- (-350.396) [-351.755] (-352.474) (-350.704) * (-349.614) (-348.227) [-351.277] (-349.138) -- 0:00:16
Average standard deviation of split frequencies: 0.006035
725500 -- (-351.965) [-348.720] (-349.892) (-350.536) * (-348.462) [-348.279] (-350.818) (-352.576) -- 0:00:16
726000 -- (-349.970) [-348.766] (-351.105) (-349.399) * (-348.931) (-348.517) (-354.698) [-349.473] -- 0:00:16
726500 -- (-351.155) (-352.817) (-350.662) [-349.522] * (-348.883) [-349.508] (-349.817) (-348.762) -- 0:00:16
727000 -- (-351.757) (-350.497) [-352.823] (-348.570) * (-348.594) [-354.994] (-351.102) (-349.030) -- 0:00:16
727500 -- [-349.120] (-348.257) (-349.932) (-351.091) * [-349.033] (-353.215) (-355.451) (-350.100) -- 0:00:16
728000 -- (-351.849) (-348.670) (-349.897) [-349.296] * (-349.551) [-348.393] (-351.324) (-348.865) -- 0:00:16
728500 -- (-350.596) (-352.338) (-349.686) [-349.621] * (-349.892) [-348.512] (-351.116) (-350.629) -- 0:00:16
729000 -- [-352.317] (-350.117) (-349.199) (-350.043) * (-352.043) (-349.916) [-348.868] (-351.838) -- 0:00:15
729500 -- (-353.854) [-350.264] (-348.892) (-352.945) * (-352.770) (-348.730) [-353.442] (-351.827) -- 0:00:15
730000 -- (-351.006) (-351.676) (-349.474) [-351.239] * (-349.916) (-348.829) [-348.550] (-349.472) -- 0:00:15
Average standard deviation of split frequencies: 0.006072
730500 -- (-348.779) (-351.833) [-349.865] (-349.235) * (-349.130) [-351.174] (-349.202) (-351.151) -- 0:00:15
731000 -- (-348.986) (-352.213) [-352.850] (-352.003) * (-349.873) [-349.301] (-351.580) (-352.270) -- 0:00:15
731500 -- (-351.940) [-349.625] (-350.850) (-349.459) * (-350.453) (-351.065) [-348.784] (-349.812) -- 0:00:15
732000 -- (-350.097) (-349.088) (-350.431) [-349.197] * (-350.169) (-352.159) (-350.582) [-349.078] -- 0:00:15
732500 -- (-348.811) [-348.893] (-350.723) (-347.984) * (-350.091) [-349.355] (-349.937) (-348.866) -- 0:00:15
733000 -- (-350.330) (-349.144) (-349.384) [-350.725] * (-348.794) [-350.030] (-353.803) (-351.690) -- 0:00:15
733500 -- (-349.756) [-351.278] (-353.518) (-358.619) * (-348.417) [-349.433] (-351.251) (-350.769) -- 0:00:15
734000 -- (-349.199) (-349.445) [-354.770] (-349.904) * [-351.383] (-349.977) (-349.866) (-356.032) -- 0:00:15
734500 -- [-349.779] (-353.284) (-351.802) (-349.063) * (-351.451) (-352.367) (-353.711) [-352.084] -- 0:00:15
735000 -- [-350.926] (-351.318) (-355.094) (-350.311) * (-349.666) (-351.892) (-348.408) [-350.816] -- 0:00:15
Average standard deviation of split frequencies: 0.005564
735500 -- (-351.491) (-352.869) (-350.655) [-350.656] * (-348.948) (-352.597) [-351.221] (-354.723) -- 0:00:15
736000 -- (-350.079) (-352.809) [-349.263] (-349.729) * (-348.855) [-349.442] (-351.817) (-348.544) -- 0:00:15
736500 -- (-349.407) (-351.147) [-350.623] (-350.024) * (-352.831) (-351.332) [-349.184] (-352.809) -- 0:00:15
737000 -- (-348.460) (-348.222) (-350.866) [-351.743] * (-350.348) (-350.753) (-349.062) [-348.441] -- 0:00:15
737500 -- (-348.455) [-350.978] (-355.784) (-350.966) * (-351.295) [-349.779] (-351.894) (-348.314) -- 0:00:15
738000 -- (-348.891) (-350.978) (-356.523) [-351.374] * (-348.216) (-349.266) (-350.770) [-348.068] -- 0:00:15
738500 -- (-351.045) (-350.330) (-350.800) [-351.139] * (-349.486) (-349.395) (-350.894) [-349.908] -- 0:00:15
739000 -- (-349.785) (-354.112) [-348.665] (-353.084) * (-353.336) [-349.411] (-349.367) (-351.380) -- 0:00:15
739500 -- (-351.029) (-350.570) (-351.401) [-348.485] * (-350.265) [-350.180] (-349.631) (-352.449) -- 0:00:15
740000 -- (-349.462) [-348.779] (-351.058) (-349.114) * (-349.076) [-348.396] (-349.687) (-348.695) -- 0:00:15
Average standard deviation of split frequencies: 0.005768
740500 -- [-349.220] (-352.058) (-349.898) (-349.873) * (-351.299) (-350.223) [-350.900] (-350.576) -- 0:00:15
741000 -- (-349.372) (-349.898) (-352.152) [-349.060] * (-350.080) (-348.584) (-352.709) [-350.963] -- 0:00:15
741500 -- [-349.412] (-355.069) (-350.305) (-350.095) * (-349.924) (-348.618) (-351.466) [-349.148] -- 0:00:15
742000 -- [-351.819] (-352.277) (-348.692) (-351.673) * (-352.059) (-352.109) (-351.021) [-349.923] -- 0:00:15
742500 -- [-350.702] (-350.333) (-350.222) (-348.272) * [-349.481] (-349.186) (-349.892) (-348.938) -- 0:00:15
743000 -- (-348.965) (-351.198) [-348.716] (-348.390) * [-349.640] (-348.633) (-349.226) (-349.469) -- 0:00:15
743500 -- (-351.468) [-349.741] (-348.344) (-352.151) * (-350.142) (-350.880) [-349.955] (-348.322) -- 0:00:15
744000 -- (-348.791) (-352.666) (-352.316) [-352.044] * (-350.239) (-353.497) [-348.851] (-350.620) -- 0:00:15
744500 -- (-350.112) [-351.119] (-348.954) (-349.587) * (-352.663) (-351.316) (-351.118) [-349.125] -- 0:00:15
745000 -- (-352.347) (-350.411) [-349.464] (-350.019) * (-351.526) (-350.974) (-349.880) [-348.811] -- 0:00:15
Average standard deviation of split frequencies: 0.005648
745500 -- (-353.523) (-351.472) [-348.319] (-349.354) * (-350.252) (-352.678) (-352.826) [-348.407] -- 0:00:15
746000 -- (-351.476) [-349.455] (-351.094) (-350.638) * [-348.853] (-350.235) (-349.150) (-348.744) -- 0:00:14
746500 -- (-349.738) (-349.916) [-351.462] (-351.897) * (-354.678) (-355.345) [-349.469] (-349.543) -- 0:00:14
747000 -- [-349.073] (-350.113) (-348.215) (-353.362) * (-354.433) (-350.584) [-350.457] (-352.784) -- 0:00:14
747500 -- [-349.205] (-348.553) (-348.338) (-351.812) * (-349.774) (-352.654) (-348.821) [-352.204] -- 0:00:14
748000 -- [-351.063] (-349.863) (-349.725) (-351.849) * (-348.291) (-350.423) (-353.388) [-351.106] -- 0:00:14
748500 -- (-350.095) [-348.552] (-348.348) (-355.864) * (-352.966) (-350.186) (-350.741) [-350.760] -- 0:00:14
749000 -- (-351.664) [-351.293] (-349.966) (-356.750) * (-352.311) [-349.204] (-349.992) (-350.318) -- 0:00:14
749500 -- (-354.613) [-349.076] (-348.763) (-356.900) * (-350.323) (-351.052) [-349.425] (-350.995) -- 0:00:14
750000 -- [-349.518] (-354.031) (-353.511) (-354.015) * (-349.316) [-349.102] (-350.084) (-352.101) -- 0:00:14
Average standard deviation of split frequencies: 0.006070
750500 -- (-349.552) [-351.136] (-352.370) (-351.471) * (-349.216) [-350.498] (-350.729) (-354.181) -- 0:00:14
751000 -- [-350.619] (-353.961) (-351.387) (-350.453) * (-349.278) (-348.103) (-351.861) [-349.633] -- 0:00:14
751500 -- (-349.858) (-350.467) [-350.436] (-350.681) * (-352.601) (-350.602) (-350.146) [-350.231] -- 0:00:14
752000 -- (-352.913) (-359.126) (-350.418) [-351.275] * (-352.433) (-351.432) (-348.358) [-348.639] -- 0:00:14
752500 -- (-351.949) (-351.642) [-353.596] (-353.269) * [-351.168] (-350.325) (-352.403) (-348.985) -- 0:00:14
753000 -- (-350.889) (-350.004) (-352.877) [-352.760] * (-349.529) (-349.656) [-351.890] (-349.705) -- 0:00:14
753500 -- (-352.518) (-350.581) (-352.208) [-348.488] * (-353.145) (-351.076) (-350.910) [-349.602] -- 0:00:14
754000 -- (-350.591) (-350.373) (-350.762) [-354.848] * [-353.222] (-348.399) (-351.708) (-351.523) -- 0:00:14
754500 -- [-348.990] (-351.121) (-350.122) (-351.963) * (-354.023) (-351.115) [-351.082] (-350.075) -- 0:00:14
755000 -- (-349.529) (-350.407) (-349.286) [-349.019] * [-351.462] (-349.169) (-349.509) (-350.665) -- 0:00:14
Average standard deviation of split frequencies: 0.005945
755500 -- (-350.073) (-351.333) (-354.419) [-349.866] * (-351.128) (-350.742) [-349.993] (-348.739) -- 0:00:14
756000 -- [-349.001] (-354.071) (-352.765) (-351.076) * (-350.931) [-350.922] (-348.240) (-357.374) -- 0:00:14
756500 -- [-349.004] (-350.399) (-349.922) (-351.916) * (-352.761) (-350.092) [-349.556] (-349.760) -- 0:00:14
757000 -- [-349.683] (-348.450) (-349.737) (-348.939) * [-351.256] (-352.226) (-350.387) (-348.525) -- 0:00:14
757500 -- (-349.733) (-348.409) [-350.775] (-349.125) * (-355.193) (-349.054) [-349.643] (-349.609) -- 0:00:14
758000 -- (-350.694) (-351.150) (-351.901) [-349.569] * (-352.674) (-350.007) (-350.145) [-349.531] -- 0:00:14
758500 -- (-350.670) (-349.122) [-349.759] (-353.233) * (-350.701) [-349.657] (-352.873) (-350.232) -- 0:00:14
759000 -- [-349.094] (-348.879) (-348.726) (-352.569) * (-350.975) (-348.545) (-353.180) [-350.536] -- 0:00:14
759500 -- (-351.128) (-349.974) [-350.124] (-352.385) * (-351.577) (-350.266) [-353.261] (-349.144) -- 0:00:14
760000 -- (-351.163) (-350.723) (-351.826) [-352.283] * (-351.473) [-349.665] (-349.715) (-353.928) -- 0:00:14
Average standard deviation of split frequencies: 0.005743
760500 -- (-352.281) (-349.101) (-354.822) [-348.701] * (-350.422) (-354.366) [-349.406] (-354.774) -- 0:00:14
761000 -- [-350.619] (-351.699) (-356.529) (-351.207) * [-354.895] (-349.332) (-350.371) (-349.887) -- 0:00:14
761500 -- (-350.794) (-349.375) [-348.873] (-351.353) * (-350.785) (-349.845) (-349.339) [-350.935] -- 0:00:14
762000 -- (-354.039) (-348.914) [-348.892] (-348.973) * (-351.053) (-353.031) (-350.765) [-351.121] -- 0:00:14
762500 -- (-354.940) (-350.093) [-349.155] (-350.331) * [-348.740] (-349.219) (-350.655) (-351.800) -- 0:00:14
763000 -- [-352.371] (-349.398) (-352.107) (-349.682) * (-349.774) (-352.212) (-348.713) [-351.827] -- 0:00:13
763500 -- (-351.775) (-350.304) [-349.955] (-352.505) * [-349.797] (-352.723) (-348.224) (-353.923) -- 0:00:13
764000 -- [-350.072] (-350.410) (-351.170) (-349.494) * [-348.374] (-350.707) (-348.735) (-352.796) -- 0:00:13
764500 -- [-349.311] (-348.551) (-350.521) (-353.663) * [-351.033] (-348.899) (-350.603) (-354.490) -- 0:00:13
765000 -- (-349.468) [-350.684] (-349.267) (-350.586) * (-350.071) (-349.302) [-350.185] (-355.198) -- 0:00:13
Average standard deviation of split frequencies: 0.006154
765500 -- (-350.149) (-351.061) (-349.095) [-348.587] * (-350.868) (-349.610) (-351.891) [-350.122] -- 0:00:13
766000 -- (-349.875) (-350.766) (-349.570) [-348.813] * (-352.822) [-353.739] (-357.055) (-349.181) -- 0:00:13
766500 -- [-349.654] (-355.158) (-350.360) (-348.551) * [-349.520] (-350.734) (-355.474) (-349.529) -- 0:00:13
767000 -- [-351.193] (-348.613) (-349.000) (-348.824) * (-351.168) (-350.268) (-350.060) [-348.962] -- 0:00:13
767500 -- (-351.229) [-353.522] (-349.495) (-349.081) * (-350.241) (-349.162) (-350.161) [-351.593] -- 0:00:13
768000 -- [-349.921] (-349.959) (-352.870) (-348.521) * (-350.100) (-349.905) [-349.152] (-350.167) -- 0:00:13
768500 -- (-350.570) (-349.772) (-352.897) [-348.831] * (-349.238) (-353.496) (-349.385) [-349.955] -- 0:00:13
769000 -- (-351.424) (-349.427) (-351.707) [-348.579] * (-349.274) (-351.963) (-348.723) [-347.906] -- 0:00:13
769500 -- (-353.901) (-349.915) (-352.614) [-349.983] * (-350.106) [-349.911] (-349.052) (-348.685) -- 0:00:13
770000 -- (-349.397) (-352.167) [-349.916] (-352.690) * (-349.259) [-350.344] (-349.830) (-348.466) -- 0:00:13
Average standard deviation of split frequencies: 0.006308
770500 -- (-349.483) [-350.798] (-348.425) (-349.622) * (-351.013) [-352.652] (-351.987) (-348.855) -- 0:00:13
771000 -- [-348.736] (-358.729) (-349.131) (-350.188) * [-348.936] (-351.312) (-348.916) (-350.079) -- 0:00:13
771500 -- (-349.052) (-348.371) (-350.160) [-348.994] * [-349.917] (-348.974) (-351.095) (-348.962) -- 0:00:13
772000 -- (-350.029) (-351.203) [-349.956] (-349.107) * [-353.308] (-349.152) (-351.124) (-349.212) -- 0:00:13
772500 -- (-350.080) (-351.862) [-350.291] (-349.017) * (-349.130) (-349.739) (-351.155) [-349.424] -- 0:00:13
