--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:08:25 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/9res/ML2440/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1803.14 -1806.69 2 -1803.17 -1807.40 -------------------------------------- TOTAL -1803.16 -1807.11 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899728 0.089985 0.380307 1.488092 0.859996 1385.10 1407.42 1.000 r(A<->C){all} 0.166821 0.017628 0.000096 0.422422 0.138128 127.69 184.34 1.003 r(A<->G){all} 0.161828 0.019231 0.000081 0.450881 0.124797 135.00 160.07 1.010 r(A<->T){all} 0.167782 0.020531 0.000034 0.450589 0.128824 104.46 138.65 1.000 r(C<->G){all} 0.159060 0.018234 0.000043 0.427855 0.122378 249.47 265.69 1.000 r(C<->T){all} 0.169945 0.019186 0.000014 0.448325 0.134431 195.66 201.27 1.010 r(G<->T){all} 0.174564 0.020877 0.000033 0.446645 0.139569 240.99 252.74 1.001 pi(A){all} 0.192691 0.000113 0.171881 0.213033 0.192663 992.62 1202.87 1.000 pi(C){all} 0.272581 0.000147 0.249100 0.296842 0.272610 845.94 1118.06 1.000 pi(G){all} 0.331396 0.000175 0.304848 0.355895 0.331303 1239.77 1310.10 1.000 pi(T){all} 0.203332 0.000128 0.182778 0.226500 0.203238 1206.25 1306.05 1.000 alpha{1,2} 0.412906 0.210173 0.000162 1.370993 0.254511 1049.19 1157.39 1.000 alpha{3} 0.455855 0.243377 0.000211 1.414357 0.287267 1263.47 1348.92 1.000 pinvar{all} 0.998801 0.000002 0.996160 0.999999 0.999271 1015.72 1115.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1747.548277 Model 2: PositiveSelection -1747.54845 Model 0: one-ratio -1747.548446 Model 7: beta -1747.547906 Model 8: beta&w>1 -1747.548302 Model 0 vs 1 3.3799999982875306E-4 Model 2 vs 1 3.45999999808555E-4 Model 8 vs 7 7.919999998193816E-4
>C1 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C2 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C3 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C4 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C5 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C6 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=441 C1 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C2 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C3 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C4 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C5 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C6 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML ************************************************** C1 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C2 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C3 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C4 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C5 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C6 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL ************************************************** C1 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C2 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C3 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C4 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C5 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C6 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV ************************************************** C1 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C2 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C3 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C4 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C5 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C6 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI ************************************************** C1 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C2 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C3 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C4 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C5 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C6 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA ************************************************** C1 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C2 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C3 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C4 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C5 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C6 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG ************************************************** C1 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C2 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C3 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C4 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C5 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C6 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV ************************************************** C1 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C2 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C3 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C4 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C5 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C6 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR ************************************************** C1 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C2 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C3 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C4 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C5 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C6 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG ***************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 441 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 441 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13230] Library Relaxation: Multi_proc [96] Relaxation Summary: [13230]--->[13230] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.544 Mb, Max= 31.029 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C2 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C3 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C4 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C5 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML C6 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML ************************************************** C1 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C2 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C3 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C4 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C5 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL C6 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL ************************************************** C1 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C2 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C3 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C4 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C5 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV C6 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV ************************************************** C1 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C2 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C3 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C4 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C5 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI C6 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI ************************************************** C1 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C2 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C3 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C4 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C5 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA C6 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA ************************************************** C1 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C2 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C3 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C4 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C5 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG C6 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG ************************************************** C1 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C2 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C3 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C4 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C5 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV C6 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV ************************************************** C1 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C2 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C3 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C4 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C5 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR C6 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR ************************************************** C1 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C2 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C3 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C4 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C5 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG C6 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG ***************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT C2 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT C3 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT C4 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT C5 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT C6 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT ************************************************** C1 TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC C2 TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC C3 TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC C4 TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC C5 TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC C6 TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC ************************************************** C1 GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG C2 GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG C3 GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG C4 GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG C5 GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG C6 GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG ************************************************** C1 CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA C2 CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA C3 CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA C4 CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA C5 CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA C6 CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA ************************************************** C1 TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC C2 TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC C3 TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC C4 TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC C5 TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC C6 TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC ************************************************** C1 GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG C2 GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG C3 GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG C4 GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG C5 GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG C6 GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG ************************************************** C1 GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC C2 GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC C3 GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC C4 GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC C5 GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC C6 GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC ************************************************** C1 GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA C2 GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA C3 GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA C4 GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA C5 GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA C6 GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA ************************************************** C1 AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG C2 AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG C3 AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG C4 AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG C5 AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG C6 AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG ************************************************** C1 CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT C2 CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT C3 CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT C4 CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT C5 CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT C6 CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT ************************************************** C1 CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT C2 CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT C3 CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT C4 CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT C5 CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT C6 CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT ************************************************** C1 CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC C2 CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC C3 CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC C4 CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC C5 CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC C6 CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC ************************************************** C1 GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG C2 GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG C3 GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG C4 GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG C5 GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG C6 GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG ************************************************** C1 GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA C2 GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA C3 GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA C4 GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA C5 GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA C6 GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA ************************************************** C1 TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT C2 TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT C3 TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT C4 TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT C5 TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT C6 TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT ************************************************** C1 GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA C2 GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA C3 GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA C4 GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA C5 GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA C6 GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA ************************************************** C1 CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG C2 CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG C3 CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG C4 CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG C5 CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG C6 CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG ************************************************** C1 CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC C2 CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC C3 CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC C4 CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC C5 CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC C6 CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC ************************************************** C1 GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA C2 GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA C3 GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA C4 GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA C5 GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA C6 GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA ************************************************** C1 AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT C2 AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT C3 AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT C4 AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT C5 AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT C6 AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT ************************************************** C1 CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT C2 CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT C3 CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT C4 CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT C5 CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT C6 CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT ************************************************** C1 GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG C2 GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG C3 GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG C4 GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG C5 GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG C6 GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ************************************************** C1 ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA C2 ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA C3 ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA C4 ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA C5 ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA C6 ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ************************************************** C1 ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG C2 ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG C3 ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG C4 ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG C5 ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG C6 ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG ************************************************** C1 CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT C2 CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT C3 CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT C4 CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT C5 CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT C6 CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT ************************************************** C1 GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT C2 GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT C3 GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT C4 GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT C5 GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT C6 GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT ************************************************** C1 GTGGAGGACGAGGAATCGCTGGC C2 GTGGAGGACGAGGAATCGCTGGC C3 GTGGAGGACGAGGAATCGCTGGC C4 GTGGAGGACGAGGAATCGCTGGC C5 GTGGAGGACGAGGAATCGCTGGC C6 GTGGAGGACGAGGAATCGCTGGC *********************** >C1 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >C2 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >C3 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >C4 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >C5 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >C6 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >C1 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C2 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C3 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C4 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C5 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >C6 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1323 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579856829 Setting output file names to "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 314762003 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5820271966 Seed = 2035867846 Swapseed = 1579856829 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2960.936971 -- -24.965149 Chain 2 -- -2960.937421 -- -24.965149 Chain 3 -- -2960.937421 -- -24.965149 Chain 4 -- -2960.936971 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2960.937421 -- -24.965149 Chain 2 -- -2960.937421 -- -24.965149 Chain 3 -- -2960.937421 -- -24.965149 Chain 4 -- -2960.937250 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2960.937] (-2960.937) (-2960.937) (-2960.937) * [-2960.937] (-2960.937) (-2960.937) (-2960.937) 500 -- (-1825.830) (-1839.107) (-1818.924) [-1809.601] * [-1809.077] (-1836.610) (-1829.776) (-1838.548) -- 0:00:00 1000 -- (-1820.533) (-1823.985) (-1813.719) [-1807.607] * (-1810.822) (-1838.706) (-1822.922) [-1817.757] -- 0:00:00 1500 -- (-1808.459) (-1813.300) [-1808.075] (-1814.697) * [-1812.463] (-1825.071) (-1815.127) (-1809.919) -- 0:00:00 2000 -- [-1806.031] (-1810.998) (-1814.384) (-1810.747) * (-1816.216) [-1816.275] (-1811.875) (-1807.939) -- 0:00:00 2500 -- (-1807.484) [-1822.952] (-1819.135) (-1816.284) * [-1812.549] (-1817.839) (-1810.648) (-1820.059) -- 0:00:00 3000 -- (-1815.304) (-1815.136) (-1813.309) [-1806.623] * (-1817.155) (-1806.690) [-1811.610] (-1808.649) -- 0:00:00 3500 -- (-1809.701) [-1810.570] (-1809.048) (-1816.646) * (-1816.038) (-1811.285) [-1812.124] (-1810.520) -- 0:04:44 4000 -- (-1812.627) (-1818.630) [-1812.537] (-1814.816) * [-1808.792] (-1806.676) (-1814.370) (-1810.776) -- 0:04:09 4500 -- [-1809.292] (-1819.390) (-1811.482) (-1814.066) * [-1811.310] (-1807.078) (-1810.577) (-1808.540) -- 0:03:41 5000 -- [-1808.401] (-1817.636) (-1813.672) (-1811.642) * (-1812.995) (-1818.426) (-1816.661) [-1812.844] -- 0:03:19 Average standard deviation of split frequencies: 0.095647 5500 -- (-1821.013) (-1815.629) [-1810.848] (-1809.541) * (-1824.047) (-1809.604) (-1813.222) [-1811.110] -- 0:03:00 6000 -- (-1818.085) (-1809.528) [-1810.792] (-1819.019) * (-1811.697) (-1817.860) (-1811.334) [-1810.315] -- 0:02:45 6500 -- (-1809.788) [-1814.493] (-1806.881) (-1820.075) * [-1812.926] (-1810.910) (-1819.265) (-1822.138) -- 0:02:32 7000 -- (-1812.446) [-1818.246] (-1811.779) (-1808.771) * (-1815.265) (-1814.264) [-1811.356] (-1812.742) -- 0:02:21 7500 -- (-1816.249) (-1813.483) (-1810.291) [-1810.278] * (-1825.914) (-1814.843) [-1805.558] (-1817.659) -- 0:02:12 8000 -- [-1809.778] (-1813.962) (-1818.048) (-1813.971) * (-1819.092) (-1816.581) (-1809.994) [-1813.614] -- 0:02:04 8500 -- (-1807.012) (-1810.251) [-1817.885] (-1811.544) * [-1808.786] (-1811.503) (-1811.082) (-1817.415) -- 0:01:56 9000 -- (-1816.749) (-1809.406) [-1810.589] (-1815.559) * (-1815.841) (-1809.850) (-1815.303) [-1806.381] -- 0:01:50 9500 -- (-1815.325) (-1808.408) (-1808.336) [-1809.516] * [-1808.380] (-1816.309) (-1820.911) (-1816.030) -- 0:01:44 10000 -- (-1817.688) [-1809.624] (-1816.456) (-1812.750) * (-1814.115) (-1810.716) (-1823.540) [-1810.868] -- 0:01:39 Average standard deviation of split frequencies: 0.071552 10500 -- (-1810.367) (-1818.640) (-1814.386) [-1812.061] * [-1814.991] (-1811.085) (-1809.469) (-1814.247) -- 0:01:34 11000 -- (-1811.466) (-1812.107) [-1814.260] (-1813.679) * (-1811.626) [-1810.500] (-1826.060) (-1812.610) -- 0:01:29 11500 -- (-1820.796) (-1819.376) [-1809.324] (-1809.715) * (-1817.637) (-1815.567) [-1818.865] (-1815.553) -- 0:01:25 12000 -- (-1814.214) (-1817.551) (-1806.868) [-1811.000] * [-1812.559] (-1816.438) (-1821.076) (-1810.884) -- 0:01:22 12500 -- (-1821.755) (-1812.829) (-1803.176) [-1811.736] * (-1812.942) (-1823.235) (-1812.081) [-1815.145] -- 0:01:19 13000 -- (-1810.040) [-1811.473] (-1803.375) (-1808.576) * (-1811.710) (-1812.339) (-1815.676) [-1811.538] -- 0:01:15 13500 -- [-1813.106] (-1815.765) (-1803.138) (-1813.568) * (-1818.068) (-1810.255) (-1811.157) [-1817.836] -- 0:01:13 14000 -- (-1810.755) (-1809.857) (-1806.303) [-1810.250] * (-1814.158) [-1812.934] (-1815.582) (-1811.840) -- 0:01:10 14500 -- (-1818.964) (-1813.723) [-1807.686] (-1810.664) * (-1813.590) (-1812.310) [-1814.164] (-1808.515) -- 0:01:07 15000 -- (-1811.707) (-1806.988) [-1804.531] (-1817.115) * (-1811.414) (-1813.389) (-1813.428) [-1813.467] -- 0:01:05 Average standard deviation of split frequencies: 0.039284 15500 -- (-1812.562) (-1810.976) (-1804.392) [-1813.997] * [-1806.864] (-1816.712) (-1810.980) (-1817.568) -- 0:01:03 16000 -- (-1815.472) (-1812.873) (-1802.358) [-1815.474] * (-1810.521) (-1814.890) (-1812.660) [-1816.100] -- 0:01:01 16500 -- (-1814.628) (-1809.705) [-1802.968] (-1813.050) * [-1810.883] (-1813.071) (-1810.339) (-1808.592) -- 0:00:59 17000 -- [-1807.217] (-1809.993) (-1802.256) (-1810.554) * (-1816.133) [-1811.338] (-1811.557) (-1814.482) -- 0:00:57 17500 -- (-1814.848) (-1816.069) [-1806.388] (-1812.927) * (-1809.761) (-1812.337) [-1813.963] (-1819.152) -- 0:00:56 18000 -- (-1812.001) [-1810.067] (-1804.358) (-1822.005) * (-1811.368) (-1818.564) (-1808.096) [-1811.383] -- 0:00:54 18500 -- (-1818.620) [-1807.021] (-1803.832) (-1816.661) * (-1819.758) (-1817.924) (-1809.550) [-1814.398] -- 0:01:46 19000 -- (-1814.427) (-1806.187) (-1803.468) [-1812.091] * (-1816.400) (-1811.689) [-1813.057] (-1824.133) -- 0:01:43 19500 -- [-1810.357] (-1815.968) (-1801.950) (-1812.961) * [-1812.213] (-1821.262) (-1815.201) (-1814.342) -- 0:01:40 20000 -- [-1816.285] (-1814.756) (-1803.473) (-1806.672) * [-1815.733] (-1811.017) (-1817.533) (-1817.388) -- 0:01:38 Average standard deviation of split frequencies: 0.049041 20500 -- [-1811.365] (-1810.870) (-1803.180) (-1814.535) * (-1813.174) (-1815.144) [-1809.325] (-1812.339) -- 0:01:35 21000 -- (-1813.707) (-1817.874) (-1805.253) [-1812.703] * (-1811.624) [-1819.589] (-1811.774) (-1823.431) -- 0:01:33 21500 -- [-1812.284] (-1813.836) (-1803.063) (-1810.577) * (-1816.060) [-1812.891] (-1816.947) (-1813.278) -- 0:01:31 22000 -- (-1813.288) (-1815.667) (-1803.063) [-1814.123] * (-1818.325) [-1813.165] (-1810.790) (-1822.137) -- 0:01:28 22500 -- [-1813.583] (-1813.756) (-1803.163) (-1812.558) * (-1812.138) (-1816.662) (-1814.149) [-1810.963] -- 0:01:26 23000 -- [-1810.996] (-1817.865) (-1802.478) (-1818.854) * (-1819.639) (-1818.346) [-1810.498] (-1810.339) -- 0:01:24 23500 -- (-1816.949) [-1811.919] (-1802.391) (-1811.651) * (-1819.731) [-1814.526] (-1811.059) (-1813.306) -- 0:01:23 24000 -- (-1814.804) [-1815.134] (-1801.987) (-1815.322) * (-1812.431) (-1821.534) [-1807.501] (-1813.086) -- 0:01:21 24500 -- (-1815.532) (-1823.674) [-1801.679] (-1811.226) * (-1820.908) (-1809.506) [-1805.818] (-1810.747) -- 0:01:19 25000 -- (-1813.107) [-1823.715] (-1802.604) (-1815.370) * (-1809.543) [-1814.516] (-1814.120) (-1821.096) -- 0:01:18 Average standard deviation of split frequencies: 0.036262 25500 -- (-1813.373) [-1810.183] (-1804.228) (-1817.370) * (-1814.368) (-1814.933) (-1814.410) [-1804.936] -- 0:01:16 26000 -- (-1816.886) [-1808.919] (-1802.704) (-1814.765) * (-1813.195) (-1810.098) [-1810.488] (-1816.583) -- 0:01:14 26500 -- (-1809.642) (-1808.955) (-1805.322) [-1816.896] * (-1809.767) (-1820.901) [-1811.919] (-1808.591) -- 0:01:13 27000 -- [-1811.667] (-1816.945) (-1802.641) (-1817.916) * (-1816.139) [-1813.204] (-1814.680) (-1814.367) -- 0:01:12 27500 -- (-1806.415) (-1812.002) (-1802.719) [-1815.107] * (-1819.039) (-1809.280) [-1810.790] (-1818.066) -- 0:01:10 28000 -- [-1806.894] (-1815.680) (-1802.716) (-1806.805) * [-1811.946] (-1813.459) (-1809.687) (-1810.290) -- 0:01:09 28500 -- (-1805.299) [-1814.381] (-1803.772) (-1814.907) * (-1808.892) [-1808.717] (-1820.157) (-1811.995) -- 0:01:08 29000 -- (-1802.499) [-1813.473] (-1809.856) (-1817.975) * (-1814.181) (-1818.191) (-1818.096) [-1812.556] -- 0:01:06 29500 -- (-1802.415) (-1816.987) (-1808.848) [-1812.122] * (-1816.724) (-1814.241) (-1825.283) [-1814.763] -- 0:01:05 30000 -- [-1806.776] (-1816.319) (-1804.041) (-1812.139) * (-1822.642) (-1815.849) (-1811.666) [-1805.978] -- 0:01:04 Average standard deviation of split frequencies: 0.032940 30500 -- [-1803.513] (-1808.061) (-1808.898) (-1820.265) * (-1807.940) [-1819.543] (-1814.841) (-1807.312) -- 0:01:03 31000 -- [-1803.648] (-1814.244) (-1806.551) (-1815.044) * (-1813.262) (-1812.549) (-1814.409) [-1808.967] -- 0:01:02 31500 -- (-1803.749) (-1821.359) [-1803.806] (-1811.458) * (-1811.521) (-1818.348) [-1809.196] (-1813.321) -- 0:01:01 32000 -- (-1804.195) (-1818.673) [-1801.977] (-1813.296) * (-1816.645) (-1818.959) [-1812.212] (-1811.092) -- 0:01:00 32500 -- (-1806.738) (-1822.646) [-1801.714] (-1812.902) * (-1810.236) [-1802.548] (-1821.299) (-1815.221) -- 0:00:59 33000 -- (-1804.972) [-1810.769] (-1801.847) (-1814.487) * (-1817.353) (-1801.992) [-1808.381] (-1816.134) -- 0:00:58 33500 -- (-1805.159) (-1822.579) (-1803.469) [-1810.832] * [-1809.380] (-1801.903) (-1812.951) (-1814.551) -- 0:00:57 34000 -- (-1808.777) (-1814.172) [-1805.093] (-1817.943) * [-1811.080] (-1802.611) (-1825.509) (-1812.310) -- 0:01:25 34500 -- (-1804.134) (-1811.617) (-1804.953) [-1810.319] * (-1811.546) [-1805.019] (-1816.324) (-1809.592) -- 0:01:23 35000 -- [-1804.871] (-1814.656) (-1801.957) (-1809.852) * [-1808.124] (-1807.819) (-1814.537) (-1812.099) -- 0:01:22 Average standard deviation of split frequencies: 0.023071 35500 -- (-1806.808) (-1820.895) (-1805.162) [-1810.833] * (-1809.863) (-1804.496) (-1814.087) [-1807.291] -- 0:01:21 36000 -- (-1802.195) (-1806.858) (-1802.199) [-1810.702] * (-1815.923) (-1804.266) (-1823.505) [-1811.238] -- 0:01:20 36500 -- (-1803.418) (-1808.518) [-1803.230] (-1815.321) * (-1814.254) (-1805.192) [-1803.852] (-1812.942) -- 0:01:19 37000 -- (-1801.819) [-1809.157] (-1803.328) (-1809.857) * (-1815.909) (-1803.277) [-1804.875] (-1813.517) -- 0:01:18 37500 -- (-1804.673) (-1812.091) (-1804.868) [-1815.527] * (-1808.486) (-1804.443) (-1805.618) [-1812.046] -- 0:01:17 38000 -- (-1807.253) (-1813.399) [-1802.494] (-1808.516) * [-1814.662] (-1804.069) (-1803.100) (-1812.826) -- 0:01:15 38500 -- (-1801.708) [-1812.613] (-1803.721) (-1808.628) * (-1810.970) (-1804.494) [-1805.886] (-1822.363) -- 0:01:14 39000 -- (-1802.473) (-1805.166) (-1804.175) [-1813.610] * (-1816.435) (-1804.066) (-1802.953) [-1814.120] -- 0:01:13 39500 -- (-1802.553) [-1806.332] (-1805.611) (-1817.701) * (-1814.369) (-1806.794) [-1805.330] (-1816.126) -- 0:01:12 40000 -- [-1803.631] (-1812.149) (-1805.611) (-1815.322) * (-1821.474) (-1806.520) (-1804.665) [-1813.379] -- 0:01:12 Average standard deviation of split frequencies: 0.032945 40500 -- (-1802.445) (-1808.107) (-1804.207) [-1811.877] * (-1813.917) (-1805.866) (-1803.685) [-1809.829] -- 0:01:11 41000 -- [-1802.219] (-1807.118) (-1805.372) (-1814.276) * (-1811.115) [-1803.161] (-1803.085) (-1814.821) -- 0:01:10 41500 -- (-1804.470) [-1802.761] (-1809.153) (-1815.126) * (-1813.537) (-1802.918) [-1803.619] (-1809.181) -- 0:01:09 42000 -- (-1804.167) [-1804.149] (-1803.149) (-1813.627) * [-1807.492] (-1801.525) (-1803.638) (-1814.117) -- 0:01:08 42500 -- (-1804.039) [-1803.866] (-1803.522) (-1815.844) * (-1811.125) [-1803.174] (-1802.033) (-1810.567) -- 0:01:07 43000 -- (-1803.594) (-1805.749) (-1806.068) [-1813.122] * (-1814.725) (-1802.321) (-1802.004) [-1809.601] -- 0:01:06 43500 -- [-1803.495] (-1803.663) (-1803.616) (-1814.217) * (-1812.438) [-1801.656] (-1802.483) (-1813.435) -- 0:01:05 44000 -- (-1802.525) (-1802.582) [-1802.977] (-1815.785) * [-1808.690] (-1801.774) (-1802.861) (-1809.906) -- 0:01:05 44500 -- [-1802.607] (-1804.602) (-1802.388) (-1818.426) * (-1807.807) [-1802.875] (-1802.806) (-1818.871) -- 0:01:04 45000 -- (-1804.283) [-1802.525] (-1802.162) (-1809.847) * (-1811.013) (-1803.104) (-1805.962) [-1815.065] -- 0:01:03 Average standard deviation of split frequencies: 0.038764 45500 -- (-1804.306) (-1802.672) [-1803.500] (-1814.201) * (-1809.954) (-1803.203) (-1803.156) [-1821.633] -- 0:01:02 46000 -- (-1803.990) (-1802.720) (-1807.219) [-1810.664] * (-1813.790) [-1803.737] (-1804.129) (-1813.866) -- 0:01:02 46500 -- (-1805.399) (-1802.813) [-1803.808] (-1813.848) * [-1809.908] (-1803.354) (-1803.743) (-1815.188) -- 0:01:01 47000 -- [-1802.714] (-1813.334) (-1804.056) (-1819.952) * (-1810.764) (-1802.858) [-1803.690] (-1811.530) -- 0:01:00 47500 -- [-1802.939] (-1810.628) (-1805.007) (-1811.407) * (-1806.229) (-1803.690) (-1802.859) [-1813.383] -- 0:01:00 48000 -- (-1803.059) (-1806.187) (-1803.055) [-1810.967] * (-1817.179) (-1802.852) (-1801.685) [-1814.779] -- 0:00:59 48500 -- [-1802.189] (-1806.394) (-1804.119) (-1812.275) * [-1816.074] (-1802.280) (-1801.685) (-1811.040) -- 0:00:58 49000 -- [-1802.891] (-1805.669) (-1803.597) (-1810.829) * (-1811.021) (-1802.351) [-1801.642] (-1817.195) -- 0:01:17 49500 -- (-1802.891) (-1806.356) (-1804.664) [-1812.619] * (-1823.667) (-1802.924) [-1802.638] (-1813.140) -- 0:01:16 50000 -- (-1804.222) [-1803.907] (-1801.925) (-1816.470) * (-1819.645) [-1802.853] (-1804.451) (-1816.543) -- 0:01:16 Average standard deviation of split frequencies: 0.039874 50500 -- (-1801.897) (-1803.521) [-1801.549] (-1820.446) * (-1810.712) [-1802.601] (-1803.327) (-1819.858) -- 0:01:15 51000 -- (-1803.641) (-1804.303) (-1803.233) [-1816.023] * (-1816.533) (-1802.354) [-1802.594] (-1813.953) -- 0:01:14 51500 -- [-1802.907] (-1802.824) (-1802.722) (-1815.723) * (-1820.369) [-1802.977] (-1802.555) (-1817.969) -- 0:01:13 52000 -- [-1804.174] (-1802.871) (-1802.628) (-1809.212) * (-1812.043) (-1803.260) (-1804.923) [-1816.038] -- 0:01:12 52500 -- (-1804.664) (-1803.074) [-1802.834] (-1809.321) * [-1808.881] (-1807.852) (-1808.253) (-1816.296) -- 0:01:12 53000 -- (-1804.068) [-1802.986] (-1803.161) (-1819.079) * (-1811.195) [-1804.632] (-1808.184) (-1810.503) -- 0:01:11 53500 -- (-1804.693) [-1804.282] (-1804.577) (-1812.742) * (-1807.396) [-1803.699] (-1805.899) (-1808.873) -- 0:01:10 54000 -- (-1801.956) (-1803.572) (-1802.743) [-1809.735] * (-1806.085) (-1806.880) [-1804.778] (-1816.485) -- 0:01:10 54500 -- [-1803.854] (-1805.513) (-1802.426) (-1819.700) * (-1817.846) (-1810.531) (-1806.387) [-1807.488] -- 0:01:09 55000 -- (-1803.791) (-1808.487) (-1802.136) [-1810.467] * (-1813.703) [-1803.323] (-1804.588) (-1814.442) -- 0:01:08 Average standard deviation of split frequencies: 0.032830 55500 -- (-1804.164) (-1807.990) [-1802.167] (-1813.278) * (-1812.967) [-1803.167] (-1802.415) (-1809.378) -- 0:01:08 56000 -- (-1803.884) (-1807.515) (-1803.035) [-1817.425] * (-1815.244) (-1803.855) [-1803.410] (-1811.264) -- 0:01:07 56500 -- (-1804.133) (-1806.293) (-1803.372) [-1807.058] * (-1813.687) (-1803.036) (-1803.105) [-1811.859] -- 0:01:06 57000 -- [-1804.338] (-1806.291) (-1805.157) (-1818.084) * [-1813.453] (-1803.499) (-1802.401) (-1810.071) -- 0:01:06 57500 -- (-1804.799) (-1803.279) [-1804.252] (-1816.545) * (-1808.413) (-1804.192) (-1802.401) [-1807.868] -- 0:01:05 58000 -- (-1803.536) (-1803.834) [-1804.128] (-1813.687) * (-1819.121) [-1804.752] (-1802.955) (-1813.691) -- 0:01:04 58500 -- [-1803.796] (-1802.636) (-1803.354) (-1820.558) * (-1817.774) (-1805.628) [-1802.831] (-1809.057) -- 0:01:04 59000 -- [-1803.921] (-1803.254) (-1803.069) (-1816.072) * [-1810.953] (-1804.897) (-1802.831) (-1814.147) -- 0:01:03 59500 -- [-1804.598] (-1803.813) (-1802.558) (-1816.794) * (-1808.231) (-1805.140) (-1806.038) [-1809.853] -- 0:01:03 60000 -- (-1807.047) (-1804.774) (-1801.947) [-1818.558] * (-1816.320) (-1807.927) (-1805.388) [-1805.203] -- 0:01:02 Average standard deviation of split frequencies: 0.032247 60500 -- (-1803.333) (-1806.286) (-1801.661) [-1809.319] * (-1813.041) (-1804.532) [-1802.288] (-1809.904) -- 0:01:02 61000 -- [-1803.548] (-1802.629) (-1802.422) (-1822.324) * (-1809.424) (-1802.974) [-1803.591] (-1814.452) -- 0:01:01 61500 -- (-1805.826) (-1802.875) [-1801.680] (-1812.920) * (-1816.435) (-1803.361) (-1805.400) [-1813.055] -- 0:01:01 62000 -- (-1807.529) (-1803.346) [-1801.680] (-1820.222) * [-1811.465] (-1802.111) (-1805.643) (-1812.932) -- 0:01:00 62500 -- [-1810.118] (-1802.636) (-1801.680) (-1813.712) * (-1808.588) (-1803.169) (-1805.257) [-1814.803] -- 0:01:00 63000 -- (-1804.974) (-1805.873) (-1803.454) [-1811.267] * (-1817.135) (-1803.556) [-1803.061] (-1807.384) -- 0:00:59 63500 -- (-1802.413) (-1804.103) (-1805.875) [-1811.647] * (-1815.276) (-1804.569) (-1803.674) [-1807.204] -- 0:01:13 64000 -- [-1802.753] (-1803.003) (-1806.468) (-1827.698) * (-1816.129) [-1802.633] (-1803.799) (-1810.449) -- 0:01:13 64500 -- (-1804.229) (-1802.921) [-1806.509] (-1818.178) * (-1811.289) (-1804.309) (-1803.487) [-1812.107] -- 0:01:12 65000 -- (-1802.898) (-1803.064) [-1801.711] (-1810.982) * (-1814.983) [-1804.580] (-1803.345) (-1812.580) -- 0:01:11 Average standard deviation of split frequencies: 0.027550 65500 -- [-1803.161] (-1803.033) (-1801.711) (-1814.743) * (-1812.930) [-1802.964] (-1805.011) (-1809.941) -- 0:01:11 66000 -- (-1803.235) (-1802.391) (-1803.307) [-1807.214] * (-1809.075) (-1801.929) [-1802.696] (-1819.427) -- 0:01:10 66500 -- (-1804.045) (-1802.686) [-1803.819] (-1809.822) * (-1817.729) [-1801.932] (-1803.615) (-1818.787) -- 0:01:10 67000 -- (-1803.405) (-1802.740) [-1803.627] (-1812.913) * (-1818.690) (-1804.493) [-1804.374] (-1809.165) -- 0:01:09 67500 -- (-1803.265) (-1803.907) [-1803.112] (-1816.747) * [-1807.773] (-1803.337) (-1804.385) (-1816.633) -- 0:01:09 68000 -- (-1802.915) [-1802.438] (-1803.991) (-1816.931) * (-1810.708) (-1803.022) [-1803.517] (-1817.073) -- 0:01:08 68500 -- [-1802.667] (-1802.380) (-1803.992) (-1819.973) * (-1812.330) [-1802.042] (-1807.189) (-1806.985) -- 0:01:07 69000 -- [-1804.097] (-1802.380) (-1802.956) (-1819.956) * (-1814.527) [-1801.913] (-1806.542) (-1805.812) -- 0:01:07 69500 -- (-1803.685) (-1801.930) [-1810.619] (-1811.982) * (-1817.106) (-1803.080) [-1805.832] (-1803.899) -- 0:01:06 70000 -- (-1805.672) [-1803.065] (-1806.028) (-1815.057) * (-1805.786) [-1803.023] (-1805.907) (-1803.340) -- 0:01:06 Average standard deviation of split frequencies: 0.027593 70500 -- (-1804.647) (-1803.254) (-1805.987) [-1811.693] * [-1816.052] (-1803.118) (-1804.545) (-1803.733) -- 0:01:05 71000 -- (-1810.042) (-1803.419) (-1806.752) [-1812.607] * (-1809.548) [-1806.445] (-1809.791) (-1806.118) -- 0:01:05 71500 -- (-1805.082) (-1805.092) (-1802.720) [-1824.468] * (-1817.054) (-1802.355) (-1808.908) [-1805.103] -- 0:01:04 72000 -- (-1808.801) (-1805.476) (-1802.488) [-1808.017] * [-1810.778] (-1803.403) (-1805.490) (-1805.705) -- 0:01:04 72500 -- (-1804.358) (-1804.772) [-1802.790] (-1819.895) * (-1821.474) (-1806.942) (-1805.491) [-1805.714] -- 0:01:03 73000 -- (-1805.002) [-1802.973] (-1802.603) (-1812.332) * (-1818.763) (-1807.004) [-1804.804] (-1802.490) -- 0:01:03 73500 -- (-1803.545) (-1805.474) (-1802.235) [-1813.017] * (-1819.066) (-1804.333) [-1804.305] (-1804.703) -- 0:01:03 74000 -- (-1803.158) (-1805.931) [-1802.174] (-1811.767) * (-1808.390) [-1802.601] (-1804.549) (-1804.378) -- 0:01:02 74500 -- (-1802.694) (-1803.279) [-1802.471] (-1813.784) * (-1804.967) (-1802.696) [-1802.735] (-1805.251) -- 0:01:02 75000 -- (-1802.672) (-1801.617) [-1802.465] (-1812.999) * (-1808.238) (-1804.059) [-1807.171] (-1805.637) -- 0:01:01 Average standard deviation of split frequencies: 0.025137 75500 -- [-1801.970] (-1802.096) (-1804.133) (-1814.215) * (-1806.431) [-1804.152] (-1804.160) (-1802.969) -- 0:01:01 76000 -- (-1802.329) (-1802.653) (-1803.327) [-1806.771] * (-1806.962) (-1803.470) [-1803.752] (-1803.750) -- 0:01:00 76500 -- (-1802.422) (-1802.653) (-1808.756) [-1811.760] * (-1807.798) [-1803.230] (-1804.793) (-1803.274) -- 0:01:00 77000 -- (-1802.202) (-1804.490) (-1802.219) [-1811.141] * [-1806.637] (-1804.226) (-1803.274) (-1803.274) -- 0:00:59 77500 -- [-1802.988] (-1805.168) (-1804.469) (-1818.725) * [-1807.216] (-1805.801) (-1804.010) (-1803.836) -- 0:01:11 78000 -- (-1801.793) (-1805.014) [-1803.585] (-1815.340) * (-1808.238) (-1803.151) [-1803.085] (-1802.696) -- 0:01:10 78500 -- (-1802.024) (-1804.690) (-1803.520) [-1809.847] * [-1803.955] (-1802.485) (-1802.744) (-1803.039) -- 0:01:10 79000 -- (-1803.986) (-1804.021) [-1802.431] (-1815.597) * (-1803.347) [-1802.449] (-1804.570) (-1805.159) -- 0:01:09 79500 -- (-1805.086) (-1806.950) [-1802.832] (-1813.725) * (-1802.723) [-1804.016] (-1806.003) (-1804.462) -- 0:01:09 80000 -- (-1803.815) [-1803.349] (-1802.289) (-1814.503) * (-1803.661) (-1805.085) [-1804.456] (-1804.662) -- 0:01:09 Average standard deviation of split frequencies: 0.023375 80500 -- (-1802.263) (-1802.781) (-1803.187) [-1809.752] * (-1804.238) (-1803.780) [-1801.557] (-1808.525) -- 0:01:08 81000 -- (-1805.806) (-1803.550) [-1803.288] (-1820.349) * [-1806.756] (-1810.427) (-1803.681) (-1803.081) -- 0:01:08 81500 -- (-1808.735) (-1806.151) [-1803.416] (-1807.832) * (-1805.960) (-1810.762) [-1803.298] (-1802.926) -- 0:01:07 82000 -- (-1805.198) (-1802.947) [-1803.462] (-1812.007) * [-1806.314] (-1804.379) (-1803.296) (-1803.277) -- 0:01:07 82500 -- (-1804.588) (-1803.095) (-1802.699) [-1811.524] * (-1805.839) (-1803.328) [-1802.718] (-1804.921) -- 0:01:06 83000 -- (-1803.339) [-1804.772] (-1803.557) (-1811.068) * (-1805.187) (-1803.956) (-1804.594) [-1803.567] -- 0:01:06 83500 -- (-1806.181) [-1804.683] (-1803.521) (-1818.599) * (-1807.432) (-1804.302) (-1802.440) [-1802.125] -- 0:01:05 84000 -- [-1802.853] (-1805.396) (-1802.526) (-1816.968) * [-1804.454] (-1804.107) (-1802.791) (-1803.103) -- 0:01:05 84500 -- (-1802.841) [-1803.145] (-1805.134) (-1811.850) * [-1805.400] (-1806.192) (-1809.723) (-1803.175) -- 0:01:05 85000 -- (-1805.428) (-1809.632) (-1804.410) [-1812.808] * (-1804.330) [-1806.869] (-1805.418) (-1804.923) -- 0:01:04 Average standard deviation of split frequencies: 0.024014 85500 -- [-1805.079] (-1811.955) (-1803.571) (-1817.063) * (-1804.513) (-1807.681) (-1805.678) [-1803.266] -- 0:01:04 86000 -- (-1803.392) (-1810.528) (-1802.872) [-1814.004] * (-1805.971) (-1805.136) (-1803.487) [-1804.219] -- 0:01:03 86500 -- (-1803.531) [-1807.115] (-1803.506) (-1823.649) * (-1803.996) (-1805.055) (-1802.461) [-1802.012] -- 0:01:03 87000 -- (-1804.433) (-1813.232) [-1803.951] (-1809.835) * [-1802.730] (-1805.635) (-1803.221) (-1804.380) -- 0:01:02 87500 -- [-1803.217] (-1806.753) (-1803.087) (-1814.544) * (-1803.106) (-1803.535) [-1803.150] (-1803.897) -- 0:01:02 88000 -- (-1803.234) (-1806.749) (-1804.865) [-1809.587] * (-1802.227) [-1804.578] (-1804.316) (-1807.627) -- 0:01:02 88500 -- (-1802.212) (-1807.204) (-1803.754) [-1807.654] * (-1804.178) (-1802.501) (-1804.639) [-1803.996] -- 0:01:01 89000 -- [-1803.380] (-1804.993) (-1805.577) (-1804.811) * (-1803.471) (-1802.244) (-1802.724) [-1803.667] -- 0:01:01 89500 -- (-1805.355) (-1804.778) [-1804.082] (-1804.959) * [-1802.612] (-1802.990) (-1801.884) (-1802.284) -- 0:01:01 90000 -- (-1801.878) (-1807.319) (-1804.677) [-1803.984] * (-1808.163) (-1801.658) (-1803.208) [-1802.594] -- 0:01:00 Average standard deviation of split frequencies: 0.020302 90500 -- (-1801.760) [-1803.176] (-1806.071) (-1805.264) * (-1805.936) [-1801.983] (-1802.272) (-1803.015) -- 0:01:00 91000 -- [-1802.583] (-1803.446) (-1806.793) (-1805.799) * [-1805.891] (-1801.983) (-1802.272) (-1803.015) -- 0:00:59 91500 -- [-1803.792] (-1802.442) (-1805.293) (-1806.945) * (-1803.079) (-1801.981) [-1804.164] (-1805.825) -- 0:00:59 92000 -- (-1806.437) [-1802.657] (-1803.527) (-1807.527) * [-1804.012] (-1802.798) (-1804.368) (-1803.709) -- 0:00:59 92500 -- (-1803.348) (-1803.868) (-1801.961) [-1804.213] * (-1805.725) (-1802.121) [-1803.437] (-1802.985) -- 0:00:58 93000 -- (-1805.701) [-1802.088] (-1802.798) (-1803.305) * (-1806.434) [-1802.488] (-1802.751) (-1805.018) -- 0:01:08 93500 -- (-1802.982) [-1802.343] (-1803.026) (-1802.793) * [-1802.469] (-1802.494) (-1802.035) (-1804.334) -- 0:01:07 94000 -- (-1807.047) [-1802.322] (-1802.117) (-1803.597) * (-1810.760) (-1803.684) [-1803.104] (-1803.288) -- 0:01:07 94500 -- (-1810.278) [-1802.879] (-1802.916) (-1804.116) * (-1807.476) [-1802.172] (-1810.241) (-1803.033) -- 0:01:07 95000 -- [-1806.785] (-1803.190) (-1805.141) (-1802.468) * (-1802.922) [-1802.437] (-1803.095) (-1801.711) -- 0:01:06 Average standard deviation of split frequencies: 0.021045 95500 -- (-1803.243) (-1811.399) (-1804.323) [-1802.524] * (-1801.837) (-1803.604) [-1803.177] (-1802.156) -- 0:01:06 96000 -- (-1804.127) (-1801.729) (-1802.878) [-1801.718] * [-1802.923] (-1805.919) (-1804.603) (-1802.403) -- 0:01:05 96500 -- [-1803.691] (-1801.864) (-1803.871) (-1802.789) * [-1805.315] (-1803.396) (-1803.165) (-1802.476) -- 0:01:05 97000 -- (-1802.615) (-1804.152) (-1804.462) [-1804.034] * [-1803.330] (-1802.063) (-1804.416) (-1802.476) -- 0:01:05 97500 -- (-1803.283) (-1803.942) [-1804.392] (-1802.911) * (-1802.231) [-1803.287] (-1803.277) (-1802.495) -- 0:01:04 98000 -- (-1803.733) (-1803.893) [-1803.087] (-1802.333) * (-1802.135) (-1804.052) (-1801.979) [-1802.487] -- 0:01:04 98500 -- [-1804.488] (-1803.261) (-1804.555) (-1803.157) * (-1805.004) (-1804.053) [-1801.818] (-1801.711) -- 0:01:04 99000 -- (-1802.182) [-1803.490] (-1808.954) (-1804.381) * (-1803.961) (-1804.649) [-1803.904] (-1803.089) -- 0:01:03 99500 -- [-1804.675] (-1804.543) (-1804.091) (-1803.985) * (-1806.577) (-1803.253) [-1803.384] (-1804.639) -- 0:01:03 100000 -- [-1805.054] (-1802.332) (-1804.903) (-1802.554) * (-1806.176) (-1803.435) [-1803.360] (-1802.827) -- 0:01:02 Average standard deviation of split frequencies: 0.021073 100500 -- (-1805.293) (-1802.311) [-1804.562] (-1802.583) * (-1808.093) [-1806.115] (-1801.953) (-1804.105) -- 0:01:02 101000 -- (-1809.125) (-1803.560) [-1803.764] (-1803.090) * (-1806.989) [-1804.289] (-1804.016) (-1801.618) -- 0:01:02 101500 -- (-1804.770) (-1804.860) (-1805.041) [-1802.479] * (-1803.790) (-1804.351) [-1804.381] (-1803.351) -- 0:01:01 102000 -- [-1803.346] (-1802.511) (-1806.611) (-1803.204) * (-1805.753) (-1805.033) [-1803.410] (-1803.968) -- 0:01:01 102500 -- (-1803.114) [-1802.228] (-1805.119) (-1805.646) * (-1807.306) (-1805.622) [-1802.906] (-1804.638) -- 0:01:01 103000 -- (-1802.864) [-1802.822] (-1806.727) (-1806.500) * (-1804.867) [-1804.475] (-1803.282) (-1803.099) -- 0:01:00 103500 -- [-1803.947] (-1803.124) (-1802.746) (-1803.492) * (-1805.035) (-1803.452) (-1802.145) [-1803.185] -- 0:01:00 104000 -- (-1802.365) (-1804.203) [-1808.689] (-1802.955) * (-1802.989) (-1801.924) [-1803.496] (-1803.036) -- 0:01:00 104500 -- [-1806.201] (-1804.391) (-1806.326) (-1803.419) * (-1808.805) [-1803.375] (-1802.200) (-1804.032) -- 0:00:59 105000 -- (-1803.757) (-1807.024) (-1806.680) [-1802.193] * (-1809.019) [-1804.618] (-1802.304) (-1803.642) -- 0:00:59 Average standard deviation of split frequencies: 0.023126 105500 -- (-1802.326) [-1804.963] (-1804.124) (-1802.300) * [-1805.881] (-1802.991) (-1802.907) (-1803.166) -- 0:00:59 106000 -- (-1804.039) (-1804.631) (-1804.155) [-1802.435] * (-1805.109) (-1802.831) [-1803.293] (-1802.797) -- 0:00:59 106500 -- (-1806.076) (-1804.946) [-1804.266] (-1803.169) * [-1805.033] (-1804.372) (-1802.615) (-1804.090) -- 0:00:58 107000 -- (-1808.547) (-1807.097) (-1803.861) [-1804.428] * (-1806.373) (-1805.676) [-1802.232] (-1803.567) -- 0:00:58 107500 -- (-1806.670) (-1807.079) [-1803.797] (-1802.421) * (-1805.238) [-1806.175] (-1802.896) (-1803.749) -- 0:00:58 108000 -- (-1809.261) (-1805.318) (-1804.087) [-1803.680] * (-1804.027) [-1802.496] (-1802.661) (-1809.053) -- 0:00:57 108500 -- (-1808.961) (-1808.727) (-1802.984) [-1802.505] * (-1804.644) [-1804.071] (-1803.178) (-1807.747) -- 0:01:05 109000 -- [-1805.432] (-1806.499) (-1803.099) (-1802.505) * [-1803.507] (-1804.866) (-1802.802) (-1804.009) -- 0:01:05 109500 -- (-1802.455) (-1803.428) (-1803.839) [-1803.640] * (-1803.689) (-1805.573) [-1801.834] (-1804.965) -- 0:01:05 110000 -- [-1802.430] (-1803.714) (-1803.048) (-1802.427) * (-1804.141) [-1806.482] (-1803.159) (-1802.425) -- 0:01:04 Average standard deviation of split