773000 -- (-349.766) (-351.247) [-354.819] (-350.390) * (-349.383) (-351.484) [-352.011] (-352.193) -- 0:00:13
773500 -- (-351.528) (-353.475) [-349.037] (-350.401) * (-350.233) [-350.570] (-350.007) (-348.926) -- 0:00:13
774000 -- [-350.638] (-350.684) (-348.790) (-349.755) * [-349.141] (-352.319) (-350.019) (-348.917) -- 0:00:13
774500 -- [-348.595] (-351.756) (-349.850) (-351.912) * [-348.987] (-352.801) (-351.442) (-348.686) -- 0:00:13
775000 -- (-351.575) [-349.745] (-350.645) (-348.838) * (-356.877) (-350.532) [-349.534] (-349.395) -- 0:00:13
Average standard deviation of split frequencies: 0.006265
775500 -- (-353.330) (-348.541) [-349.149] (-348.320) * [-349.817] (-355.577) (-352.727) (-350.893) -- 0:00:13
776000 -- (-354.004) [-350.250] (-350.324) (-349.871) * (-350.641) (-354.925) (-350.196) [-349.947] -- 0:00:13
776500 -- [-353.200] (-355.374) (-350.956) (-350.033) * [-348.991] (-353.560) (-349.364) (-350.488) -- 0:00:13
777000 -- (-352.029) (-351.830) (-348.667) [-352.455] * (-350.575) (-352.228) [-349.959] (-352.006) -- 0:00:13
777500 -- [-351.196] (-350.919) (-349.789) (-352.580) * (-352.459) [-350.164] (-349.498) (-350.243) -- 0:00:13
778000 -- (-355.917) [-349.915] (-350.341) (-352.487) * (-348.758) (-349.241) [-349.527] (-349.909) -- 0:00:13
778500 -- [-350.460] (-350.305) (-348.519) (-350.631) * (-350.931) (-349.295) (-350.889) [-353.044] -- 0:00:13
779000 -- (-349.786) (-348.897) [-350.596] (-349.399) * (-348.531) (-349.717) (-351.510) [-352.641] -- 0:00:13
779500 -- (-351.471) [-350.395] (-354.970) (-354.242) * (-349.767) [-348.825] (-350.761) (-351.463) -- 0:00:13
780000 -- (-348.962) [-351.344] (-349.454) (-357.813) * (-351.839) (-349.556) (-352.518) [-350.396] -- 0:00:12
Average standard deviation of split frequencies: 0.006378
780500 -- [-349.531] (-349.219) (-350.263) (-355.002) * (-354.519) (-350.790) (-351.748) [-350.652] -- 0:00:12
781000 -- (-348.871) [-349.127] (-351.284) (-357.139) * (-351.217) (-348.415) (-349.313) [-349.143] -- 0:00:12
781500 -- (-349.716) (-350.229) [-350.253] (-358.808) * (-352.654) [-348.617] (-349.856) (-356.557) -- 0:00:12
782000 -- [-349.127] (-351.929) (-350.549) (-351.654) * (-349.535) (-349.392) (-348.398) [-349.812] -- 0:00:12
782500 -- (-350.138) (-350.256) (-350.976) [-348.643] * (-348.873) [-349.303] (-353.691) (-348.631) -- 0:00:12
783000 -- (-348.677) (-347.952) (-350.447) [-349.393] * (-348.829) [-352.266] (-355.069) (-349.694) -- 0:00:12
783500 -- (-350.041) [-349.201] (-350.980) (-352.229) * (-353.534) (-352.579) [-352.764] (-351.932) -- 0:00:12
784000 -- (-352.541) (-350.213) [-349.243] (-352.238) * (-353.922) (-352.786) [-349.789] (-350.981) -- 0:00:12
784500 -- [-350.862] (-353.590) (-350.662) (-351.929) * [-352.793] (-351.389) (-355.209) (-350.594) -- 0:00:12
785000 -- (-349.310) (-351.362) [-350.919] (-352.502) * (-353.378) (-351.317) (-358.411) [-354.561] -- 0:00:12
Average standard deviation of split frequencies: 0.006485
785500 -- (-348.585) (-351.610) [-352.765] (-350.327) * (-349.882) (-349.182) (-362.838) [-349.408] -- 0:00:12
786000 -- [-355.225] (-351.012) (-351.294) (-353.074) * (-351.844) (-349.432) (-352.626) [-349.367] -- 0:00:12
786500 -- (-351.318) (-350.081) (-350.232) [-351.673] * [-349.981] (-349.924) (-351.774) (-350.431) -- 0:00:12
787000 -- (-350.882) [-350.533] (-349.901) (-349.152) * (-349.131) (-349.562) [-349.109] (-352.817) -- 0:00:12
787500 -- (-350.692) (-349.841) (-349.554) [-347.986] * (-352.049) (-348.698) [-349.448] (-350.370) -- 0:00:12
788000 -- [-349.848] (-351.457) (-350.035) (-349.762) * (-351.415) (-349.953) (-349.097) [-350.611] -- 0:00:12
788500 -- (-350.564) (-353.867) [-349.471] (-349.322) * (-351.450) (-349.590) [-351.448] (-352.045) -- 0:00:12
789000 -- (-349.714) (-352.259) (-348.928) [-350.844] * (-350.256) (-348.772) (-352.299) [-353.820] -- 0:00:12
789500 -- (-349.594) (-353.498) [-350.047] (-350.467) * [-352.210] (-349.818) (-350.909) (-350.030) -- 0:00:12
790000 -- (-354.233) (-351.332) [-348.790] (-348.846) * [-351.107] (-350.162) (-348.749) (-350.243) -- 0:00:12
Average standard deviation of split frequencies: 0.006558
790500 -- [-351.692] (-348.415) (-352.677) (-349.530) * (-349.381) (-349.562) [-351.727] (-351.051) -- 0:00:12
791000 -- (-351.834) (-349.023) [-349.913] (-351.855) * (-349.387) [-351.842] (-352.273) (-349.633) -- 0:00:12
791500 -- [-349.268] (-349.743) (-353.798) (-352.094) * (-348.589) (-351.653) [-349.348] (-351.822) -- 0:00:12
792000 -- (-349.795) (-350.489) (-352.472) [-351.575] * (-349.976) [-348.889] (-349.783) (-349.867) -- 0:00:12
792500 -- (-351.941) [-349.433] (-349.951) (-350.694) * (-349.925) (-348.917) [-348.728] (-350.652) -- 0:00:12
793000 -- [-348.507] (-349.029) (-349.156) (-349.666) * [-350.524] (-348.671) (-348.363) (-351.157) -- 0:00:12
793500 -- (-348.727) (-349.179) (-350.076) [-348.872] * (-351.228) (-348.761) [-350.871] (-352.359) -- 0:00:12
794000 -- (-349.966) [-350.299] (-350.430) (-348.295) * (-351.164) (-348.534) (-352.253) [-348.619] -- 0:00:12
794500 -- [-350.707] (-351.937) (-351.676) (-350.841) * (-350.992) (-349.332) (-350.500) [-348.453] -- 0:00:12
795000 -- (-349.440) [-350.618] (-349.708) (-351.029) * [-348.653] (-348.768) (-348.924) (-356.972) -- 0:00:12
Average standard deviation of split frequencies: 0.006292
795500 -- (-348.481) [-350.524] (-349.305) (-352.114) * (-350.146) (-349.290) (-349.093) [-356.008] -- 0:00:12
796000 -- [-350.174] (-349.655) (-349.469) (-352.013) * (-351.653) (-349.087) [-350.106] (-351.972) -- 0:00:12
796500 -- (-350.542) (-351.867) (-349.877) [-348.446] * (-350.768) [-349.479] (-353.455) (-351.843) -- 0:00:12
797000 -- [-349.680] (-349.367) (-350.469) (-349.286) * (-349.872) [-348.743] (-348.453) (-348.778) -- 0:00:11
797500 -- (-354.791) (-349.092) [-351.943] (-353.694) * (-354.814) (-353.045) (-349.787) [-350.331] -- 0:00:11
798000 -- (-355.188) (-348.769) (-350.732) [-351.618] * (-351.796) (-352.090) [-351.041] (-349.619) -- 0:00:11
798500 -- (-351.709) [-351.928] (-349.670) (-348.735) * [-351.836] (-349.730) (-350.099) (-351.347) -- 0:00:11
799000 -- [-351.071] (-350.138) (-351.234) (-351.851) * (-354.157) (-349.213) [-350.012] (-350.204) -- 0:00:11
799500 -- (-350.868) [-349.498] (-352.324) (-350.503) * (-352.694) (-348.680) (-353.338) [-349.164] -- 0:00:11
800000 -- (-353.218) (-353.468) [-352.321] (-351.737) * (-349.730) [-352.007] (-352.656) (-349.659) -- 0:00:11
Average standard deviation of split frequencies: 0.006366
800500 -- [-348.822] (-350.571) (-349.610) (-349.115) * [-348.945] (-351.003) (-351.555) (-353.100) -- 0:00:11
801000 -- (-353.461) (-350.611) (-350.859) [-350.199] * (-349.241) [-350.817] (-348.806) (-351.684) -- 0:00:11
801500 -- (-354.331) [-349.808] (-350.628) (-351.857) * [-351.539] (-350.466) (-352.148) (-349.888) -- 0:00:11
802000 -- [-348.900] (-350.937) (-355.822) (-348.943) * (-349.903) (-348.169) (-349.739) [-349.319] -- 0:00:11
802500 -- (-348.668) [-348.273] (-353.212) (-351.265) * (-352.972) (-348.092) [-350.350] (-351.122) -- 0:00:11
803000 -- (-348.989) (-349.335) [-352.688] (-349.937) * [-348.926] (-349.247) (-349.563) (-354.777) -- 0:00:11
803500 -- (-351.072) (-349.738) (-350.030) [-349.539] * [-351.726] (-348.824) (-349.518) (-352.530) -- 0:00:11
804000 -- (-352.580) [-350.049] (-350.118) (-349.145) * [-350.171] (-355.592) (-350.564) (-353.102) -- 0:00:11
804500 -- (-352.077) [-351.631] (-349.351) (-351.116) * [-353.206] (-349.015) (-351.377) (-351.671) -- 0:00:11
805000 -- (-358.273) (-351.262) (-349.744) [-350.526] * (-349.704) [-349.343] (-351.295) (-349.310) -- 0:00:11
Average standard deviation of split frequencies: 0.007018
805500 -- (-349.815) (-351.844) (-350.567) [-348.734] * [-350.682] (-354.326) (-349.007) (-350.304) -- 0:00:11
806000 -- (-351.786) (-350.906) (-351.937) [-349.095] * (-350.148) (-351.844) (-354.972) [-350.110] -- 0:00:11
806500 -- (-353.021) (-351.401) [-349.566] (-352.145) * (-349.287) (-348.231) (-350.305) [-347.938] -- 0:00:11
807000 -- (-350.374) (-353.541) [-349.406] (-350.002) * (-351.713) (-353.335) [-350.142] (-348.007) -- 0:00:11
807500 -- (-349.492) (-350.297) (-350.283) [-351.165] * (-351.827) [-351.648] (-348.523) (-349.516) -- 0:00:11
808000 -- (-350.234) (-348.130) [-350.593] (-354.060) * (-350.269) (-351.854) [-350.531] (-350.853) -- 0:00:11
808500 -- (-351.041) (-349.548) [-349.982] (-351.994) * (-351.921) (-355.942) (-352.544) [-349.514] -- 0:00:11
809000 -- (-350.002) [-353.151] (-350.366) (-351.365) * (-349.699) (-352.925) [-350.315] (-351.008) -- 0:00:11
809500 -- (-354.198) [-349.627] (-354.480) (-349.714) * [-349.764] (-352.992) (-357.131) (-349.749) -- 0:00:11
810000 -- (-353.520) [-350.839] (-353.351) (-348.846) * (-351.689) [-352.146] (-349.501) (-348.249) -- 0:00:11
Average standard deviation of split frequencies: 0.006942
810500 -- (-348.448) (-351.369) (-353.950) [-349.824] * [-351.683] (-349.168) (-349.995) (-352.106) -- 0:00:11
811000 -- [-349.529] (-355.351) (-351.149) (-349.981) * (-350.104) (-350.363) [-350.964] (-350.963) -- 0:00:11
811500 -- [-349.416] (-351.780) (-349.548) (-354.953) * (-349.797) (-353.061) [-349.370] (-349.576) -- 0:00:11
812000 -- (-351.107) (-350.726) (-350.519) [-352.214] * (-350.817) (-355.525) [-351.980] (-349.157) -- 0:00:11
812500 -- (-348.772) (-350.129) (-351.510) [-354.163] * [-354.817] (-353.257) (-351.075) (-349.545) -- 0:00:11
813000 -- (-350.454) (-351.904) [-350.772] (-348.901) * (-353.013) (-352.051) [-350.273] (-348.712) -- 0:00:11
813500 -- (-355.308) [-351.269] (-353.595) (-349.311) * (-352.890) [-349.032] (-348.716) (-349.510) -- 0:00:11
814000 -- (-352.809) (-349.181) [-350.069] (-356.303) * [-351.740] (-351.513) (-353.691) (-348.970) -- 0:00:10
814500 -- (-351.463) (-349.542) (-350.251) [-352.301] * (-349.531) (-352.758) [-349.607] (-351.406) -- 0:00:10
815000 -- (-349.636) [-350.988] (-348.228) (-351.075) * [-350.607] (-349.268) (-349.236) (-351.493) -- 0:00:10
Average standard deviation of split frequencies: 0.007113
815500 -- (-350.097) (-349.568) [-350.055] (-348.544) * [-348.926] (-349.107) (-351.962) (-349.725) -- 0:00:10
816000 -- (-350.298) [-350.847] (-351.068) (-348.495) * [-349.935] (-348.933) (-351.796) (-348.933) -- 0:00:10
816500 -- (-351.955) (-349.016) [-348.886] (-351.032) * (-349.912) (-348.603) (-350.624) [-349.028] -- 0:00:10
817000 -- [-348.857] (-352.439) (-351.673) (-348.584) * [-355.150] (-349.323) (-351.079) (-351.361) -- 0:00:10
817500 -- (-350.086) [-350.314] (-354.664) (-349.468) * (-349.986) (-349.190) (-349.812) [-351.888] -- 0:00:10
818000 -- (-349.391) (-350.176) [-356.586] (-350.425) * [-350.604] (-351.300) (-351.294) (-351.830) -- 0:00:10
818500 -- (-351.423) (-351.513) (-350.153) [-350.431] * (-350.455) [-348.590] (-349.946) (-350.581) -- 0:00:10
819000 -- (-349.649) (-350.044) (-350.412) [-356.656] * [-349.615] (-350.169) (-348.973) (-348.943) -- 0:00:10
819500 -- (-348.542) (-352.662) [-349.081] (-349.461) * [-348.486] (-350.188) (-348.478) (-351.015) -- 0:00:10
820000 -- (-351.422) (-350.136) (-348.640) [-351.023] * [-353.945] (-348.794) (-350.912) (-352.292) -- 0:00:10
Average standard deviation of split frequencies: 0.007396
820500 -- (-349.199) (-350.097) [-352.273] (-351.621) * (-350.091) [-348.651] (-348.702) (-351.811) -- 0:00:10
821000 -- (-349.743) (-348.951) [-349.518] (-349.389) * [-348.564] (-349.064) (-349.182) (-350.590) -- 0:00:10
821500 -- [-348.051] (-351.010) (-351.632) (-351.894) * [-349.873] (-348.694) (-349.206) (-350.354) -- 0:00:10
822000 -- (-353.848) (-352.958) (-353.917) [-348.495] * (-349.336) [-349.980] (-349.990) (-351.304) -- 0:00:10
822500 -- [-353.327] (-352.114) (-348.840) (-350.443) * (-348.404) (-349.404) (-350.803) [-351.514] -- 0:00:10
823000 -- (-351.129) (-350.156) (-351.167) [-349.227] * (-349.005) (-349.386) [-348.707] (-347.959) -- 0:00:10
823500 -- [-350.690] (-351.112) (-349.438) (-350.892) * (-350.688) (-353.728) (-351.164) [-350.405] -- 0:00:10
824000 -- [-349.783] (-348.377) (-350.544) (-348.640) * [-348.936] (-350.724) (-349.865) (-349.448) -- 0:00:10
824500 -- (-349.088) (-352.738) (-348.426) [-349.120] * (-348.744) [-350.046] (-350.367) (-351.358) -- 0:00:10
825000 -- (-348.964) (-349.086) (-351.260) [-349.385] * [-349.090] (-349.716) (-350.362) (-351.039) -- 0:00:10
Average standard deviation of split frequencies: 0.007633
825500 -- (-348.423) [-350.362] (-355.126) (-354.915) * (-349.036) [-352.241] (-352.935) (-348.750) -- 0:00:10
826000 -- (-350.770) [-351.202] (-358.998) (-349.255) * (-351.984) [-349.745] (-349.172) (-348.664) -- 0:00:10
826500 -- (-348.575) [-348.888] (-353.253) (-348.591) * (-349.475) [-350.480] (-354.888) (-348.885) -- 0:00:10
827000 -- (-350.053) (-348.638) [-348.420] (-348.389) * (-349.151) [-357.758] (-351.163) (-355.707) -- 0:00:10
827500 -- (-348.568) [-351.007] (-350.897) (-350.399) * [-350.141] (-352.147) (-350.066) (-353.188) -- 0:00:10
828000 -- (-348.382) (-348.996) [-355.879] (-352.215) * (-350.220) (-352.611) (-349.146) [-348.756] -- 0:00:10
828500 -- (-349.810) [-349.386] (-350.895) (-349.841) * [-348.797] (-354.048) (-349.023) (-349.091) -- 0:00:10
829000 -- (-349.469) (-352.112) [-352.736] (-351.913) * (-349.058) (-349.695) (-350.649) [-350.879] -- 0:00:10
829500 -- (-349.925) (-352.493) (-350.177) [-349.738] * (-349.211) (-350.135) [-348.925] (-348.618) -- 0:00:10
830000 -- (-350.557) (-352.762) (-350.046) [-349.500] * (-348.715) (-351.952) (-354.843) [-349.553] -- 0:00:10
Average standard deviation of split frequencies: 0.007874
830500 -- (-349.043) (-350.791) [-349.096] (-349.910) * [-350.808] (-348.949) (-348.487) (-351.810) -- 0:00:10
831000 -- (-350.362) [-349.613] (-351.137) (-349.968) * [-350.292] (-348.576) (-350.344) (-351.227) -- 0:00:09
831500 -- (-351.247) (-348.713) [-348.846] (-353.228) * (-354.588) [-349.143] (-349.589) (-349.589) -- 0:00:09
832000 -- (-348.955) (-350.065) [-348.707] (-350.381) * (-351.265) (-348.872) [-350.223] (-348.219) -- 0:00:09
832500 -- (-351.291) [-352.120] (-349.561) (-351.773) * (-350.292) (-348.604) [-348.790] (-349.267) -- 0:00:09
833000 -- (-349.161) (-351.960) (-353.034) [-355.310] * (-349.507) (-351.481) [-350.057] (-348.736) -- 0:00:09
833500 -- (-349.107) [-352.333] (-355.991) (-352.582) * (-348.756) [-349.209] (-354.770) (-348.477) -- 0:00:09
834000 -- (-348.348) (-349.075) [-349.867] (-352.490) * (-353.064) (-351.663) (-351.347) [-350.395] -- 0:00:09
834500 -- (-352.762) (-352.560) [-348.213] (-350.288) * (-352.846) (-350.122) (-349.839) [-350.863] -- 0:00:09
835000 -- (-354.262) [-350.816] (-350.762) (-350.229) * [-351.697] (-349.950) (-348.807) (-348.938) -- 0:00:09
Average standard deviation of split frequencies: 0.007894
835500 -- (-351.445) [-348.590] (-349.711) (-349.913) * (-350.465) (-349.013) (-350.643) [-349.928] -- 0:00:09
836000 -- (-349.841) (-349.905) [-349.298] (-352.294) * (-352.017) (-349.511) [-352.327] (-351.387) -- 0:00:09
836500 -- [-352.613] (-349.686) (-349.454) (-348.719) * [-350.391] (-350.187) (-348.169) (-349.804) -- 0:00:09
837000 -- [-350.472] (-350.484) (-352.967) (-352.682) * [-352.694] (-351.345) (-353.279) (-349.603) -- 0:00:09
837500 -- (-350.652) [-350.498] (-348.299) (-351.796) * (-350.597) [-347.967] (-349.293) (-356.773) -- 0:00:09
838000 -- (-350.038) (-348.595) (-348.284) [-351.278] * [-351.439] (-353.575) (-356.169) (-349.921) -- 0:00:09
838500 -- (-351.345) (-349.734) (-349.841) [-349.725] * [-351.505] (-350.479) (-350.930) (-349.416) -- 0:00:09
839000 -- (-353.267) (-349.271) (-351.653) [-351.826] * (-349.628) (-350.028) [-350.051] (-351.110) -- 0:00:09
839500 -- (-351.029) (-354.156) (-350.515) [-352.013] * [-348.308] (-350.455) (-352.128) (-350.731) -- 0:00:09
840000 -- (-350.232) (-349.773) (-348.871) [-349.460] * (-350.875) [-351.103] (-350.113) (-353.389) -- 0:00:09
Average standard deviation of split frequencies: 0.007851
840500 -- [-349.253] (-348.448) (-350.252) (-349.796) * (-348.577) [-349.455] (-348.262) (-350.353) -- 0:00:09
841000 -- [-349.704] (-355.805) (-357.324) (-351.849) * [-349.352] (-349.898) (-356.010) (-351.510) -- 0:00:09
841500 -- (-350.525) (-350.414) (-351.362) [-348.915] * (-354.378) (-349.073) (-349.774) [-349.795] -- 0:00:09
842000 -- (-352.810) (-350.092) (-352.136) [-348.346] * (-355.864) (-351.596) (-348.496) [-349.474] -- 0:00:09
842500 -- (-351.214) (-349.586) [-350.576] (-349.893) * [-350.637] (-353.498) (-352.391) (-351.992) -- 0:00:09
843000 -- (-354.123) (-349.891) [-353.421] (-350.148) * (-351.016) (-351.221) [-348.159] (-351.888) -- 0:00:09
843500 -- (-352.067) (-348.466) [-349.867] (-351.724) * [-349.412] (-349.355) (-351.286) (-352.213) -- 0:00:09
844000 -- (-357.674) (-349.077) (-348.887) [-351.333] * [-350.137] (-348.633) (-354.728) (-354.477) -- 0:00:09
844500 -- (-353.731) [-350.881] (-348.528) (-354.032) * (-348.671) [-349.042] (-349.392) (-349.748) -- 0:00:09
845000 -- (-348.556) [-348.763] (-353.802) (-352.207) * (-349.659) (-351.767) [-357.327] (-349.462) -- 0:00:09
Average standard deviation of split frequencies: 0.007662
845500 -- (-349.568) (-354.999) [-350.912] (-354.754) * [-349.429] (-352.083) (-349.385) (-350.422) -- 0:00:09
846000 -- (-359.014) (-349.265) (-351.542) [-350.055] * (-349.951) (-349.178) [-351.467] (-351.085) -- 0:00:09
846500 -- (-353.820) (-350.434) [-350.124] (-353.264) * (-349.874) (-351.754) [-351.777] (-349.773) -- 0:00:09
847000 -- (-354.105) (-348.686) [-350.756] (-355.707) * (-348.279) (-351.556) [-350.257] (-348.660) -- 0:00:09
847500 -- [-351.195] (-349.649) (-349.602) (-350.940) * [-351.175] (-352.174) (-347.944) (-348.482) -- 0:00:08
848000 -- [-349.494] (-349.222) (-349.034) (-349.366) * (-348.816) (-352.562) [-350.264] (-349.175) -- 0:00:08
848500 -- [-353.131] (-349.313) (-351.711) (-350.243) * [-351.052] (-349.446) (-349.955) (-348.911) -- 0:00:08
849000 -- [-348.295] (-349.982) (-351.506) (-348.221) * [-351.553] (-351.054) (-353.893) (-349.365) -- 0:00:08
849500 -- (-349.617) (-349.672) [-352.395] (-349.531) * [-349.944] (-351.273) (-349.662) (-348.859) -- 0:00:08
850000 -- (-350.504) (-350.750) [-352.511] (-351.662) * (-350.309) (-348.445) [-348.237] (-352.899) -- 0:00:08
Average standard deviation of split frequencies: 0.007481
850500 -- (-349.968) (-349.312) [-352.131] (-349.125) * [-351.060] (-354.733) (-349.605) (-353.873) -- 0:00:08
851000 -- (-350.710) (-350.082) [-349.727] (-348.078) * [-348.766] (-352.471) (-348.536) (-349.561) -- 0:00:08
851500 -- (-351.430) (-348.309) (-351.292) [-349.576] * (-356.228) (-353.436) [-349.580] (-349.062) -- 0:00:08
852000 -- (-352.089) (-351.254) (-349.929) [-349.201] * (-355.744) (-350.261) (-352.573) [-348.800] -- 0:00:08
852500 -- [-351.389] (-354.545) (-349.266) (-348.938) * [-351.509] (-349.026) (-349.571) (-352.499) -- 0:00:08
853000 -- (-349.580) [-348.319] (-349.613) (-349.084) * [-350.108] (-355.332) (-348.973) (-355.009) -- 0:00:08
853500 -- (-349.413) (-350.407) [-348.847] (-351.230) * [-348.853] (-351.183) (-351.809) (-350.125) -- 0:00:08
854000 -- (-349.537) [-349.755] (-350.466) (-351.793) * (-351.263) (-349.965) (-350.950) [-348.874] -- 0:00:08
854500 -- (-352.379) (-351.635) [-348.516] (-349.790) * (-349.334) (-349.977) [-349.053] (-350.763) -- 0:00:08
855000 -- (-351.694) (-350.097) (-349.373) [-348.736] * (-348.249) (-350.412) [-350.217] (-352.381) -- 0:00:08
Average standard deviation of split frequencies: 0.007572
855500 -- (-350.245) (-350.002) (-348.183) [-349.420] * (-349.243) (-350.165) (-352.666) [-349.966] -- 0:00:08
856000 -- [-349.088] (-352.051) (-353.265) (-351.667) * [-353.507] (-349.078) (-351.585) (-349.355) -- 0:00:08
856500 -- [-350.126] (-352.243) (-352.789) (-349.094) * (-349.497) (-352.793) [-351.196] (-353.571) -- 0:00:08
857000 -- [-349.611] (-352.371) (-349.022) (-348.646) * (-349.802) (-349.697) (-350.636) [-350.209] -- 0:00:08
857500 -- (-350.389) (-356.392) (-349.877) [-349.399] * [-349.511] (-350.599) (-353.818) (-349.397) -- 0:00:08
858000 -- (-354.741) (-348.694) (-355.997) [-350.720] * (-351.121) (-349.830) [-354.745] (-349.117) -- 0:00:08
858500 -- (-354.094) (-351.103) (-350.218) [-347.889] * (-351.003) (-353.752) [-352.106] (-351.035) -- 0:00:08
859000 -- (-350.306) (-353.910) (-348.742) [-348.927] * [-348.454] (-355.850) (-351.393) (-351.859) -- 0:00:08
859500 -- (-351.909) (-349.650) (-348.929) [-348.843] * (-349.055) (-350.280) [-350.255] (-349.330) -- 0:00:08
860000 -- (-349.810) (-351.084) (-351.700) [-348.544] * (-352.343) (-351.328) [-349.994] (-350.463) -- 0:00:08
Average standard deviation of split frequencies: 0.007531
860500 -- [-349.798] (-350.799) (-349.211) (-349.593) * [-350.438] (-349.531) (-350.609) (-349.889) -- 0:00:08
861000 -- (-350.328) (-350.473) (-348.765) [-350.746] * [-350.354] (-351.920) (-350.297) (-356.925) -- 0:00:08
861500 -- [-350.739] (-351.627) (-349.066) (-349.380) * (-352.971) (-351.052) [-350.073] (-350.881) -- 0:00:08
862000 -- (-352.407) [-348.437] (-350.185) (-350.071) * [-351.312] (-353.457) (-348.343) (-351.482) -- 0:00:08
862500 -- (-350.394) [-348.563] (-350.806) (-349.382) * [-354.866] (-349.484) (-351.865) (-349.318) -- 0:00:08
863000 -- (-350.797) [-351.328] (-349.818) (-348.555) * (-350.029) (-350.739) [-351.879] (-350.401) -- 0:00:08
863500 -- [-350.231] (-349.521) (-351.770) (-349.806) * (-351.444) (-351.215) [-349.783] (-350.033) -- 0:00:08
864000 -- [-351.328] (-348.270) (-349.180) (-355.070) * [-350.649] (-348.153) (-352.037) (-350.202) -- 0:00:08
864500 -- (-349.079) (-350.182) [-348.443] (-349.978) * (-350.049) (-349.494) [-348.634] (-350.742) -- 0:00:07
865000 -- (-349.361) (-351.684) [-348.683] (-348.149) * (-348.907) [-352.868] (-350.576) (-349.472) -- 0:00:07
Average standard deviation of split frequencies: 0.007451
865500 -- (-353.296) (-353.217) [-350.657] (-351.487) * (-350.827) [-352.847] (-349.367) (-348.534) -- 0:00:07
866000 -- (-351.614) (-353.983) [-353.298] (-351.176) * (-348.939) [-351.855] (-349.340) (-350.130) -- 0:00:07
866500 -- (-349.910) [-353.133] (-350.596) (-350.682) * (-349.153) [-350.798] (-349.887) (-354.523) -- 0:00:07
867000 -- (-353.399) [-350.063] (-350.950) (-350.767) * (-348.400) (-349.251) [-350.711] (-350.504) -- 0:00:07
867500 -- (-351.172) (-348.336) (-349.430) [-352.981] * (-349.060) (-350.834) [-350.675] (-348.786) -- 0:00:07
868000 -- (-349.141) [-349.734] (-351.041) (-350.827) * (-349.770) [-350.252] (-350.378) (-348.316) -- 0:00:07
868500 -- (-350.631) (-348.755) [-349.543] (-351.343) * [-348.665] (-351.868) (-350.839) (-354.386) -- 0:00:07
869000 -- (-348.692) [-349.304] (-347.956) (-350.643) * (-350.029) (-350.320) [-351.379] (-350.028) -- 0:00:07
869500 -- (-348.136) (-351.177) (-349.651) [-351.631] * (-349.860) [-348.428] (-349.886) (-351.668) -- 0:00:07
870000 -- [-348.540] (-351.238) (-349.455) (-354.577) * (-355.764) (-349.595) [-349.752] (-350.431) -- 0:00:07
Average standard deviation of split frequencies: 0.007309
870500 -- (-349.618) (-349.672) [-350.795] (-350.429) * (-349.936) [-349.119] (-354.628) (-354.601) -- 0:00:07
871000 -- (-349.143) [-351.668] (-352.972) (-352.316) * (-350.156) (-350.065) (-351.401) [-348.914] -- 0:00:07
871500 -- (-348.820) (-353.372) (-351.414) [-350.827] * (-351.087) (-350.131) [-348.829] (-350.325) -- 0:00:07
872000 -- [-348.491] (-351.467) (-350.175) (-351.001) * (-349.495) (-352.371) (-349.555) [-348.361] -- 0:00:07
872500 -- (-349.667) [-351.567] (-350.508) (-349.745) * (-349.068) (-351.394) [-349.342] (-349.064) -- 0:00:07
873000 -- [-351.687] (-349.619) (-348.517) (-350.695) * (-349.306) (-350.429) (-348.921) [-351.261] -- 0:00:07
873500 -- (-351.611) (-348.941) [-353.329] (-351.318) * (-354.139) (-350.188) [-349.046] (-349.982) -- 0:00:07
874000 -- (-349.059) [-349.470] (-352.303) (-349.834) * (-352.003) (-351.361) (-351.061) [-350.277] -- 0:00:07
874500 -- (-350.542) (-354.556) (-348.952) [-350.996] * [-350.476] (-350.078) (-349.825) (-348.226) -- 0:00:07
875000 -- [-348.175] (-349.508) (-349.729) (-349.560) * [-349.694] (-351.199) (-348.968) (-352.231) -- 0:00:07
Average standard deviation of split frequencies: 0.007198
875500 -- [-348.932] (-350.741) (-348.781) (-348.512) * (-350.297) (-349.027) [-349.987] (-351.559) -- 0:00:07
876000 -- (-356.527) [-347.982] (-349.633) (-349.951) * (-348.635) (-351.687) [-349.652] (-352.260) -- 0:00:07
876500 -- (-352.687) (-348.000) (-349.500) [-351.223] * (-349.451) (-349.394) [-352.592] (-351.847) -- 0:00:07
877000 -- (-360.574) [-348.571] (-350.054) (-349.506) * (-349.050) (-349.104) (-351.531) [-348.323] -- 0:00:07
877500 -- (-353.810) [-348.859] (-352.170) (-351.964) * [-350.538] (-349.152) (-349.047) (-351.684) -- 0:00:07
878000 -- (-350.656) [-348.479] (-350.824) (-353.308) * (-351.671) [-349.947] (-348.309) (-350.421) -- 0:00:07
878500 -- (-348.534) (-349.008) [-348.835] (-351.798) * (-348.468) [-351.358] (-349.045) (-350.776) -- 0:00:07
879000 -- (-354.974) [-348.345] (-351.182) (-357.564) * (-349.051) (-348.886) (-349.166) [-352.205] -- 0:00:07
879500 -- (-351.621) (-348.994) [-351.893] (-352.343) * [-351.943] (-353.693) (-348.498) (-353.147) -- 0:00:07
880000 -- (-356.822) (-348.958) (-351.915) [-348.409] * (-348.056) (-352.531) (-350.163) [-348.302] -- 0:00:07
Average standard deviation of split frequencies: 0.007494
880500 -- (-348.264) (-349.853) [-351.198] (-349.229) * (-349.909) [-348.535] (-351.407) (-353.113) -- 0:00:07
881000 -- [-349.935] (-349.109) (-349.236) (-352.017) * (-349.062) (-351.304) (-352.987) [-349.861] -- 0:00:07
881500 -- (-349.979) [-351.568] (-351.494) (-350.774) * (-350.270) (-350.510) [-351.803] (-352.740) -- 0:00:06
882000 -- (-350.143) (-353.559) (-351.202) [-349.126] * (-351.485) (-348.815) [-349.897] (-349.933) -- 0:00:06
882500 -- (-350.556) (-351.965) (-349.441) [-347.997] * [-350.059] (-348.422) (-351.179) (-350.276) -- 0:00:06
883000 -- (-351.711) (-348.822) (-349.916) [-348.249] * (-353.181) (-350.112) (-349.400) [-350.117] -- 0:00:06
883500 -- (-351.316) (-352.520) [-352.372] (-349.449) * (-350.246) [-349.997] (-352.184) (-351.881) -- 0:00:06
884000 -- [-351.208] (-348.233) (-349.983) (-348.899) * (-350.212) (-348.700) (-352.663) [-350.157] -- 0:00:06
884500 -- (-350.536) (-358.322) [-350.965] (-352.770) * (-349.847) (-350.753) (-351.108) [-349.970] -- 0:00:06
885000 -- (-349.561) (-349.259) [-353.871] (-351.101) * (-350.035) (-349.522) [-353.230] (-350.576) -- 0:00:06
Average standard deviation of split frequencies: 0.007549
885500 -- (-349.225) [-350.484] (-350.224) (-348.690) * (-351.517) (-349.932) (-349.026) [-349.813] -- 0:00:06
886000 -- (-350.557) [-350.906] (-350.724) (-353.257) * (-351.619) (-351.999) [-348.828] (-348.959) -- 0:00:06
886500 -- (-350.938) (-349.898) [-349.183] (-351.019) * [-349.055] (-350.280) (-349.576) (-349.575) -- 0:00:06
887000 -- (-349.992) (-351.245) [-351.179] (-350.527) * (-349.425) [-350.152] (-349.823) (-349.993) -- 0:00:06
887500 -- (-350.648) [-348.077] (-351.032) (-349.645) * (-349.442) [-353.261] (-357.486) (-351.180) -- 0:00:06
888000 -- (-349.119) [-350.567] (-348.629) (-350.393) * (-349.610) [-348.833] (-348.520) (-352.873) -- 0:00:06
888500 -- (-349.784) (-353.243) (-348.825) [-349.573] * (-352.500) (-353.692) [-347.968] (-349.570) -- 0:00:06
889000 -- (-354.526) [-348.957] (-352.076) (-350.932) * [-353.700] (-350.734) (-348.474) (-349.396) -- 0:00:06
889500 -- (-350.706) [-352.808] (-348.974) (-349.516) * (-348.584) (-355.304) [-350.352] (-348.684) -- 0:00:06
890000 -- [-353.175] (-348.471) (-351.593) (-350.213) * (-349.990) [-348.933] (-350.566) (-356.700) -- 0:00:06
Average standard deviation of split frequencies: 0.007542
890500 -- (-350.989) (-349.656) [-353.503] (-349.818) * (-351.506) [-351.038] (-350.046) (-353.660) -- 0:00:06
891000 -- (-349.176) [-348.632] (-353.575) (-356.005) * (-348.870) (-351.121) [-351.380] (-349.859) -- 0:00:06
891500 -- (-351.526) [-349.248] (-349.124) (-354.293) * [-348.277] (-351.364) (-350.941) (-355.356) -- 0:00:06
892000 -- (-354.400) [-349.133] (-352.068) (-353.698) * (-349.548) [-350.529] (-349.220) (-351.471) -- 0:00:06
892500 -- (-351.534) [-352.321] (-348.968) (-349.397) * (-353.472) (-352.596) (-348.213) [-351.420] -- 0:00:06
893000 -- (-351.611) (-354.144) [-351.187] (-349.446) * [-349.142] (-357.834) (-349.551) (-350.699) -- 0:00:06
893500 -- (-350.120) [-350.250] (-350.125) (-353.743) * (-349.374) [-350.512] (-349.957) (-349.987) -- 0:00:06
894000 -- (-352.696) (-351.925) (-357.759) [-352.951] * [-349.540] (-354.069) (-350.432) (-350.974) -- 0:00:06
894500 -- (-349.668) (-350.086) [-354.224] (-348.920) * (-348.829) (-351.583) [-350.109] (-348.711) -- 0:00:06
895000 -- [-348.982] (-355.248) (-349.305) (-351.207) * (-348.232) [-351.701] (-352.180) (-349.372) -- 0:00:06
Average standard deviation of split frequencies: 0.007760
895500 -- (-352.650) (-349.799) (-349.546) [-350.316] * (-348.681) (-353.889) [-350.530] (-351.041) -- 0:00:06
896000 -- (-351.956) (-350.696) [-349.085] (-349.554) * (-349.633) (-353.900) (-350.801) [-358.543] -- 0:00:06
896500 -- (-349.718) (-351.776) (-348.024) [-349.321] * (-352.159) (-349.921) (-349.598) [-354.674] -- 0:00:06
897000 -- [-351.464] (-352.277) (-355.866) (-350.819) * [-351.124] (-351.008) (-356.327) (-354.350) -- 0:00:06
897500 -- [-352.207] (-349.717) (-355.083) (-353.148) * (-348.591) (-354.964) (-350.722) [-354.425] -- 0:00:06
898000 -- (-351.142) (-350.351) (-353.812) [-351.003] * (-350.133) [-353.671] (-349.872) (-351.536) -- 0:00:06
898500 -- (-348.334) (-353.811) (-350.124) [-349.550] * (-348.246) [-353.058] (-350.624) (-353.096) -- 0:00:05
899000 -- [-350.200] (-350.707) (-350.368) (-348.808) * [-350.328] (-353.121) (-350.448) (-350.333) -- 0:00:05
899500 -- [-349.739] (-351.002) (-353.364) (-350.786) * (-348.271) (-349.968) (-350.835) [-353.083] -- 0:00:05
900000 -- [-349.687] (-351.567) (-350.276) (-351.725) * (-349.542) (-349.450) [-350.723] (-350.416) -- 0:00:05
Average standard deviation of split frequencies: 0.007884
900500 -- [-349.712] (-349.996) (-348.301) (-349.734) * (-349.025) (-348.871) (-348.664) [-349.378] -- 0:00:05
901000 -- (-352.527) (-348.840) [-349.528] (-353.909) * (-351.781) (-348.700) [-348.634] (-347.973) -- 0:00:05
901500 -- (-349.881) [-350.558] (-352.422) (-350.061) * [-352.893] (-348.959) (-349.942) (-350.278) -- 0:00:05
902000 -- (-351.181) (-350.470) (-352.727) [-352.508] * (-350.167) (-352.369) [-351.624] (-350.100) -- 0:00:05
902500 -- (-354.639) (-349.698) (-349.053) [-349.197] * (-350.293) [-352.951] (-348.943) (-350.377) -- 0:00:05
903000 -- (-352.147) [-350.797] (-349.637) (-354.666) * (-348.307) [-352.669] (-349.670) (-349.738) -- 0:00:05
903500 -- (-351.578) (-351.789) [-349.985] (-352.651) * [-348.733] (-351.559) (-349.329) (-353.024) -- 0:00:05
904000 -- [-350.919] (-350.806) (-348.464) (-353.389) * (-351.709) (-355.016) [-351.373] (-353.799) -- 0:00:05
904500 -- (-348.611) (-350.647) [-349.620] (-352.100) * (-348.636) (-353.134) [-349.924] (-348.067) -- 0:00:05
905000 -- [-350.027] (-354.119) (-355.715) (-349.929) * (-348.740) (-349.099) (-349.789) [-348.112] -- 0:00:05
Average standard deviation of split frequencies: 0.007870
905500 -- (-352.858) [-352.249] (-350.524) (-349.971) * (-348.247) (-349.396) (-350.275) [-353.432] -- 0:00:05
906000 -- (-352.237) (-352.271) [-350.198] (-348.393) * [-349.314] (-348.359) (-349.738) (-351.637) -- 0:00:05
906500 -- [-348.978] (-348.480) (-349.904) (-350.575) * (-350.841) (-350.473) (-350.344) [-348.010] -- 0:00:05
907000 -- (-350.892) [-353.050] (-348.168) (-350.094) * (-351.547) (-353.190) [-348.652] (-348.664) -- 0:00:05
907500 -- [-349.922] (-350.815) (-349.940) (-349.603) * (-349.772) (-351.189) [-348.544] (-349.060) -- 0:00:05
908000 -- (-350.932) (-350.881) [-351.622] (-353.165) * (-349.909) (-356.577) [-352.982] (-350.699) -- 0:00:05
908500 -- (-348.939) [-349.856] (-350.634) (-349.446) * (-351.668) (-353.328) [-351.441] (-351.405) -- 0:00:05
909000 -- [-348.575] (-350.338) (-351.104) (-348.639) * (-354.784) [-350.944] (-350.903) (-350.246) -- 0:00:05
909500 -- (-350.995) (-349.651) (-348.402) [-350.692] * (-350.003) (-350.133) [-349.422] (-351.522) -- 0:00:05
910000 -- [-350.398] (-349.462) (-351.120) (-349.181) * (-350.141) (-354.860) [-350.869] (-351.722) -- 0:00:05
Average standard deviation of split frequencies: 0.007506
910500 -- (-352.013) (-351.219) (-349.046) [-348.016] * (-351.822) (-351.733) (-351.834) [-351.803] -- 0:00:05
911000 -- (-350.782) (-352.187) (-350.139) [-349.908] * (-349.564) (-353.146) [-350.332] (-349.119) -- 0:00:05
911500 -- (-352.080) (-355.941) [-351.685] (-348.251) * (-353.027) (-349.776) (-355.308) [-350.602] -- 0:00:05
912000 -- (-352.299) (-351.864) [-349.706] (-348.378) * [-353.144] (-350.730) (-354.425) (-350.821) -- 0:00:05
912500 -- (-351.180) (-352.814) [-350.236] (-350.395) * (-349.081) (-350.539) (-354.290) [-348.735] -- 0:00:05
913000 -- (-350.824) (-351.685) [-350.447] (-350.723) * (-352.963) [-353.001] (-353.884) (-354.552) -- 0:00:05
913500 -- (-352.260) (-351.179) (-352.684) [-349.912] * (-348.554) (-349.112) [-349.618] (-357.913) -- 0:00:05
914000 -- (-349.661) (-350.648) [-349.561] (-349.522) * [-348.436] (-351.911) (-355.557) (-350.390) -- 0:00:05
914500 -- (-349.780) [-351.469] (-349.711) (-351.032) * (-349.578) [-349.602] (-348.354) (-348.708) -- 0:00:05
915000 -- (-349.562) (-349.520) (-351.426) [-354.396] * (-350.349) (-351.809) (-348.792) [-349.839] -- 0:00:05
Average standard deviation of split frequencies: 0.007334
915500 -- (-350.598) (-350.123) (-351.320) [-350.532] * (-351.136) (-349.361) [-349.817] (-351.245) -- 0:00:04
916000 -- (-352.545) (-350.323) (-348.670) [-349.106] * [-350.371] (-349.162) (-351.741) (-350.941) -- 0:00:04
916500 -- (-354.078) (-349.330) [-349.862] (-350.172) * (-350.978) (-350.773) [-349.470] (-348.215) -- 0:00:04
917000 -- (-350.908) [-348.199] (-356.514) (-350.670) * (-349.929) (-349.621) (-351.567) [-353.092] -- 0:00:04
917500 -- (-352.072) (-349.028) (-353.543) [-351.139] * (-348.258) (-352.631) [-351.479] (-350.542) -- 0:00:04
918000 -- (-352.820) [-348.894] (-351.229) (-349.358) * (-351.351) (-352.229) [-353.421] (-349.859) -- 0:00:04
918500 -- [-351.446] (-349.517) (-352.541) (-351.924) * (-349.245) [-353.085] (-349.362) (-353.257) -- 0:00:04
919000 -- (-350.824) [-350.700] (-351.117) (-351.108) * (-349.058) [-352.507] (-349.163) (-350.203) -- 0:00:04
919500 -- (-352.797) (-348.391) (-348.348) [-353.698] * (-352.037) (-353.161) [-348.570] (-350.724) -- 0:00:04
920000 -- (-353.338) (-350.546) (-349.112) [-350.702] * (-350.416) [-350.694] (-349.648) (-358.972) -- 0:00:04
Average standard deviation of split frequencies: 0.007552
920500 -- (-350.768) (-351.102) [-350.759] (-352.406) * (-350.989) [-349.316] (-353.001) (-351.524) -- 0:00:04
921000 -- [-349.180] (-352.620) (-351.048) (-348.064) * [-349.158] (-348.376) (-357.733) (-349.710) -- 0:00:04
921500 -- (-350.508) (-355.949) [-349.477] (-348.331) * (-352.029) [-348.866] (-355.382) (-352.222) -- 0:00:04
922000 -- (-351.387) (-351.639) (-349.814) [-349.952] * (-350.274) (-354.947) (-351.700) [-349.953] -- 0:00:04
922500 -- (-349.733) (-351.971) (-352.715) [-348.802] * (-349.112) (-348.671) [-350.309] (-350.808) -- 0:00:04
923000 -- [-349.266] (-349.218) (-349.755) (-353.366) * (-349.513) (-354.656) (-349.324) [-350.652] -- 0:00:04
923500 -- (-349.029) [-350.176] (-349.829) (-352.641) * (-348.408) (-349.952) [-348.873] (-354.090) -- 0:00:04
924000 -- (-348.586) [-349.680] (-351.552) (-351.392) * (-348.554) (-349.942) [-348.001] (-351.368) -- 0:00:04
924500 -- [-351.309] (-353.572) (-351.959) (-352.585) * (-348.959) (-350.567) [-348.113] (-353.182) -- 0:00:04
925000 -- (-350.776) (-352.454) (-348.375) [-348.296] * (-349.256) (-355.116) (-351.717) [-353.258] -- 0:00:04
Average standard deviation of split frequencies: 0.007286
925500 -- (-350.001) (-352.036) (-349.886) [-348.094] * (-349.813) (-353.049) (-349.692) [-351.968] -- 0:00:04
926000 -- [-349.420] (-351.966) (-348.478) (-348.144) * (-348.481) [-353.032] (-352.699) (-349.429) -- 0:00:04
926500 -- [-350.918] (-348.274) (-353.860) (-348.399) * [-350.871] (-351.562) (-355.680) (-349.053) -- 0:00:04
927000 -- (-349.202) [-348.017] (-354.343) (-349.652) * [-349.186] (-350.218) (-355.353) (-352.522) -- 0:00:04
927500 -- (-352.995) (-349.006) [-350.618] (-349.766) * (-349.124) [-348.651] (-352.653) (-352.474) -- 0:00:04
928000 -- (-348.877) (-348.660) (-349.393) [-348.618] * (-350.614) [-349.883] (-353.639) (-352.695) -- 0:00:04
928500 -- (-348.516) (-350.867) (-348.588) [-351.901] * [-350.279] (-348.880) (-351.876) (-351.068) -- 0:00:04
929000 -- [-348.977] (-349.668) (-348.380) (-349.473) * [-350.642] (-351.672) (-353.342) (-349.206) -- 0:00:04
929500 -- [-352.006] (-348.608) (-349.155) (-351.229) * (-350.878) (-349.444) [-349.158] (-350.203) -- 0:00:04
930000 -- (-350.116) (-353.991) [-354.273] (-351.229) * [-355.371] (-350.156) (-351.095) (-349.790) -- 0:00:04
Average standard deviation of split frequencies: 0.007091
930500 -- (-352.120) [-350.920] (-351.389) (-353.226) * (-348.462) (-348.686) (-351.403) [-349.476] -- 0:00:04
931000 -- (-349.688) [-349.930] (-353.399) (-352.152) * (-350.054) (-351.431) [-349.521] (-351.547) -- 0:00:04
931500 -- [-349.578] (-349.811) (-351.236) (-355.811) * (-349.432) [-350.365] (-350.724) (-348.280) -- 0:00:04
932000 -- (-348.630) (-354.162) [-364.881] (-349.522) * (-353.001) [-350.125] (-349.897) (-348.241) -- 0:00:04
932500 -- (-353.371) (-349.832) [-351.890] (-357.624) * (-349.008) [-349.843] (-351.949) (-350.989) -- 0:00:03
933000 -- (-348.737) [-348.856] (-350.055) (-353.955) * (-355.219) (-349.480) (-350.272) [-348.997] -- 0:00:03
933500 -- [-349.039] (-349.847) (-349.582) (-352.843) * (-354.439) [-350.904] (-348.234) (-350.279) -- 0:00:03
934000 -- (-354.157) (-350.787) [-349.466] (-348.710) * (-350.511) (-350.300) (-348.935) [-352.288] -- 0:00:03
934500 -- (-351.763) (-352.581) (-348.867) [-348.189] * (-350.148) (-349.499) [-349.015] (-350.600) -- 0:00:03
935000 -- [-348.772] (-349.581) (-354.355) (-349.360) * (-349.583) (-350.133) [-348.870] (-352.013) -- 0:00:03
Average standard deviation of split frequencies: 0.007347
935500 -- (-349.493) (-350.521) (-349.919) [-348.566] * [-349.037] (-352.184) (-352.282) (-352.541) -- 0:00:03
936000 -- (-349.939) (-350.347) (-351.830) [-349.138] * (-350.581) [-350.094] (-353.829) (-350.230) -- 0:00:03
936500 -- (-349.264) [-349.333] (-349.828) (-349.335) * (-350.663) (-350.707) [-351.034] (-352.023) -- 0:00:03
937000 -- (-349.348) (-350.383) (-348.540) [-352.101] * [-351.000] (-348.179) (-352.608) (-349.584) -- 0:00:03
937500 -- (-349.363) (-350.811) (-349.299) [-353.917] * (-349.856) (-349.003) [-348.202] (-348.578) -- 0:00:03
938000 -- (-349.857) (-350.382) (-352.495) [-349.982] * (-349.028) (-353.706) (-348.232) [-349.891] -- 0:00:03
938500 -- [-350.258] (-350.330) (-352.013) (-356.807) * [-351.405] (-349.687) (-350.485) (-349.011) -- 0:00:03
939000 -- [-348.985] (-350.288) (-350.287) (-351.324) * [-351.992] (-348.676) (-350.555) (-350.595) -- 0:00:03
939500 -- (-352.192) [-349.235] (-349.389) (-349.355) * [-354.283] (-350.080) (-350.368) (-349.549) -- 0:00:03
940000 -- (-349.169) (-351.583) (-350.545) [-349.331] * (-352.512) (-349.516) [-348.890] (-351.147) -- 0:00:03
Average standard deviation of split frequencies: 0.007281
940500 -- (-350.378) (-355.717) [-348.825] (-349.654) * (-350.559) [-350.581] (-348.985) (-352.009) -- 0:00:03
941000 -- (-353.516) [-349.299] (-350.118) (-350.871) * (-351.855) (-350.721) [-348.955] (-348.165) -- 0:00:03
941500 -- (-352.011) [-348.563] (-351.595) (-349.650) * (-353.217) [-349.024] (-351.160) (-348.457) -- 0:00:03
942000 -- (-351.443) (-349.586) [-351.896] (-349.673) * (-350.924) [-348.287] (-352.421) (-349.645) -- 0:00:03
942500 -- (-349.685) (-351.672) [-350.572] (-348.877) * (-349.319) (-348.424) [-351.480] (-353.944) -- 0:00:03
943000 -- (-354.874) [-356.546] (-349.049) (-348.891) * (-349.872) (-348.696) (-349.023) [-353.443] -- 0:00:03
943500 -- [-353.776] (-351.013) (-349.357) (-349.101) * (-352.332) (-351.287) (-348.705) [-350.497] -- 0:00:03
944000 -- (-350.960) [-349.886] (-349.960) (-350.140) * (-350.999) [-350.845] (-351.070) (-348.867) -- 0:00:03
944500 -- (-348.802) (-349.436) [-350.343] (-350.365) * [-352.447] (-349.618) (-350.438) (-351.972) -- 0:00:03
945000 -- (-347.993) (-349.556) (-348.295) [-350.650] * (-350.412) (-350.094) [-349.397] (-351.693) -- 0:00:03
Average standard deviation of split frequencies: 0.007328
945500 -- (-348.412) [-352.287] (-350.067) (-350.391) * (-350.016) (-348.335) (-348.118) [-349.851] -- 0:00:03
946000 -- (-355.676) [-354.601] (-350.398) (-348.659) * (-350.258) [-350.925] (-348.776) (-349.512) -- 0:00:03
946500 -- (-352.621) (-352.653) (-351.724) [-352.129] * [-351.079] (-353.433) (-349.178) (-353.340) -- 0:00:03
947000 -- (-356.198) (-352.584) [-350.776] (-349.400) * (-352.028) [-352.154] (-348.469) (-349.970) -- 0:00:03
947500 -- (-349.120) [-349.707] (-351.769) (-350.353) * (-349.230) [-349.181] (-352.648) (-349.981) -- 0:00:03
948000 -- [-350.527] (-350.716) (-351.965) (-353.399) * (-351.714) (-348.230) (-349.151) [-351.861] -- 0:00:03
948500 -- (-350.371) (-348.188) (-352.053) [-350.505] * [-351.432] (-349.584) (-354.391) (-348.457) -- 0:00:03
949000 -- (-348.583) (-351.096) [-351.057] (-352.207) * (-350.099) [-348.962] (-350.114) (-351.349) -- 0:00:03
949500 -- (-350.235) [-350.465] (-348.947) (-352.247) * (-352.727) [-352.403] (-348.899) (-348.317) -- 0:00:02
950000 -- (-351.369) [-348.736] (-348.815) (-349.918) * [-353.163] (-348.897) (-353.946) (-349.099) -- 0:00:02
Average standard deviation of split frequencies: 0.007409
950500 -- (-353.370) [-349.040] (-349.016) (-350.165) * [-351.549] (-352.120) (-348.792) (-353.317) -- 0:00:02
951000 -- (-351.265) [-348.775] (-349.452) (-350.421) * (-351.185) (-352.392) (-349.684) [-350.400] -- 0:00:02
951500 -- (-351.594) (-348.905) (-348.391) [-349.440] * (-352.026) (-351.811) [-348.630] (-349.091) -- 0:00:02
952000 -- (-351.926) [-348.543] (-349.433) (-353.418) * (-352.144) (-348.674) (-352.567) [-350.307] -- 0:00:02
952500 -- (-350.914) (-353.599) [-348.299] (-350.136) * [-350.257] (-349.842) (-348.866) (-349.841) -- 0:00:02
953000 -- (-350.305) [-349.496] (-348.726) (-353.769) * (-349.817) (-350.469) (-349.467) [-349.283] -- 0:00:02
953500 -- (-350.051) [-350.857] (-349.399) (-350.916) * [-350.879] (-349.578) (-352.286) (-349.878) -- 0:00:02
954000 -- (-349.027) (-352.385) (-347.911) [-349.990] * [-352.095] (-349.246) (-352.750) (-356.520) -- 0:00:02
954500 -- (-351.088) (-352.637) (-349.910) [-349.964] * (-348.727) (-348.806) (-355.166) [-348.258] -- 0:00:02
955000 -- (-348.772) (-351.882) (-352.143) [-349.276] * [-353.647] (-350.759) (-352.019) (-349.659) -- 0:00:02
Average standard deviation of split frequencies: 0.007077
955500 -- (-354.663) (-351.565) (-348.783) [-349.839] * (-352.453) (-349.500) (-348.372) [-351.002] -- 0:00:02
956000 -- (-351.790) [-348.520] (-351.762) (-352.381) * [-348.659] (-348.606) (-349.452) (-350.197) -- 0:00:02
956500 -- (-348.618) (-353.354) (-350.634) [-349.466] * (-348.925) (-352.279) (-353.880) [-348.284] -- 0:00:02
957000 -- (-349.431) (-349.467) [-348.484] (-348.250) * (-350.791) [-351.676] (-357.545) (-348.169) -- 0:00:02
957500 -- [-349.018] (-349.039) (-351.949) (-348.990) * [-349.952] (-350.187) (-352.358) (-349.824) -- 0:00:02
958000 -- [-350.462] (-349.102) (-352.285) (-349.348) * [-352.026] (-349.973) (-351.292) (-349.961) -- 0:00:02
958500 -- (-352.416) [-352.881] (-349.851) (-350.793) * (-349.739) (-351.243) (-350.950) [-349.778] -- 0:00:02
959000 -- (-348.200) (-353.186) [-350.722] (-352.280) * (-349.559) (-349.061) [-350.888] (-349.954) -- 0:00:02
959500 -- (-352.176) (-350.778) (-351.565) [-352.847] * (-349.047) (-349.776) [-351.231] (-349.502) -- 0:00:02
960000 -- (-351.293) [-349.839] (-350.361) (-350.758) * [-350.810] (-350.843) (-349.478) (-351.152) -- 0:00:02
Average standard deviation of split frequencies: 0.006870
960500 -- (-350.346) (-351.273) [-350.763] (-348.766) * (-354.245) (-349.689) [-349.528] (-350.718) -- 0:00:02
961000 -- (-352.672) (-349.243) (-349.124) [-352.146] * (-351.555) (-349.864) [-350.796] (-349.467) -- 0:00:02
961500 -- [-349.509] (-350.038) (-350.356) (-352.426) * (-353.859) (-348.830) [-349.249] (-351.847) -- 0:00:02
962000 -- [-351.587] (-349.184) (-352.396) (-348.906) * [-356.624] (-348.711) (-349.081) (-351.447) -- 0:00:02
962500 -- (-351.789) [-350.552] (-349.859) (-350.633) * (-351.748) (-348.055) [-351.476] (-351.193) -- 0:00:02
963000 -- (-350.524) (-349.236) (-349.958) [-352.605] * (-349.390) [-352.437] (-349.972) (-350.928) -- 0:00:02
963500 -- (-349.370) (-352.637) (-352.605) [-357.530] * [-348.702] (-353.194) (-350.596) (-350.530) -- 0:00:02
964000 -- [-348.257] (-350.685) (-351.704) (-357.601) * (-348.707) [-350.673] (-350.848) (-356.293) -- 0:00:02
964500 -- (-350.450) (-348.770) [-349.124] (-348.913) * (-350.727) [-349.583] (-350.939) (-357.082) -- 0:00:02
965000 -- (-349.635) [-349.122] (-354.462) (-351.285) * (-350.791) (-353.080) [-350.681] (-350.162) -- 0:00:02
Average standard deviation of split frequencies: 0.006775
965500 -- (-349.715) [-348.638] (-348.305) (-350.033) * (-350.157) [-352.460] (-351.310) (-357.042) -- 0:00:02
966000 -- (-349.110) [-350.405] (-348.729) (-354.555) * (-349.768) (-352.279) (-354.128) [-350.839] -- 0:00:02
966500 -- (-348.262) [-352.024] (-351.926) (-351.345) * (-351.495) [-350.517] (-354.771) (-350.378) -- 0:00:01
967000 -- (-351.895) (-349.297) (-353.800) [-350.285] * (-353.483) [-350.907] (-351.861) (-351.083) -- 0:00:01
967500 -- [-351.453] (-350.163) (-351.310) (-349.481) * (-351.175) (-349.632) (-348.967) [-350.174] -- 0:00:01
968000 -- (-349.912) [-353.453] (-352.900) (-351.440) * (-349.310) (-350.762) [-349.963] (-351.962) -- 0:00:01
968500 -- [-348.925] (-349.358) (-349.931) (-351.116) * [-349.696] (-350.375) (-353.431) (-351.412) -- 0:00:01
969000 -- [-350.726] (-350.861) (-351.914) (-348.439) * (-349.677) [-349.558] (-353.870) (-355.866) -- 0:00:01
969500 -- (-350.015) (-355.747) (-351.204) [-350.150] * (-349.436) (-349.183) [-352.021] (-351.131) -- 0:00:01
970000 -- [-355.817] (-353.186) (-350.343) (-348.250) * (-352.432) (-350.947) [-351.726] (-350.967) -- 0:00:01
Average standard deviation of split frequencies: 0.007056
970500 -- [-350.600] (-353.989) (-350.434) (-351.935) * (-350.059) (-350.740) (-354.121) [-350.821] -- 0:00:01
971000 -- (-348.641) (-353.011) [-348.723] (-351.044) * [-350.258] (-352.054) (-349.328) (-349.489) -- 0:00:01
971500 -- (-348.290) (-349.166) [-350.122] (-353.017) * (-350.729) (-352.083) (-348.693) [-351.263] -- 0:00:01
972000 -- [-348.442] (-350.819) (-351.207) (-350.239) * (-350.107) (-351.461) [-350.128] (-350.250) -- 0:00:01
972500 -- (-351.548) (-353.892) (-350.257) [-349.767] * (-352.470) [-351.496] (-352.626) (-355.074) -- 0:00:01
973000 -- [-349.516] (-349.470) (-349.492) (-353.736) * (-353.246) (-351.151) (-349.161) [-351.645] -- 0:00:01
973500 -- (-349.520) (-351.128) [-349.316] (-355.760) * (-354.718) [-350.040] (-350.924) (-348.945) -- 0:00:01
974000 -- (-350.000) [-348.711] (-355.397) (-349.442) * (-348.833) (-350.117) [-349.218] (-351.989) -- 0:00:01
974500 -- (-348.923) (-349.810) (-354.509) [-351.365] * (-349.532) [-350.789] (-348.887) (-349.681) -- 0:00:01
975000 -- [-350.652] (-352.938) (-352.110) (-353.289) * (-349.550) (-349.696) [-348.784] (-348.525) -- 0:00:01
Average standard deviation of split frequencies: 0.006989
975500 -- (-349.709) [-348.880] (-352.015) (-352.850) * [-351.019] (-350.153) (-349.479) (-348.525) -- 0:00:01
976000 -- (-357.567) (-350.001) [-355.096] (-352.283) * [-347.941] (-349.444) (-348.453) (-348.716) -- 0:00:01
976500 -- (-349.118) (-351.374) [-355.904] (-352.312) * [-348.439] (-351.901) (-351.404) (-349.022) -- 0:00:01
977000 -- (-350.581) (-351.067) (-353.339) [-348.568] * (-350.201) (-351.990) (-349.774) [-350.432] -- 0:00:01
977500 -- (-351.646) (-350.606) (-351.508) [-347.944] * (-348.750) (-354.442) (-350.484) [-350.931] -- 0:00:01
978000 -- (-350.845) (-350.000) (-356.450) [-349.111] * [-349.876] (-355.060) (-351.210) (-347.967) -- 0:00:01
978500 -- (-351.820) [-353.253] (-350.385) (-353.805) * [-349.744] (-352.116) (-351.630) (-350.023) -- 0:00:01
979000 -- (-352.885) (-349.831) [-350.313] (-349.994) * (-349.658) (-349.780) [-349.688] (-349.444) -- 0:00:01
979500 -- (-350.129) [-349.776] (-352.015) (-348.895) * [-352.990] (-349.338) (-350.237) (-353.741) -- 0:00:01
980000 -- [-355.621] (-351.470) (-352.828) (-348.348) * [-350.019] (-349.384) (-353.291) (-354.587) -- 0:00:01
Average standard deviation of split frequencies: 0.007126
980500 -- (-350.461) (-349.435) (-349.649) [-350.978] * (-350.982) (-349.015) [-353.100] (-350.770) -- 0:00:01
981000 -- (-349.915) (-348.274) (-352.484) [-350.407] * (-351.558) (-348.544) (-352.018) [-350.106] -- 0:00:01
981500 -- (-352.000) [-349.482] (-350.483) (-351.393) * (-349.063) [-348.167] (-351.714) (-349.104) -- 0:00:01
982000 -- (-349.356) (-350.889) [-349.660] (-349.654) * [-349.204] (-348.949) (-351.826) (-350.935) -- 0:00:01
982500 -- [-348.322] (-349.880) (-348.988) (-357.418) * (-353.160) [-351.192] (-349.560) (-359.392) -- 0:00:01
983000 -- (-354.020) [-349.082] (-348.697) (-348.914) * (-355.915) (-347.948) [-349.411] (-354.845) -- 0:00:01
983500 -- (-353.599) (-352.130) (-355.314) [-349.428] * (-358.591) (-350.306) [-350.440] (-355.448) -- 0:00:00
984000 -- [-348.919] (-351.922) (-350.105) (-348.181) * (-352.238) (-352.595) [-348.075] (-350.318) -- 0:00:00
984500 -- (-351.460) [-352.133] (-348.285) (-350.591) * (-352.368) (-351.260) [-350.275] (-350.257) -- 0:00:00
985000 -- [-350.590] (-354.164) (-350.984) (-351.547) * (-352.656) [-351.191] (-350.665) (-350.419) -- 0:00:00
Average standard deviation of split frequencies: 0.006918
985500 -- (-351.061) (-348.765) (-349.638) [-351.034] * (-355.424) (-349.724) [-349.850] (-349.773) -- 0:00:00
986000 -- (-351.689) (-350.226) [-349.779] (-349.760) * [-350.101] (-350.463) (-349.813) (-351.042) -- 0:00:00
986500 -- [-348.514] (-350.602) (-353.189) (-354.560) * [-352.709] (-350.849) (-353.241) (-351.491) -- 0:00:00
987000 -- (-348.842) [-349.504] (-349.252) (-355.126) * (-351.177) [-349.720] (-350.738) (-349.994) -- 0:00:00
987500 -- (-352.534) (-348.624) (-351.464) [-352.019] * (-350.423) (-352.009) (-349.125) [-350.102] -- 0:00:00
988000 -- (-348.793) (-348.966) [-351.533] (-350.242) * (-348.800) [-349.200] (-350.051) (-349.417) -- 0:00:00
988500 -- (-349.974) (-348.588) [-352.280] (-349.409) * [-349.892] (-354.826) (-348.737) (-350.394) -- 0:00:00
989000 -- (-349.378) (-349.709) (-350.253) [-348.504] * (-350.264) [-349.692] (-351.237) (-353.918) -- 0:00:00
989500 -- (-351.779) (-353.720) [-349.631] (-354.240) * (-356.396) (-350.955) (-350.562) [-352.806] -- 0:00:00
990000 -- (-350.613) [-348.688] (-354.031) (-350.211) * (-354.628) (-351.239) [-349.194] (-351.486) -- 0:00:00
Average standard deviation of split frequencies: 0.006914
990500 -- [-350.458] (-348.915) (-350.693) (-351.514) * (-349.793) (-350.149) [-352.745] (-353.860) -- 0:00:00
991000 -- (-352.615) [-350.655] (-353.686) (-349.528) * (-351.291) [-348.843] (-354.117) (-355.624) -- 0:00:00
991500 -- (-349.162) (-349.921) [-349.893] (-356.639) * (-348.920) [-350.641] (-351.037) (-352.899) -- 0:00:00
992000 -- [-350.214] (-353.752) (-350.183) (-354.052) * [-352.014] (-349.085) (-349.540) (-351.702) -- 0:00:00
992500 -- (-349.596) (-350.201) (-354.649) [-351.002] * (-359.778) (-350.988) [-348.433] (-348.240) -- 0:00:00
993000 -- (-349.563) (-352.227) (-353.028) [-354.352] * [-350.653] (-351.624) (-349.342) (-349.966) -- 0:00:00
993500 -- (-348.892) [-351.649] (-355.927) (-356.433) * (-354.731) (-350.761) [-349.316] (-349.534) -- 0:00:00
994000 -- (-350.528) [-350.522] (-349.013) (-351.471) * (-353.544) (-352.479) [-351.479] (-349.605) -- 0:00:00
994500 -- (-350.174) [-349.334] (-349.291) (-352.880) * [-350.592] (-354.853) (-349.910) (-350.542) -- 0:00:00
995000 -- [-349.610] (-349.629) (-348.737) (-349.366) * (-350.807) [-351.714] (-353.941) (-350.730) -- 0:00:00
Average standard deviation of split frequencies: 0.006849
995500 -- [-350.524] (-351.221) (-348.806) (-350.871) * [-350.617] (-354.915) (-349.593) (-349.798) -- 0:00:00
996000 -- [-349.173] (-352.095) (-350.923) (-353.461) * (-350.163) (-351.609) (-349.578) [-349.691] -- 0:00:00
996500 -- (-351.905) (-348.313) [-349.826] (-352.266) * [-351.297] (-350.178) (-349.868) (-349.587) -- 0:00:00
997000 -- (-351.169) (-354.628) (-349.357) [-349.376] * (-350.312) [-353.701] (-348.985) (-352.390) -- 0:00:00
997500 -- (-349.531) [-354.822] (-349.831) (-348.844) * (-348.204) (-353.193) (-349.344) [-350.201] -- 0:00:00
998000 -- (-353.828) [-350.991] (-350.044) (-349.941) * [-349.585] (-354.071) (-350.609) (-351.874) -- 0:00:00
998500 -- (-357.975) (-351.103) (-348.589) [-348.421] * (-349.696) (-352.712) [-351.277] (-354.261) -- 0:00:00
999000 -- (-352.348) (-349.528) [-349.918] (-348.606) * [-351.049] (-349.031) (-352.713) (-351.261) -- 0:00:00
999500 -- (-352.914) (-349.265) [-349.877] (-351.493) * [-351.204] (-352.777) (-351.163) (-351.447) -- 0:00:00
1000000 -- (-350.772) (-349.647) [-348.812] (-350.882) * (-350.438) [-349.896] (-351.869) (-350.249) -- 0:00:00
Average standard deviation of split frequencies: 0.006678
Analysis completed in 59 seconds
Analysis used 57.47 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -347.81
Likelihood of best state for "cold" chain of run 2 was -347.81
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.2 % ( 23 %) Dirichlet(Pi{all})
41.3 % ( 24 %) Slider(Pi{all})
78.9 % ( 57 %) Multiplier(Alpha{1,2})
78.1 % ( 60 %) Multiplier(Alpha{3})
27.3 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.3 % ( 96 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.9 % ( 33 %) Dirichlet(Pi{all})
39.7 % ( 26 %) Slider(Pi{all})
78.4 % ( 58 %) Multiplier(Alpha{1,2})
77.9 % ( 58 %) Multiplier(Alpha{3})
26.7 % ( 29 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 31 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.3 % ( 42 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166756 0.82 0.67
3 | 166040 167020 0.84
4 | 166726 166897 166561
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166570 0.82 0.67
3 | 166159 167220 0.84
4 | 166941 166336 166774
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -349.53
| 1 1 |
| 22 2 1 22 2 |
| 1 2 1 1 1 1 1 |
|1 211 * 2 2211 1 2 1 |
| 2 2 1 1 2 1 1 22 1 1 2 2 |
| 1211 1 2 2 2 1 12 1 2 2 1 |
| 1 21 2 1* 21 2 2 2 2 2 2 11 1|
|2 1 1 2 11 1 122 *1 2 12|
| * 1 2 2 2 2 2 1 12 2 * |
| 2 1 * 2 2 |
| 1 2 1 1 |
| |
| 2 1 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -351.57
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -349.53 -357.57
2 -349.55 -353.14
--------------------------------------
TOTAL -349.54 -356.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889789 0.084807 0.369089 1.472786 0.860998 1385.38 1443.19 1.000
r(A<->C){all} 0.176422 0.022148 0.000028 0.482368 0.137212 164.43 173.08 1.000
r(A<->G){all} 0.160276 0.017413 0.000162 0.423079 0.130129 257.67 300.12 1.001
r(A<->T){all} 0.165101 0.020326 0.000094 0.459835 0.126560 217.31 227.83 1.000
r(C<->G){all} 0.164428 0.019750 0.000075 0.449905 0.126274 114.23 125.32 1.005
r(C<->T){all} 0.161963 0.020103 0.000019 0.452781 0.122173 193.61 251.64 1.000
r(G<->T){all} 0.171811 0.022120 0.000012 0.480610 0.129188 168.94 221.01 1.004
pi(A){all} 0.175057 0.000549 0.131728 0.220517 0.174434 1226.26 1268.63 1.001
pi(C){all} 0.285762 0.000760 0.231735 0.338161 0.285311 1207.58 1354.29 1.000
pi(G){all} 0.343613 0.000847 0.286750 0.397054 0.343664 1310.45 1363.05 1.000
pi(T){all} 0.195567 0.000602 0.148434 0.244021 0.195243 1121.34 1220.06 1.000
alpha{1,2} 0.402013 0.223734 0.000148 1.335368 0.229205 907.32 1043.80 1.000
alpha{3} 0.452983 0.236223 0.000105 1.456611 0.285460 1077.41 1265.70 1.000
pinvar{all} 0.992996 0.000073 0.975734 0.999991 0.995888 922.01 1125.71 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .**...
9 -- ...**.
10 -- .*.***
11 -- ..**..
12 -- ....**
13 -- .*..*.
14 -- ..****
15 -- ...*.*
16 -- .***.*
17 -- .**.**
18 -- .*.*..
19 -- .****.
20 -- ..*..*
21 -- ..*.*.
22 -- .*..**
23 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.014133 0.140573 0.160560 2
8 449 0.149567 0.015546 0.138574 0.160560 2
9 447 0.148901 0.013662 0.139241 0.158561 2
10 444 0.147901 0.001884 0.146569 0.149234 2
11 433 0.144237 0.005182 0.140573 0.147901 2
12 431 0.143571 0.005182 0.139907 0.147235 2
13 430 0.143238 0.004711 0.139907 0.146569 2
14 429 0.142905 0.001413 0.141905 0.143904 2
15 424 0.141239 0.009422 0.134577 0.147901 2
16 420 0.139907 0.006595 0.135243 0.144570 2
17 418 0.139241 0.006595 0.134577 0.143904 2
18 415 0.138241 0.005182 0.134577 0.141905 2
19 415 0.138241 0.008951 0.131912 0.144570 2
20 414 0.137908 0.000000 0.137908 0.137908 2
21 413 0.137575 0.000471 0.137242 0.137908 2
22 296 0.098601 0.003769 0.095936 0.101266 2
23 281 0.093604 0.010835 0.085943 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101571 0.010300 0.000006 0.298853 0.070998 1.000 2
length{all}[2] 0.098679 0.010121 0.000027 0.300242 0.069910 1.000 2
length{all}[3] 0.098746 0.009939 0.000014 0.297332 0.067031 1.000 2
length{all}[4] 0.102486 0.010487 0.000031 0.303038 0.070060 1.000 2
length{all}[5] 0.096574 0.009156 0.000019 0.287312 0.068094 1.000 2
length{all}[6] 0.096079 0.008750 0.000080 0.294668 0.067480 1.000 2
length{all}[7] 0.102855 0.012039 0.000143 0.310491 0.069689 0.999 2
length{all}[8] 0.104537 0.012714 0.000368 0.338705 0.063262 1.004 2
length{all}[9] 0.103763 0.010867 0.000250 0.335457 0.075605 0.998 2
length{all}[10] 0.104542 0.010942 0.000546 0.331268 0.079078 1.003 2
length{all}[11] 0.103577 0.009491 0.000018 0.285351 0.075342 1.000 2
length{all}[12] 0.096406 0.008931 0.000011 0.273931 0.069262 0.998 2
length{all}[13] 0.093422 0.008586 0.000005 0.290495 0.060611 0.998 2
length{all}[14] 0.094706 0.008767 0.000019 0.294186 0.070723 1.000 2
length{all}[15] 0.093654 0.008301 0.000153 0.279263 0.069020 1.000 2
length{all}[16] 0.099099 0.008807 0.000727 0.290295 0.071196 0.999 2
length{all}[17] 0.101479 0.010316 0.000110 0.312172 0.066746 0.998 2
length{all}[18] 0.091875 0.008447 0.000112 0.287932 0.063764 0.999 2
length{all}[19] 0.093042 0.007242 0.000806 0.269226 0.067235 0.998 2
length{all}[20] 0.098261 0.010151 0.000152 0.303002 0.070494 0.998 2
length{all}[21] 0.098203 0.009825 0.000451 0.296408 0.065182 1.000 2
length{all}[22] 0.098662 0.009324 0.000003 0.325711 0.066317 1.008 2
length{all}[23] 0.102008 0.008740 0.000061 0.278650 0.076696 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006678
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 258
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 86 / 86 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 86 / 86 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046224 0.077168 0.107690 0.056304 0.099698 0.086073 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -372.012801
Iterating by ming2
Initial: fx= 372.012801
x= 0.04622 0.07717 0.10769 0.05630 0.09970 0.08607 0.30000 1.30000
1 h-m-p 0.0000 0.0005 205.4778 +++ 348.792077 m 0.0005 14 | 1/8
2 h-m-p 0.0013 0.0067 44.8496 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 188.9786 ++ 344.514808 m 0.0001 45 | 2/8
4 h-m-p 0.0006 0.0092 33.1452 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 169.1155 +++ 337.389737 m 0.0002 77 | 3/8
6 h-m-p 0.0014 0.0121 25.4190 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 146.8922 ++ 335.093756 m 0.0001 108 | 4/8
8 h-m-p 0.0007 0.0173 18.1365 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 120.0053 +++ 332.742166 m 0.0002 140 | 5/8
10 h-m-p 0.0012 0.0271 11.8101 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 85.0111 ++ 332.049295 m 0.0001 171 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ---Y 332.049295 0 0.0063 185 | 6/8
13 h-m-p 0.7346 8.0000 0.0000 C 332.049295 0 0.7346 198
Out..
lnL = -332.049295
199 lfun, 199 eigenQcodon, 1194 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.023546 0.095864 0.071740 0.060466 0.031490 0.105168 0.299587 0.644407 0.168086
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.060643
np = 9
lnL0 = -362.813007
Iterating by ming2
Initial: fx= 362.813007
x= 0.02355 0.09586 0.07174 0.06047 0.03149 0.10517 0.29959 0.64441 0.16809
1 h-m-p 0.0000 0.0003 181.2730 +++ 352.215149 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0003 129.9573 ++ 348.995544 m 0.0003 27 | 2/9
3 h-m-p 0.0001 0.0004 222.5997 ++ 340.411561 m 0.0004 39 | 3/9
4 h-m-p 0.0001 0.0004 146.9836 ++ 337.485258 m 0.0004 51 | 4/9
5 h-m-p 0.0000 0.0000 341749.4944 ++ 336.278094 m 0.0000 63 | 5/9
6 h-m-p 0.0023 0.0144 6.7696 ------------.. | 5/9
7 h-m-p 0.0000 0.0002 115.2144 +++ 332.967085 m 0.0002 98 | 6/9
8 h-m-p 0.0060 0.0928 3.3408 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 84.4156 ++ 332.049303 m 0.0001 132 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 332.049303 m 8.0000 147 | 7/9
11 h-m-p 0.0101 5.0275 0.1410 +++++ 332.049293 m 5.0275 164 | 8/9
12 h-m-p 1.2221 8.0000 0.1240 --------------C 332.049293 0 0.0000 192 | 8/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 332.049293 m 8.0000 208 | 8/9
14 h-m-p 0.0004 0.2246 0.6613 +++++ 332.049290 m 0.2246 224 | 9/9
15 h-m-p 0.0160 8.0000 0.0000 Y 332.049290 0 0.0160 237 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 Y 332.049290 0 0.0160 249
Out..
lnL = -332.049290
250 lfun, 750 eigenQcodon, 3000 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039169 0.016280 0.032490 0.077566 0.107698 0.038502 0.000100 1.623690 0.314811 0.310264 1.515188
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.571871
np = 11
lnL0 = -357.162320
Iterating by ming2
Initial: fx= 357.162320
x= 0.03917 0.01628 0.03249 0.07757 0.10770 0.03850 0.00011 1.62369 0.31481 0.31026 1.51519
1 h-m-p 0.0000 0.0000 188.2941 ++ 356.728414 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 97.0004 +++ 349.041595 m 0.0010 31 | 2/11
3 h-m-p 0.0001 0.0005 72.7926 ++ 343.635103 m 0.0005 45 | 3/11
4 h-m-p 0.0003 0.0017 30.4609 ++ 341.462872 m 0.0017 59 | 4/11
5 h-m-p 0.0000 0.0000 378.5726 ++ 341.313051 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 82196.1729 ++ 335.628584 m 0.0000 87 | 6/11
7 h-m-p 0.0010 0.0050 12.3990 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 114.6905 ++ 335.076391 m 0.0000 124 | 7/11
9 h-m-p 0.0160 8.0000 1.9440 -------------.. | 7/11
10 h-m-p 0.0000 0.0004 80.9702 +++ 332.049302 m 0.0004 164 | 8/11
11 h-m-p 1.5576 8.0000 0.0000 ++ 332.049302 m 8.0000 178 | 8/11
12 h-m-p 0.0160 8.0000 0.0197 +++++ 332.049301 m 8.0000 198 | 8/11
13 h-m-p 0.0849 8.0000 1.8587 ++Y 332.049287 0 3.3305 217 | 8/11
14 h-m-p 1.6000 8.0000 0.1701 ++ 332.049287 m 8.0000 231 | 8/11
15 h-m-p 1.2590 6.2952 0.9505 Y 332.049287 0 0.5064 248 | 8/11
16 h-m-p 1.6000 8.0000 0.0718 Y 332.049287 0 0.7775 265 | 8/11
17 h-m-p 1.6000 8.0000 0.0010 ++ 332.049287 m 8.0000 282 | 8/11
18 h-m-p 1.6000 8.0000 0.0002 ++ 332.049287 m 8.0000 299 | 8/11
19 h-m-p 0.0160 8.0000 0.8675 ------C 332.049287 0 0.0000 322 | 8/11
20 h-m-p 0.0160 8.0000 0.0150 +++++ 332.049287 m 8.0000 342 | 8/11
21 h-m-p 0.0160 8.0000 10.5425 ------------Y 332.049287 0 0.0000 371 | 8/11
22 h-m-p 0.0160 8.0000 2.2716 ----------Y 332.049287 0 0.0000 395 | 8/11
23 h-m-p 0.0495 8.0000 0.0000 C 332.049287 0 0.0495 409
Out..
lnL = -332.049287
410 lfun, 1640 eigenQcodon, 7380 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -332.050566 S = -332.047627 -0.001123
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:03
did 20 / 41 patterns 0:03
did 30 / 41 patterns 0:03
did 40 / 41 patterns 0:03
did 41 / 41 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064269 0.033820 0.034524 0.066876 0.068299 0.093105 0.000100 1.076421 1.555522
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.909770
np = 9
lnL0 = -361.647291
Iterating by ming2
Initial: fx= 361.647291
x= 0.06427 0.03382 0.03452 0.06688 0.06830 0.09311 0.00011 1.07642 1.55552
1 h-m-p 0.0000 0.0000 193.4147 ++ 361.095569 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0620 17.2794 ----------.. | 1/9
3 h-m-p 0.0000 0.0004 193.7030 +++ 345.409582 m 0.0004 47 | 2/9
4 h-m-p 0.0059 0.0873 12.3158 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 184.0743 ++ 345.119438 m 0.0000 81 | 3/9
6 h-m-p 0.0003 0.1523 7.1866 ----------.. | 3/9
7 h-m-p 0.0000 0.0004 164.3655 +++ 335.118293 m 0.0004 114 | 4/9
8 h-m-p 0.0126 0.2883 4.1022 -------------.. | 4/9
9 h-m-p 0.0000 0.0000 146.4267 ++ 334.444991 m 0.0000 149 | 5/9
10 h-m-p 0.0050 2.5194 1.8877 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 119.6369 ++ 334.199877 m 0.0000 183 | 6/9
12 h-m-p 0.0064 3.2081 1.6303 ------------.. | 6/9
13 h-m-p 0.0000 0.0003 84.3358 +++ 332.049301 m 0.0003 218 | 7/9
14 h-m-p 0.2782 8.0000 0.0000 +++ 332.049301 m 8.0000 231 | 7/9
15 h-m-p 0.0813 8.0000 0.0005 ++++ 332.049301 m 8.0000 247 | 7/9
16 h-m-p 0.0160 8.0000 0.6938 +++++ 332.049296 m 8.0000 264 | 7/9
17 h-m-p 1.6000 8.0000 0.2350 ++ 332.049295 m 8.0000 278 | 7/9
18 h-m-p 0.6219 8.0000 3.0231 ++ 332.049295 m 8.0000 292 | 7/9
19 h-m-p 1.6000 8.0000 3.5582 ++ 332.049295 m 8.0000 304 | 7/9
20 h-m-p 0.5377 2.6886 18.1237 ++ 332.049294 m 2.6886 316 | 8/9
21 h-m-p 0.3036 1.5178 32.9438 ------------Y 332.049294 0 0.0000 340 | 8/9
22 h-m-p 0.0882 8.0000 0.0000 N 332.049294 0 0.0110 352 | 8/9
23 h-m-p 0.0623 8.0000 0.0000 N 332.049294 0 0.0156 365
Out..
lnL = -332.049294
366 lfun, 4026 eigenQcodon, 21960 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044543 0.050102 0.046718 0.102856 0.055029 0.035498 0.000100 0.900000 0.412331 1.512885 1.300052
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.180291
np = 11
lnL0 = -358.148428
Iterating by ming2
Initial: fx= 358.148428
x= 0.04454 0.05010 0.04672 0.10286 0.05503 0.03550 0.00011 0.90000 0.41233 1.51288 1.30005
1 h-m-p 0.0000 0.0000 175.8918 ++ 357.622198 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0027 86.1372 ++++ 341.826134 m 0.0027 32 | 2/11
3 h-m-p 0.0000 0.0000 17527.6812 ++ 338.240344 m 0.0000 46 | 3/11
4 h-m-p 0.0007 0.0034 13.2445 ++ 337.994989 m 0.0034 60 | 4/11
5 h-m-p 0.0000 0.0001 631.0711 ++ 337.444433 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0000 7869.4299 ++ 337.040990 m 0.0000 88 | 6/11
7 h-m-p 0.0006 0.0032 65.1834 ++ 336.414478 m 0.0032 102 | 7/11
8 h-m-p 0.0039 0.0193 13.6875 ++ 334.985870 m 0.0193 116 | 7/11
9 h-m-p 0.0000 0.0000 7.3585
h-m-p: 0.00000000e+00 0.00000000e+00 7.35847405e+00 334.985870
.. | 7/11
10 h-m-p 0.0000 0.0004 83.6734 +++ 332.049337 m 0.0004 142 | 8/11
11 h-m-p 1.6000 8.0000 0.0000 ++ 332.049337 m 8.0000 156 | 7/11
12 h-m-p 0.0004 0.2208 0.0084 -------Y 332.049337 0 0.0000 180 | 7/11
13 h-m-p 0.0000 0.0000 4.2278
h-m-p: 1.47718892e-11 7.38594458e-11 4.22776973e+00 332.049337
.. | 7/11
14 h-m-p 0.0160 8.0000 0.0004 +++++ 332.049336 m 8.0000 212 | 7/11
15 h-m-p 0.0425 8.0000 0.0744 ++++ 332.049293 m 8.0000 232 | 7/11
16 h-m-p 1.6000 8.0000 0.0142 ++ 332.049292 m 8.0000 250 | 7/11
17 h-m-p 0.4568 2.2838 0.1336 +C 332.049292 0 1.8270 269 | 7/11
18 h-m-p 1.6000 8.0000 0.0003 ++ 332.049292 m 8.0000 287 | 7/11
19 h-m-p 0.0098 0.2331 0.2472 +++ 332.049291 m 0.2331 306 | 8/11
20 h-m-p 0.0273 2.1767 0.0887 ++++ 332.049286 m 2.1767 326 | 9/11
21 h-m-p 0.3829 8.0000 0.1878 +++ 332.049282 m 8.0000 344 | 9/11
22 h-m-p 1.6000 8.0000 0.6571 ++ 332.049280 m 8.0000 360 | 9/11
23 h-m-p 1.6000 8.0000 0.9344 ++ 332.049279 m 8.0000 376 | 9/11
24 h-m-p 1.6000 8.0000 2.9895 ++ 332.049278 m 8.0000 392 | 9/11
25 h-m-p 0.4512 3.7216 53.0063 ++ 332.049278 m 3.7216 406 | 9/11
26 h-m-p -0.0000 -0.0000 8.1137
h-m-p: -3.94088352e-16 -1.97044176e-15 8.11367141e+00 332.049278
.. | 9/11
27 h-m-p 0.0160 8.0000 0.0000 C 332.049278 0 0.0040 431 | 9/11
28 h-m-p 1.6000 8.0000 0.0000 -Y 332.049278 0 0.1000 448
Out..
lnL = -332.049278
449 lfun, 5388 eigenQcodon, 29634 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -332.047282 S = -332.047255 -0.000012
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:16
did 20 / 41 patterns 0:17
did 30 / 41 patterns 0:17
did 40 / 41 patterns 0:17
did 41 / 41 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=86
NC_011896_1_WP_010908893_1_2597_MLBR_RS12365 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
NC_002677_1_NP_302574_1_1446_ML2429 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY
**************************************************
NC_011896_1_WP_010908893_1_2597_MLBR_RS12365 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
NC_002677_1_NP_302574_1_1446_ML2429 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695 RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
************************************
>NC_011896_1_WP_010908893_1_2597_MLBR_RS12365 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG ACGTGGGC >NC_002677_1_NP_302574_1_1446_ML2429 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG ACGTGGGC >NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG ACGTGGGC >NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG ACGTGGGC >NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG ACGTGGGC >NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695 ATGACGTCTACTAACGGGCCATCGGCGCGGGATTCAGCTGGCAAATCGGT GCGGGACACCGGTTCGTTCGAGGGCCAGCAGCCCCGCACGCAATTTCTCA CCGTGGCCGAGGTGGCGACGCTAATGCGGGTCTCCAAGATGACGGTGTAC CGGCTGGTACACAACGGTGAATTGCCGGCGGTTCGGGTTGGGCGGTCCTT CCGGGTGCATGCCAAGGCTGTCCACGACATGCTCGAGACGTCGTACTTCG ACGTGGGC
>NC_011896_1_WP_010908893_1_2597_MLBR_RS12365 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG >NC_002677_1_NP_302574_1_1446_ML2429 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG >NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG >NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG >NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG >NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695 MTSTNGPSARDSAGKSVRDTGSFEGQQPRTQFLTVAEVATLMRVSKMTVY RLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDVG
#NEXUS
[ID: 5778268416]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908893_1_2597_MLBR_RS12365
NC_002677_1_NP_302574_1_1446_ML2429
NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850
NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560
NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370
NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908893_1_2597_MLBR_RS12365,
2 NC_002677_1_NP_302574_1_1446_ML2429,
3 NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850,
4 NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560,
5 NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370,
6 NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.070998,2:0.06991041,3:0.06703066,4:0.07006024,5:0.06809431,6:0.0674799);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.070998,2:0.06991041,3:0.06703066,4:0.07006024,5:0.06809431,6:0.0674799);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -349.53 -357.57
2 -349.55 -353.14
--------------------------------------
TOTAL -349.54 -356.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2429/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889789 0.084807 0.369089 1.472786 0.860998 1385.38 1443.19 1.000
r(A<->C){all} 0.176422 0.022148 0.000028 0.482368 0.137212 164.43 173.08 1.000
r(A<->G){all} 0.160276 0.017413 0.000162 0.423079 0.130129 257.67 300.12 1.001
r(A<->T){all} 0.165101 0.020326 0.000094 0.459835 0.126560 217.31 227.83 1.000
r(C<->G){all} 0.164428 0.019750 0.000075 0.449905 0.126274 114.23 125.32 1.005
r(C<->T){all} 0.161963 0.020103 0.000019 0.452781 0.122173 193.61 251.64 1.000
r(G<->T){all} 0.171811 0.022120 0.000012 0.480610 0.129188 168.94 221.01 1.004
pi(A){all} 0.175057 0.000549 0.131728 0.220517 0.174434 1226.26 1268.63 1.001
pi(C){all} 0.285762 0.000760 0.231735 0.338161 0.285311 1207.58 1354.29 1.000
pi(G){all} 0.343613 0.000847 0.286750 0.397054 0.343664 1310.45 1363.05 1.000
pi(T){all} 0.195567 0.000602 0.148434 0.244021 0.195243 1121.34 1220.06 1.000
alpha{1,2} 0.402013 0.223734 0.000148 1.335368 0.229205 907.32 1043.80 1.000
alpha{3} 0.452983 0.236223 0.000105 1.456611 0.285460 1077.41 1265.70 1.000
pinvar{all} 0.992996 0.000073 0.975734 0.999991 0.995888 922.01 1125.71 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2429/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 86
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 0 0 0 0 0 0 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 5 5 5 5 5 5 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 3 3 3 3 3 3 | GGC 3 3 3 3 3 3
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 6 6 6 6 6 6 | GCG 3 3 3 3 3 3 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908893_1_2597_MLBR_RS12365
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
#2: NC_002677_1_NP_302574_1_1446_ML2429
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
#3: NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
#4: NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
#5: NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
#6: NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 0
CTC 12 | CCC 6 | CAC 12 | CGC 6
CTA 6 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 6 | CCG 6 | CAG 12 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 0 | ACC 12 | AAC 12 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 24 | ACG 30 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 12
GTC 12 | GCC 12 | GAC 18 | GGC 18
GTA 6 | GCA 0 | Glu E GAA 6 | GGA 0
GTG 36 | GCG 18 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17442 C:0.24419 A:0.19767 G:0.38372
position 2: T:0.27907 C:0.30233 A:0.24419 G:0.17442
position 3: T:0.12791 C:0.31395 A:0.08140 G:0.47674
Average T:0.19380 C:0.28682 A:0.17442 G:0.34496
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -332.049295 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299587 1.300052
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908893_1_2597_MLBR_RS12365: 0.000004, NC_002677_1_NP_302574_1_1446_ML2429: 0.000004, NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850: 0.000004, NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560: 0.000004, NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370: 0.000004, NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29959
omega (dN/dS) = 1.30005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.0 53.0 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 205.0 53.0 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 205.0 53.0 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 205.0 53.0 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 205.0 53.0 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 205.0 53.0 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -332.049290 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908893_1_2597_MLBR_RS12365: 0.000004, NC_002677_1_NP_302574_1_1446_ML2429: 0.000004, NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850: 0.000004, NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560: 0.000004, NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370: 0.000004, NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.7 52.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 205.7 52.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 205.7 52.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 205.7 52.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 205.7 52.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 205.7 52.3 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -332.049287 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.024677 0.808254 0.000001 3.738325
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908893_1_2597_MLBR_RS12365: 0.000004, NC_002677_1_NP_302574_1_1446_ML2429: 0.000004, NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850: 0.000004, NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560: 0.000004, NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370: 0.000004, NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.02468 0.80825 0.16707
w: 0.00000 1.00000 3.73832
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.7 52.3 1.4328 0.0000 0.0000 0.0 0.0
7..2 0.000 205.7 52.3 1.4328 0.0000 0.0000 0.0 0.0
7..3 0.000 205.7 52.3 1.4328 0.0000 0.0000 0.0 0.0
7..4 0.000 205.7 52.3 1.4328 0.0000 0.0000 0.0 0.0
7..5 0.000 205.7 52.3 1.4328 0.0000 0.0000 0.0 0.0
7..6 0.000 205.7 52.3 1.4328 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908893_1_2597_MLBR_RS12365)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908893_1_2597_MLBR_RS12365)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -332.049294 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 99.000000 48.998767
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908893_1_2597_MLBR_RS12365: 0.000004, NC_002677_1_NP_302574_1_1446_ML2429: 0.000004, NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850: 0.000004, NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560: 0.000004, NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370: 0.000004, NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 99.00000 q = 48.99877
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.60420 0.62880 0.64324 0.65466 0.66481 0.67454 0.68449 0.69544 0.70893 0.73104
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.7 52.3 0.6690 0.0000 0.0000 0.0 0.0
7..2 0.000 205.7 52.3 0.6690 0.0000 0.0000 0.0 0.0
7..3 0.000 205.7 52.3 0.6690 0.0000 0.0000 0.0 0.0
7..4 0.000 205.7 52.3 0.6690 0.0000 0.0000 0.0 0.0
7..5 0.000 205.7 52.3 0.6690 0.0000 0.0000 0.0 0.0
7..6 0.000 205.7 52.3 0.6690 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -332.049278 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 237.009583
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908893_1_2597_MLBR_RS12365: 0.000004, NC_002677_1_NP_302574_1_1446_ML2429: 0.000004, NZ_LVXE01000055_1_WP_010908893_1_2198_A3216_RS11850: 0.000004, NZ_LYPH01000045_1_WP_010908893_1_1794_A8144_RS08560: 0.000004, NZ_CP029543_1_WP_010908893_1_2625_DIJ64_RS13370: 0.000004, NZ_AP014567_1_WP_010908893_1_2690_JK2ML_RS13695: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 0.00500
(p1 = 0.99999) w = 237.00958
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 237.00958
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.7 52.3 237.0072 0.0000 0.0000 0.0 0.0
7..2 0.000 205.7 52.3 237.0072 0.0000 0.0000 0.0 0.0
7..3 0.000 205.7 52.3 237.0072 0.0000 0.0000 0.0 0.0
7..4 0.000 205.7 52.3 237.0072 0.0000 0.0000 0.0 0.0
7..5 0.000 205.7 52.3 237.0072 0.0000 0.0000 0.0 0.0
7..6 0.000 205.7 52.3 237.0072 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908893_1_2597_MLBR_RS12365)
Pr(w>1) post mean +- SE for w
1 M 1.000** 237.007
2 T 1.000** 237.007
3 S 1.000** 237.007
4 T 1.000** 237.007
5 N 1.000** 237.007
6 G 1.000** 237.007
7 P 1.000** 237.007
8 S 1.000** 237.007
9 A 1.000** 237.007
10 R 1.000** 237.007
11 D 1.000** 237.007
12 S 1.000** 237.007
13 A 1.000** 237.007
14 G 1.000** 237.007
15 K 1.000** 237.007
16 S 1.000** 237.007
17 V 1.000** 237.007
18 R 1.000** 237.007
19 D 1.000** 237.007
20 T 1.000** 237.007
21 G 1.000** 237.007
22 S 1.000** 237.007
23 F 1.000** 237.007
24 E 1.000** 237.007
25 G 1.000** 237.007
26 Q 1.000** 237.007
27 Q 1.000** 237.007
28 P 1.000** 237.007
29 R 1.000** 237.007
30 T 1.000** 237.007
31 Q 1.000** 237.007
32 F 1.000** 237.007
33 L 1.000** 237.007
34 T 1.000** 237.007
35 V 1.000** 237.007
36 A 1.000** 237.007
37 E 1.000** 237.007
38 V 1.000** 237.007
39 A 1.000** 237.007
40 T 1.000** 237.007
41 L 1.000** 237.007
42 M 1.000** 237.007
43 R 1.000** 237.007
44 V 1.000** 237.007
45 S 1.000** 237.007
46 K 1.000** 237.007
47 M 1.000** 237.007
48 T 1.000** 237.007
49 V 1.000** 237.007
50 Y 1.000** 237.007
51 R 1.000** 237.007
52 L 1.000** 237.007
53 V 1.000** 237.007
54 H 1.000** 237.007
55 N 1.000** 237.007
56 G 1.000** 237.007
57 E 1.000** 237.007
58 L 1.000** 237.007
59 P 1.000** 237.007
60 A 1.000** 237.007
61 V 1.000** 237.007
62 R 1.000** 237.007
63 V 1.000** 237.007
64 G 1.000** 237.007
65 R 1.000** 237.007
66 S 1.000** 237.007
67 F 1.000** 237.007
68 R 1.000** 237.007
69 V 1.000** 237.007
70 H 1.000** 237.007
71 A 1.000** 237.007
72 K 1.000** 237.007
73 A 1.000** 237.007
74 V 1.000** 237.007
75 H 1.000** 237.007
76 D 1.000** 237.007
77 M 1.000** 237.007
78 L 1.000** 237.007
79 E 1.000** 237.007
80 T 1.000** 237.007
81 S 1.000** 237.007
82 Y 1.000** 237.007
83 F 1.000** 237.007
84 D 1.000** 237.007
85 V 1.000** 237.007
86 G 1.000** 237.007
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908893_1_2597_MLBR_RS12365)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -332.04929 Model 2: PositiveSelection -332.049287 Model 0: one-ratio -332.049295 Model 7: beta -332.049294 Model 8: beta&w>1 -332.049278 Model 0 vs 1 9.999999974752427E-6 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 3.199999991920777E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