frequencies: 0.024280 110500 -- (-1802.713) [-1804.340] (-1804.645) (-1802.450) * (-1804.152) (-1808.148) [-1804.316] (-1810.858) -- 0:01:04 111000 -- [-1802.654] (-1803.013) (-1804.432) (-1802.237) * [-1805.344] (-1803.733) (-1805.766) (-1808.864) -- 0:01:04 111500 -- (-1802.418) [-1806.243] (-1809.271) (-1804.315) * (-1809.200) [-1804.846] (-1803.556) (-1806.265) -- 0:01:03 112000 -- (-1802.408) (-1804.687) (-1808.394) [-1805.013] * (-1806.264) (-1803.016) [-1803.065] (-1810.575) -- 0:01:03 112500 -- (-1802.405) (-1803.314) (-1801.985) [-1801.881] * [-1806.230] (-1803.241) (-1806.474) (-1806.777) -- 0:01:03 113000 -- (-1802.142) [-1803.507] (-1802.605) (-1805.342) * (-1806.057) [-1803.057] (-1806.362) (-1806.065) -- 0:01:02 113500 -- (-1805.091) (-1802.882) (-1802.582) [-1804.396] * (-1808.416) (-1803.166) (-1803.651) [-1807.318] -- 0:01:02 114000 -- [-1803.418] (-1804.137) (-1804.159) (-1805.289) * (-1810.406) (-1803.249) [-1803.179] (-1807.501) -- 0:01:02 114500 -- (-1807.681) (-1807.360) [-1802.776] (-1801.432) * (-1810.176) [-1803.262] (-1803.270) (-1813.802) -- 0:01:01 115000 -- (-1802.651) (-1803.528) (-1804.875) [-1804.288] * (-1807.708) (-1802.492) [-1801.822] (-1806.434) -- 0:01:01 Average standard deviation of split frequencies: 0.021335 115500 -- [-1802.336] (-1806.839) (-1803.508) (-1803.908) * [-1810.215] (-1802.241) (-1804.090) (-1808.081) -- 0:01:01 116000 -- (-1802.339) (-1805.851) [-1804.737] (-1803.256) * (-1805.084) (-1803.511) [-1804.530] (-1805.818) -- 0:01:00 116500 -- [-1802.596] (-1806.426) (-1805.697) (-1805.079) * (-1805.891) [-1802.708] (-1804.560) (-1803.049) -- 0:01:00 117000 -- (-1802.596) (-1804.107) [-1804.500] (-1804.888) * (-1805.156) (-1803.297) (-1802.636) [-1803.784] -- 0:01:00 117500 -- [-1803.620] (-1803.938) (-1810.307) (-1803.249) * (-1804.051) [-1803.710] (-1803.938) (-1802.965) -- 0:01:00 118000 -- (-1803.478) [-1805.235] (-1804.003) (-1802.570) * (-1806.042) (-1802.744) [-1802.552] (-1803.524) -- 0:00:59 118500 -- [-1802.183] (-1805.150) (-1804.649) (-1803.744) * (-1803.997) (-1803.212) (-1803.574) [-1803.066] -- 0:00:59 119000 -- (-1802.429) (-1803.186) [-1806.682] (-1804.460) * [-1804.710] (-1802.816) (-1805.402) (-1803.143) -- 0:00:59 119500 -- (-1802.096) (-1803.413) (-1804.470) [-1802.349] * [-1804.649] (-1803.244) (-1803.434) (-1803.021) -- 0:00:58 120000 -- (-1804.541) (-1806.591) (-1806.765) [-1803.552] * (-1804.368) [-1802.136] (-1805.716) (-1803.642) -- 0:00:58 Average standard deviation of split frequencies: 0.021921 120500 -- (-1802.056) (-1803.436) [-1805.037] (-1803.450) * (-1801.923) [-1802.333] (-1803.280) (-1803.612) -- 0:00:58 121000 -- (-1803.989) (-1804.449) [-1803.082] (-1804.427) * (-1803.868) (-1802.913) (-1803.900) [-1804.308] -- 0:00:58 121500 -- [-1803.370] (-1802.230) (-1804.264) (-1804.272) * (-1805.325) (-1802.199) [-1803.687] (-1805.983) -- 0:00:57 122000 -- (-1802.360) [-1805.088] (-1803.256) (-1806.503) * (-1804.341) (-1802.199) [-1803.224] (-1803.495) -- 0:00:57 122500 -- (-1804.155) [-1804.980] (-1803.357) (-1803.511) * [-1801.912] (-1805.816) (-1803.700) (-1803.393) -- 0:00:57 123000 -- [-1803.309] (-1805.489) (-1802.982) (-1803.455) * [-1802.038] (-1805.816) (-1803.729) (-1805.049) -- 0:00:57 123500 -- (-1802.753) [-1806.721] (-1806.258) (-1801.632) * (-1803.911) (-1801.943) (-1804.799) [-1803.039] -- 0:00:56 124000 -- (-1805.028) (-1807.082) [-1803.181] (-1801.631) * (-1803.014) (-1802.453) (-1804.078) [-1804.847] -- 0:01:03 124500 -- (-1807.860) (-1806.338) (-1803.372) [-1804.289] * [-1803.699] (-1803.686) (-1807.280) (-1803.589) -- 0:01:03 125000 -- (-1806.136) (-1806.558) (-1804.795) [-1803.996] * (-1804.834) (-1805.945) [-1804.698] (-1808.466) -- 0:01:03 Average standard deviation of split frequencies: 0.020390 125500 -- (-1806.006) [-1803.663] (-1804.705) (-1803.678) * [-1805.011] (-1804.418) (-1802.921) (-1808.238) -- 0:01:02 126000 -- [-1802.586] (-1804.088) (-1803.809) (-1804.385) * (-1803.790) (-1804.222) (-1804.190) [-1805.336] -- 0:01:02 126500 -- (-1802.131) [-1805.566] (-1805.094) (-1803.854) * (-1803.843) (-1803.119) [-1803.590] (-1805.442) -- 0:01:02 127000 -- [-1803.288] (-1804.475) (-1804.549) (-1803.184) * (-1803.949) (-1803.445) [-1803.783] (-1805.452) -- 0:01:01 127500 -- (-1804.392) [-1806.570] (-1803.874) (-1803.388) * [-1803.628] (-1803.989) (-1802.071) (-1804.889) -- 0:01:01 128000 -- [-1802.874] (-1806.971) (-1803.496) (-1802.245) * [-1803.922] (-1804.660) (-1802.311) (-1807.764) -- 0:01:01 128500 -- (-1803.680) [-1809.074] (-1803.080) (-1802.467) * [-1803.763] (-1806.147) (-1801.981) (-1805.208) -- 0:01:01 129000 -- [-1803.282] (-1804.506) (-1804.151) (-1801.628) * (-1804.469) (-1804.133) [-1804.275] (-1805.143) -- 0:01:00 129500 -- (-1803.074) (-1806.866) [-1805.801] (-1801.780) * [-1807.931] (-1802.996) (-1802.199) (-1803.104) -- 0:01:00 130000 -- (-1805.043) (-1803.823) (-1803.025) [-1802.320] * [-1803.582] (-1805.000) (-1802.251) (-1804.068) -- 0:01:00 Average standard deviation of split frequencies: 0.021045 130500 -- (-1804.775) (-1803.099) (-1803.404) [-1801.987] * (-1802.017) (-1803.419) (-1807.271) [-1805.458] -- 0:00:59 131000 -- [-1804.848] (-1802.702) (-1803.669) (-1802.905) * (-1803.315) (-1803.850) (-1805.661) [-1804.285] -- 0:00:59 131500 -- (-1803.741) (-1803.836) (-1803.097) [-1802.154] * (-1803.795) (-1803.583) [-1806.222] (-1804.463) -- 0:00:59 132000 -- [-1805.303] (-1806.801) (-1803.353) (-1802.991) * (-1804.163) (-1803.378) (-1807.171) [-1803.304] -- 0:00:59 132500 -- (-1805.898) (-1805.732) (-1802.932) [-1803.146] * [-1804.168] (-1806.613) (-1804.360) (-1803.247) -- 0:00:58 133000 -- (-1808.069) [-1805.091] (-1803.395) (-1802.220) * (-1803.975) (-1802.655) (-1804.534) [-1803.236] -- 0:00:58 133500 -- (-1804.683) (-1803.112) [-1803.573] (-1804.739) * [-1802.779] (-1803.849) (-1803.909) (-1806.238) -- 0:00:58 134000 -- (-1804.483) [-1804.204] (-1803.618) (-1803.120) * [-1805.278] (-1803.250) (-1805.662) (-1805.592) -- 0:00:58 134500 -- (-1803.256) [-1805.857] (-1802.847) (-1807.022) * (-1807.045) (-1802.593) [-1809.918] (-1803.729) -- 0:00:57 135000 -- (-1802.992) (-1806.213) [-1802.847] (-1805.311) * (-1805.051) [-1802.261] (-1804.554) (-1803.856) -- 0:00:57 Average standard deviation of split frequencies: 0.022439 135500 -- (-1803.524) (-1806.213) [-1801.498] (-1808.013) * (-1809.859) [-1803.541] (-1805.172) (-1803.413) -- 0:00:57 136000 -- (-1803.303) [-1806.275] (-1802.598) (-1808.684) * (-1806.620) (-1805.859) [-1807.861] (-1802.178) -- 0:00:57 136500 -- (-1804.803) [-1805.414] (-1802.598) (-1808.240) * [-1805.446] (-1805.119) (-1805.523) (-1804.398) -- 0:00:56 137000 -- (-1804.752) (-1803.144) [-1801.991] (-1805.082) * [-1802.807] (-1810.719) (-1802.071) (-1803.599) -- 0:00:56 137500 -- (-1805.042) [-1806.947] (-1801.490) (-1804.330) * (-1802.461) (-1806.179) [-1804.113] (-1804.172) -- 0:00:56 138000 -- [-1804.332] (-1806.948) (-1801.675) (-1806.535) * [-1804.289] (-1803.909) (-1805.984) (-1805.899) -- 0:00:56 138500 -- (-1803.537) (-1805.266) [-1802.060] (-1806.004) * (-1806.255) [-1803.491] (-1804.820) (-1806.880) -- 0:00:55 139000 -- (-1803.776) (-1803.871) [-1803.936] (-1805.070) * (-1806.672) (-1803.679) [-1802.650] (-1806.403) -- 0:00:55 139500 -- (-1803.623) [-1802.424] (-1803.031) (-1806.601) * (-1805.691) (-1803.470) (-1804.002) [-1803.298] -- 0:01:01 140000 -- (-1807.708) [-1803.867] (-1802.365) (-1803.676) * (-1805.053) (-1803.652) [-1803.034] (-1803.617) -- 0:01:01 Average standard deviation of split frequencies: 0.025134 140500 -- [-1804.796] (-1807.421) (-1803.908) (-1803.862) * (-1802.641) (-1804.523) [-1803.630] (-1806.388) -- 0:01:01 141000 -- (-1804.984) [-1803.672] (-1806.142) (-1805.871) * (-1803.833) (-1804.094) (-1804.336) [-1803.000] -- 0:01:00 141500 -- (-1804.212) [-1803.026] (-1805.905) (-1804.494) * (-1804.064) (-1805.589) [-1803.639] (-1805.232) -- 0:01:00 142000 -- (-1805.004) (-1803.572) [-1809.245] (-1807.256) * (-1804.920) (-1809.163) [-1803.639] (-1806.657) -- 0:01:00 142500 -- (-1804.420) [-1803.799] (-1804.584) (-1806.692) * [-1803.892] (-1808.345) (-1805.156) (-1804.743) -- 0:01:00 143000 -- [-1804.912] (-1806.911) (-1803.873) (-1806.682) * (-1804.116) [-1803.045] (-1804.183) (-1806.278) -- 0:00:59 143500 -- (-1803.441) (-1805.730) [-1806.305] (-1806.153) * (-1804.809) (-1803.546) (-1803.483) [-1805.761] -- 0:00:59 144000 -- [-1804.304] (-1803.900) (-1804.866) (-1806.576) * [-1804.989] (-1804.084) (-1804.170) (-1805.542) -- 0:00:59 144500 -- (-1806.186) (-1802.939) (-1804.182) [-1806.258] * [-1802.070] (-1804.031) (-1804.238) (-1805.346) -- 0:00:59 145000 -- (-1804.482) [-1803.027] (-1802.960) (-1803.279) * (-1802.089) (-1803.771) (-1802.547) [-1803.980] -- 0:00:58 Average standard deviation of split frequencies: 0.024575 145500 -- (-1803.947) (-1803.709) (-1802.009) [-1803.759] * (-1803.998) (-1808.132) (-1804.484) [-1804.460] -- 0:00:58 146000 -- (-1804.495) [-1804.593] (-1802.003) (-1805.884) * (-1804.508) (-1806.033) [-1804.530] (-1803.893) -- 0:00:58 146500 -- (-1803.651) (-1803.767) [-1801.888] (-1803.086) * (-1803.124) [-1802.896] (-1802.171) (-1802.376) -- 0:00:58 147000 -- [-1803.460] (-1805.800) (-1803.240) (-1803.480) * [-1803.601] (-1803.252) (-1802.872) (-1805.351) -- 0:00:58 147500 -- (-1803.664) (-1804.852) [-1804.626] (-1804.277) * (-1806.221) (-1802.558) (-1802.977) [-1803.384] -- 0:00:57 148000 -- (-1803.410) (-1804.852) [-1805.461] (-1802.982) * (-1803.804) [-1802.556] (-1806.498) (-1803.384) -- 0:00:57 148500 -- (-1804.459) [-1806.037] (-1803.518) (-1803.100) * (-1803.121) (-1804.526) (-1804.017) [-1803.014] -- 0:00:57 149000 -- (-1803.867) [-1806.334] (-1802.322) (-1805.690) * [-1802.916] (-1803.477) (-1803.765) (-1801.901) -- 0:00:57 149500 -- (-1802.843) (-1804.927) [-1802.685] (-1805.343) * (-1803.452) (-1808.386) [-1804.810] (-1806.402) -- 0:00:56 150000 -- (-1801.775) (-1805.179) [-1802.995] (-1804.283) * [-1803.545] (-1806.478) (-1807.284) (-1810.541) -- 0:00:56 Average standard deviation of split frequencies: 0.021165 150500 -- (-1801.775) (-1804.015) (-1802.665) [-1803.361] * (-1804.177) [-1801.978] (-1806.260) (-1802.387) -- 0:00:56 151000 -- (-1803.039) [-1804.681] (-1803.011) (-1803.402) * (-1801.873) (-1801.994) (-1807.857) [-1802.026] -- 0:00:56 151500 -- (-1803.407) (-1805.719) (-1802.658) [-1803.091] * [-1801.748] (-1802.058) (-1806.834) (-1803.632) -- 0:00:56 152000 -- [-1806.713] (-1804.277) (-1803.285) (-1803.381) * (-1802.102) (-1802.086) (-1806.436) [-1804.898] -- 0:00:55 152500 -- (-1804.980) [-1804.007] (-1801.954) (-1804.344) * (-1802.118) (-1802.040) [-1802.579] (-1803.310) -- 0:00:55 153000 -- (-1804.075) (-1804.542) (-1802.113) [-1804.808] * (-1802.549) [-1806.484] (-1802.586) (-1803.130) -- 0:00:55 153500 -- (-1804.002) (-1803.969) [-1802.114] (-1805.615) * [-1803.150] (-1811.922) (-1804.956) (-1804.284) -- 0:00:55 154000 -- (-1807.474) [-1802.784] (-1802.097) (-1806.358) * (-1802.023) [-1803.762] (-1802.120) (-1804.401) -- 0:00:54 154500 -- (-1802.289) (-1802.129) [-1802.193] (-1805.125) * [-1804.842] (-1803.993) (-1802.119) (-1803.399) -- 0:00:54 155000 -- (-1808.193) [-1802.495] (-1801.559) (-1803.971) * (-1804.618) [-1806.374] (-1803.960) (-1803.500) -- 0:00:59 Average standard deviation of split frequencies: 0.018509 155500 -- (-1807.081) [-1802.999] (-1804.048) (-1804.580) * [-1807.511] (-1807.322) (-1803.268) (-1803.753) -- 0:00:59 156000 -- (-1806.416) [-1806.513] (-1814.398) (-1803.982) * (-1806.641) (-1807.333) (-1802.718) [-1806.652] -- 0:00:59 156500 -- (-1811.341) [-1808.068] (-1805.318) (-1805.927) * (-1803.669) [-1810.284] (-1803.917) (-1804.124) -- 0:00:59 157000 -- (-1805.174) [-1803.727] (-1802.176) (-1806.379) * (-1802.369) (-1804.173) (-1802.810) [-1805.003] -- 0:00:59 157500 -- (-1801.970) (-1805.204) [-1801.961] (-1806.316) * [-1804.004] (-1804.348) (-1801.924) (-1805.150) -- 0:00:58 158000 -- [-1801.744] (-1802.729) (-1802.219) (-1805.439) * (-1804.800) [-1804.248] (-1802.812) (-1802.362) -- 0:00:58 158500 -- (-1802.023) (-1802.966) (-1803.534) [-1807.807] * [-1805.170] (-1802.263) (-1805.273) (-1802.163) -- 0:00:58 159000 -- [-1802.626] (-1803.718) (-1804.086) (-1805.864) * [-1805.984] (-1802.125) (-1808.946) (-1803.323) -- 0:00:58 159500 -- (-1802.797) (-1803.201) [-1804.877] (-1805.376) * (-1807.984) (-1803.819) [-1804.560] (-1802.639) -- 0:00:57 160000 -- [-1802.843] (-1808.322) (-1804.971) (-1804.063) * (-1810.852) [-1803.636] (-1802.423) (-1803.145) -- 0:00:57 Average standard deviation of split frequencies: 0.020021 160500 -- [-1802.225] (-1804.557) (-1804.222) (-1802.288) * (-1805.361) (-1807.314) [-1802.766] (-1803.860) -- 0:00:57 161000 -- (-1802.165) [-1803.432] (-1803.888) (-1804.042) * (-1804.641) (-1805.491) (-1803.240) [-1802.868] -- 0:00:57 161500 -- (-1808.009) [-1803.437] (-1803.396) (-1804.580) * (-1804.169) [-1804.414] (-1805.569) (-1802.733) -- 0:00:57 162000 -- (-1804.663) (-1802.393) [-1806.171] (-1804.948) * [-1802.467] (-1803.979) (-1806.207) (-1802.819) -- 0:00:56 162500 -- (-1803.439) (-1803.276) [-1806.275] (-1805.749) * (-1803.331) (-1803.939) (-1806.437) [-1802.745] -- 0:00:56 163000 -- (-1802.873) [-1803.643] (-1811.082) (-1806.586) * [-1803.288] (-1803.931) (-1804.782) (-1804.191) -- 0:00:56 163500 -- [-1804.436] (-1801.986) (-1806.558) (-1804.339) * (-1802.883) [-1805.338] (-1804.409) (-1804.141) -- 0:00:56 164000 -- (-1806.040) [-1802.384] (-1806.495) (-1804.245) * (-1803.096) (-1806.900) [-1803.501] (-1805.670) -- 0:00:56 164500 -- (-1805.569) (-1804.715) [-1804.845] (-1804.915) * [-1803.141] (-1803.141) (-1803.584) (-1803.358) -- 0:00:55 165000 -- (-1803.701) (-1801.751) [-1803.246] (-1806.113) * [-1805.039] (-1802.775) (-1803.847) (-1802.300) -- 0:00:55 Average standard deviation of split frequencies: 0.018616 165500 -- [-1803.473] (-1801.790) (-1804.446) (-1804.092) * (-1803.823) (-1802.782) [-1804.186] (-1803.603) -- 0:00:55 166000 -- (-1804.959) (-1803.773) (-1804.061) [-1803.893] * (-1802.781) (-1802.731) (-1804.184) [-1801.976] -- 0:00:55 166500 -- [-1802.384] (-1802.507) (-1803.344) (-1804.960) * (-1803.585) (-1803.594) [-1803.592] (-1803.460) -- 0:00:55 167000 -- (-1802.519) [-1804.754] (-1802.552) (-1802.610) * (-1804.479) (-1801.795) (-1811.644) [-1802.708] -- 0:00:54 167500 -- [-1802.576] (-1803.109) (-1803.698) (-1802.790) * (-1804.703) (-1803.921) [-1804.798] (-1802.517) -- 0:00:54 168000 -- (-1803.029) (-1803.754) (-1804.617) [-1802.687] * (-1806.720) (-1803.057) (-1802.818) [-1804.660] -- 0:00:54 168500 -- (-1804.521) (-1802.437) (-1803.875) [-1803.704] * [-1803.831] (-1804.788) (-1802.131) (-1802.132) -- 0:00:54 169000 -- (-1801.909) [-1802.275] (-1805.353) (-1802.977) * (-1802.971) (-1804.172) [-1802.132] (-1803.905) -- 0:00:54 169500 -- (-1803.622) (-1802.990) [-1803.323] (-1803.915) * (-1803.125) (-1805.811) (-1802.682) [-1803.767] -- 0:00:53 170000 -- (-1804.124) (-1803.625) (-1803.395) [-1806.960] * (-1802.547) (-1803.917) (-1805.386) [-1803.225] -- 0:00:53 Average standard deviation of split frequencies: 0.019795 170500 -- [-1802.651] (-1803.298) (-1804.747) (-1802.720) * [-1803.046] (-1803.509) (-1807.551) (-1804.754) -- 0:00:58 171000 -- (-1802.651) (-1802.422) (-1803.136) [-1801.733] * (-1806.079) [-1802.561] (-1807.658) (-1806.687) -- 0:00:58 171500 -- (-1803.074) (-1802.244) [-1803.090] (-1807.548) * [-1806.524] (-1802.842) (-1803.092) (-1806.687) -- 0:00:57 172000 -- (-1805.728) [-1805.165] (-1805.033) (-1804.588) * (-1809.023) (-1802.976) [-1804.649] (-1805.620) -- 0:00:57 172500 -- [-1802.054] (-1803.277) (-1803.332) (-1808.039) * (-1805.035) [-1803.940] (-1803.481) (-1807.151) -- 0:00:57 173000 -- [-1806.626] (-1807.383) (-1802.575) (-1803.512) * (-1806.139) (-1803.992) [-1809.956] (-1808.908) -- 0:00:57 173500 -- (-1804.198) (-1804.683) (-1804.785) [-1802.182] * (-1802.824) (-1813.353) [-1802.916] (-1803.621) -- 0:00:57 174000 -- (-1804.130) [-1803.774] (-1803.758) (-1805.667) * [-1803.484] (-1804.501) (-1802.125) (-1802.924) -- 0:00:56 174500 -- (-1806.569) [-1805.258] (-1804.166) (-1803.183) * [-1805.115] (-1804.353) (-1802.603) (-1805.549) -- 0:00:56 175000 -- [-1804.900] (-1802.924) (-1804.600) (-1803.505) * (-1804.567) [-1806.923] (-1803.355) (-1806.646) -- 0:00:56 Average standard deviation of split frequencies: 0.017559 175500 -- (-1804.527) (-1802.158) [-1804.650] (-1803.995) * (-1803.729) (-1804.537) [-1803.756] (-1808.318) -- 0:00:56 176000 -- (-1808.326) (-1805.051) (-1803.329) [-1803.430] * [-1803.719] (-1805.235) (-1803.436) (-1808.439) -- 0:00:56 176500 -- [-1804.068] (-1803.085) (-1801.861) (-1807.069) * (-1804.113) (-1806.379) (-1804.506) [-1805.535] -- 0:00:55 177000 -- (-1804.828) [-1802.183] (-1803.296) (-1805.304) * [-1803.699] (-1805.517) (-1803.649) (-1808.474) -- 0:00:55 177500 -- (-1807.399) (-1804.716) [-1804.634] (-1806.262) * [-1803.758] (-1805.294) (-1804.182) (-1802.799) -- 0:00:55 178000 -- (-1805.076) (-1804.240) [-1802.474] (-1807.978) * (-1803.581) [-1804.655] (-1805.759) (-1804.910) -- 0:00:55 178500 -- [-1804.472] (-1803.441) (-1803.377) (-1806.357) * (-1803.582) (-1803.915) [-1803.623] (-1805.017) -- 0:00:55 179000 -- (-1806.246) [-1803.482] (-1804.328) (-1804.554) * [-1804.483] (-1804.235) (-1801.998) (-1804.150) -- 0:00:55 179500 -- (-1806.538) [-1803.165] (-1804.444) (-1803.712) * [-1804.698] (-1804.882) (-1803.335) (-1804.288) -- 0:00:54 180000 -- (-1806.074) (-1802.722) (-1810.057) [-1806.800] * (-1803.082) (-1803.509) [-1801.681] (-1804.150) -- 0:00:54 Average standard deviation of split frequencies: 0.015800 180500 -- (-1804.213) [-1803.688] (-1807.015) (-1803.386) * (-1804.502) (-1804.360) [-1805.643] (-1802.982) -- 0:00:54 181000 -- (-1803.996) [-1804.632] (-1808.018) (-1804.414) * (-1803.898) (-1803.640) (-1804.314) [-1804.450] -- 0:00:54 181500 -- (-1802.524) (-1804.443) [-1804.440] (-1801.975) * (-1803.759) [-1802.190] (-1803.568) (-1802.282) -- 0:00:54 182000 -- [-1803.565] (-1804.443) (-1804.269) (-1802.640) * (-1807.349) [-1803.043] (-1803.149) (-1802.521) -- 0:00:53 182500 -- (-1804.514) [-1802.207] (-1804.034) (-1805.561) * (-1807.823) [-1802.620] (-1809.056) (-1803.124) -- 0:00:53 183000 -- (-1805.365) [-1802.472] (-1805.024) (-1805.023) * (-1804.484) (-1803.166) (-1806.251) [-1803.813] -- 0:00:53 183500 -- (-1805.251) (-1803.864) [-1806.978] (-1802.728) * (-1804.780) (-1805.676) (-1803.503) [-1802.218] -- 0:00:53 184000 -- (-1806.081) (-1804.128) [-1805.123] (-1803.236) * (-1805.665) [-1807.654] (-1802.939) (-1802.236) -- 0:00:53 184500 -- (-1804.049) (-1801.961) [-1805.219] (-1803.621) * (-1805.733) (-1805.847) (-1802.989) [-1802.281] -- 0:00:53 185000 -- (-1804.281) (-1803.801) [-1802.122] (-1804.176) * [-1802.528] (-1804.235) (-1803.965) (-1803.290) -- 0:00:52 Average standard deviation of split frequencies: 0.013873 185500 -- (-1806.857) (-1801.716) (-1802.813) [-1806.011] * (-1801.801) [-1804.274] (-1805.235) (-1804.343) -- 0:00:57 186000 -- (-1807.443) [-1806.796] (-1802.766) (-1802.028) * (-1802.414) [-1803.455] (-1803.697) (-1803.766) -- 0:00:56 186500 -- (-1807.160) (-1804.386) [-1802.553] (-1802.728) * (-1802.022) (-1803.584) (-1803.255) [-1803.278] -- 0:00:56 187000 -- (-1804.213) (-1811.061) [-1806.437] (-1802.574) * (-1804.185) (-1805.305) [-1803.683] (-1804.845) -- 0:00:56 187500 -- (-1808.356) (-1806.545) [-1808.746] (-1805.103) * [-1804.818] (-1804.933) (-1803.912) (-1804.350) -- 0:00:56 188000 -- [-1803.444] (-1806.458) (-1806.308) (-1802.912) * (-1802.879) [-1802.765] (-1805.473) (-1805.128) -- 0:00:56 188500 -- (-1805.019) [-1806.447] (-1804.923) (-1806.477) * (-1803.021) (-1801.717) [-1806.816] (-1804.415) -- 0:00:55 189000 -- (-1802.884) (-1809.409) [-1801.736] (-1806.073) * [-1804.147] (-1801.822) (-1804.716) (-1806.338) -- 0:00:55 189500 -- [-1804.869] (-1808.901) (-1802.843) (-1803.079) * (-1803.021) [-1802.215] (-1803.083) (-1805.631) -- 0:00:55 190000 -- (-1805.292) (-1803.337) [-1802.555] (-1803.432) * (-1804.243) (-1802.896) (-1802.863) [-1802.842] -- 0:00:55 Average standard deviation of split frequencies: 0.014444 190500 -- (-1806.266) (-1804.183) (-1801.904) [-1802.872] * (-1803.911) [-1803.881] (-1803.624) (-1802.582) -- 0:00:55 191000 -- (-1803.759) (-1805.925) [-1801.685] (-1804.044) * [-1803.643] (-1803.886) (-1803.649) (-1803.071) -- 0:00:55 191500 -- (-1802.486) (-1805.191) (-1802.318) [-1806.344] * (-1805.969) [-1805.173] (-1804.040) (-1802.916) -- 0:00:54 192000 -- (-1804.717) (-1806.933) [-1801.932] (-1806.188) * (-1805.412) (-1804.795) (-1802.438) [-1804.042] -- 0:00:54 192500 -- (-1805.731) (-1806.658) (-1802.538) [-1803.145] * (-1805.508) (-1805.756) (-1802.041) [-1804.380] -- 0:00:54 193000 -- (-1802.926) (-1803.848) [-1802.425] (-1804.156) * [-1803.684] (-1803.790) (-1803.700) (-1802.402) -- 0:00:54 193500 -- [-1802.921] (-1805.103) (-1802.971) (-1804.039) * (-1802.545) (-1802.754) [-1801.755] (-1803.974) -- 0:00:54 194000 -- (-1803.869) (-1804.015) (-1803.311) [-1802.265] * [-1803.486] (-1802.460) (-1805.400) (-1803.756) -- 0:00:54 194500 -- (-1805.250) (-1804.387) (-1802.977) [-1802.665] * (-1802.637) (-1802.644) [-1804.440] (-1805.201) -- 0:00:53 195000 -- (-1803.366) [-1803.818] (-1802.397) (-1808.144) * (-1802.249) (-1802.644) [-1803.160] (-1804.064) -- 0:00:53 Average standard deviation of split frequencies: 0.014190 195500 -- (-1804.873) (-1802.635) [-1803.881] (-1804.725) * (-1803.358) (-1802.086) [-1802.598] (-1801.897) -- 0:00:53 196000 -- (-1803.917) (-1802.253) [-1802.225] (-1806.196) * [-1803.358] (-1802.458) (-1802.070) (-1802.599) -- 0:00:53 196500 -- (-1802.252) [-1802.635] (-1802.807) (-1804.326) * [-1803.632] (-1803.230) (-1803.676) (-1804.106) -- 0:00:53 197000 -- [-1803.746] (-1804.867) (-1802.780) (-1804.121) * (-1807.144) (-1803.023) [-1805.835] (-1807.393) -- 0:00:52 197500 -- (-1807.626) (-1803.142) [-1803.431] (-1803.350) * (-1804.248) (-1805.830) [-1804.640] (-1805.495) -- 0:00:52 198000 -- (-1805.753) (-1802.641) (-1805.581) [-1803.243] * (-1808.092) (-1806.337) [-1805.297] (-1805.115) -- 0:00:52 198500 -- (-1804.478) (-1802.521) [-1803.768] (-1802.600) * (-1807.293) (-1803.201) [-1805.329] (-1801.757) -- 0:00:52 199000 -- [-1801.887] (-1802.222) (-1804.119) (-1803.544) * (-1805.378) [-1801.977] (-1806.203) (-1803.579) -- 0:00:52 199500 -- [-1801.896] (-1802.273) (-1805.057) (-1805.909) * (-1803.864) (-1801.988) (-1804.385) [-1803.743] -- 0:00:52 200000 -- (-1804.642) (-1802.273) [-1803.436] (-1805.314) * (-1803.923) (-1801.987) (-1807.550) [-1802.560] -- 0:00:51 Average standard deviation of split frequencies: 0.016444 200500 -- (-1802.160) (-1802.739) (-1803.649) [-1802.777] * (-1802.950) (-1802.617) [-1805.011] (-1802.554) -- 0:00:55 201000 -- [-1802.427] (-1804.721) (-1804.871) (-1802.319) * (-1804.854) (-1802.406) (-1807.659) [-1802.483] -- 0:00:55 201500 -- (-1802.527) (-1807.753) (-1804.475) [-1802.959] * (-1803.675) [-1802.383] (-1808.362) (-1804.613) -- 0:00:55 202000 -- [-1802.527] (-1805.823) (-1803.435) (-1802.366) * [-1804.410] (-1801.616) (-1808.233) (-1803.113) -- 0:00:55 202500 -- (-1803.966) (-1804.653) (-1803.819) [-1803.044] * (-1805.175) [-1802.254] (-1805.063) (-1804.054) -- 0:00:55 203000 -- (-1803.600) (-1805.744) (-1804.452) [-1802.200] * [-1803.041] (-1802.591) (-1805.262) (-1803.258) -- 0:00:54 203500 -- (-1804.005) (-1803.857) [-1804.594] (-1802.081) * (-1802.889) [-1803.634] (-1802.088) (-1803.258) -- 0:00:54 204000 -- (-1803.068) (-1802.346) [-1803.857] (-1805.650) * (-1802.967) (-1804.341) (-1802.038) [-1802.566] -- 0:00:54 204500 -- [-1802.773] (-1801.731) (-1803.265) (-1805.222) * (-1802.987) (-1803.864) [-1803.389] (-1801.873) -- 0:00:54 205000 -- (-1802.936) (-1801.616) [-1803.912] (-1811.042) * (-1803.871) (-1803.344) [-1802.426] (-1801.902) -- 0:00:54 Average standard deviation of split frequencies: 0.016591 205500 -- [-1802.668] (-1803.284) (-1805.060) (-1808.009) * [-1806.162] (-1804.777) (-1804.956) (-1802.088) -- 0:00:54 206000 -- (-1802.406) [-1804.166] (-1806.354) (-1806.042) * [-1803.385] (-1802.801) (-1803.670) (-1803.804) -- 0:00:53 206500 -- (-1802.977) [-1804.275] (-1806.601) (-1808.110) * (-1806.123) (-1803.870) [-1802.789] (-1805.115) -- 0:00:53 207000 -- (-1804.882) [-1803.491] (-1805.696) (-1805.868) * (-1802.323) (-1803.183) (-1801.760) [-1801.547] -- 0:00:53 207500 -- (-1806.890) (-1803.721) [-1806.930] (-1805.930) * [-1803.019] (-1806.186) (-1801.952) (-1802.982) -- 0:00:53 208000 -- [-1803.454] (-1802.602) (-1803.671) (-1803.891) * (-1802.513) (-1802.819) [-1802.564] (-1804.390) -- 0:00:53 208500 -- [-1803.461] (-1802.415) (-1803.635) (-1803.648) * [-1804.174] (-1802.844) (-1804.159) (-1804.331) -- 0:00:53 209000 -- (-1803.932) [-1804.943] (-1804.046) (-1804.021) * [-1803.348] (-1804.072) (-1802.743) (-1802.592) -- 0:00:52 209500 -- (-1804.225) [-1807.391] (-1810.498) (-1804.432) * (-1803.720) (-1805.177) [-1802.367] (-1802.585) -- 0:00:52 210000 -- (-1803.605) (-1803.268) [-1804.773] (-1807.677) * [-1804.041] (-1802.953) (-1803.011) (-1804.977) -- 0:00:52 Average standard deviation of split frequencies: 0.017566 210500 -- (-1804.607) (-1803.318) (-1807.010) [-1803.832] * (-1803.495) (-1802.103) [-1802.570] (-1803.802) -- 0:00:52 211000 -- [-1805.150] (-1802.189) (-1803.629) (-1803.953) * (-1804.351) (-1803.837) [-1803.617] (-1803.273) -- 0:00:52 211500 -- (-1804.859) (-1805.460) [-1802.180] (-1803.548) * [-1804.282] (-1802.406) (-1804.693) (-1803.325) -- 0:00:52 212000 -- (-1805.617) (-1805.470) (-1803.394) [-1803.431] * (-1802.890) [-1802.406] (-1802.051) (-1805.981) -- 0:00:52 212500 -- [-1803.528] (-1808.440) (-1803.151) (-1803.023) * [-1811.190] (-1802.405) (-1802.260) (-1804.459) -- 0:00:51 213000 -- (-1803.805) (-1806.031) (-1803.533) [-1802.436] * (-1804.628) [-1807.773] (-1803.361) (-1804.309) -- 0:00:51 213500 -- (-1803.004) (-1805.237) (-1804.721) [-1802.708] * (-1806.093) [-1806.801] (-1804.861) (-1802.947) -- 0:00:51 214000 -- (-1803.436) (-1805.737) (-1803.158) [-1802.708] * [-1803.198] (-1804.471) (-1804.440) (-1803.372) -- 0:00:51 214500 -- [-1802.346] (-1804.324) (-1804.724) (-1804.393) * [-1805.644] (-1811.541) (-1804.408) (-1803.100) -- 0:00:51 215000 -- (-1802.260) [-1802.250] (-1808.327) (-1803.453) * (-1802.565) (-1811.283) (-1805.263) [-1802.445] -- 0:00:51 Average standard deviation of split frequencies: 0.016805 215500 -- (-1802.267) [-1802.735] (-1808.805) (-1802.961) * [-1802.504] (-1801.575) (-1808.091) (-1802.418) -- 0:00:50 216000 -- (-1802.101) [-1803.934] (-1803.050) (-1805.959) * (-1803.821) [-1804.509] (-1807.800) (-1802.378) -- 0:00:54 216500 -- [-1803.051] (-1807.140) (-1809.534) (-1804.845) * [-1803.390] (-1804.272) (-1804.535) (-1802.274) -- 0:00:54 217000 -- [-1808.869] (-1804.932) (-1808.306) (-1805.189) * (-1802.463) [-1804.195] (-1804.942) (-1802.082) -- 0:00:54 217500 -- [-1803.227] (-1810.236) (-1803.849) (-1804.989) * (-1806.487) [-1802.722] (-1802.539) (-1805.176) -- 0:00:53 218000 -- (-1806.537) (-1805.356) [-1805.601] (-1805.611) * (-1802.661) (-1801.702) [-1802.347] (-1805.743) -- 0:00:53 218500 -- [-1804.614] (-1803.144) (-1803.922) (-1805.999) * [-1804.091] (-1801.655) (-1803.034) (-1806.774) -- 0:00:53 219000 -- (-1803.080) [-1802.344] (-1802.798) (-1804.766) * [-1805.274] (-1801.563) (-1804.620) (-1806.550) -- 0:00:53 219500 -- (-1804.075) (-1806.935) (-1803.275) [-1804.062] * (-1803.710) (-1801.539) [-1805.415] (-1808.235) -- 0:00:53 220000 -- (-1805.654) [-1804.860] (-1808.457) (-1803.126) * (-1805.405) (-1802.395) [-1805.837] (-1805.014) -- 0:00:53 Average standard deviation of split frequencies: 0.016449 220500 -- [-1806.194] (-1805.510) (-1808.382) (-1803.146) * (-1805.961) [-1804.399] (-1805.596) (-1804.060) -- 0:00:53 221000 -- (-1807.867) [-1802.890] (-1802.901) (-1803.469) * [-1805.588] (-1804.994) (-1810.509) (-1802.435) -- 0:00:52 221500 -- (-1804.889) [-1803.406] (-1805.338) (-1805.389) * [-1805.662] (-1804.971) (-1807.107) (-1804.698) -- 0:00:52 222000 -- (-1805.833) [-1803.200] (-1807.241) (-1804.127) * [-1803.528] (-1804.142) (-1805.461) (-1806.265) -- 0:00:52 222500 -- [-1805.442] (-1803.479) (-1804.075) (-1805.152) * (-1806.797) (-1806.391) (-1805.659) [-1806.380] -- 0:00:52 223000 -- (-1802.115) [-1805.929] (-1803.795) (-1805.528) * (-1806.481) [-1805.736] (-1805.070) (-1805.558) -- 0:00:52 223500 -- (-1803.167) (-1806.738) (-1803.382) [-1804.734] * (-1805.607) (-1804.049) [-1803.164] (-1802.529) -- 0:00:52 224000 -- [-1805.203] (-1806.136) (-1802.307) (-1804.269) * (-1803.028) (-1804.274) [-1804.350] (-1803.265) -- 0:00:51 224500 -- (-1802.561) [-1803.933] (-1802.776) (-1803.370) * (-1806.465) [-1802.915] (-1807.105) (-1804.753) -- 0:00:51 225000 -- [-1803.803] (-1807.478) (-1802.428) (-1803.073) * (-1807.330) (-1802.480) [-1803.704] (-1805.661) -- 0:00:51 Average standard deviation of split frequencies: 0.015957 225500 -- (-1803.407) [-1803.950] (-1802.854) (-1807.264) * (-1807.746) [-1802.605] (-1805.697) (-1804.733) -- 0:00:51 226000 -- [-1802.597] (-1803.177) (-1803.865) (-1806.577) * [-1804.798] (-1806.324) (-1805.307) (-1803.904) -- 0:00:51 226500 -- [-1802.251] (-1805.278) (-1805.013) (-1804.074) * (-1804.461) (-1803.197) [-1805.502] (-1806.766) -- 0:00:51 227000 -- (-1802.827) (-1808.030) (-1803.224) [-1802.308] * (-1810.278) (-1802.640) (-1803.766) [-1806.742] -- 0:00:51 227500 -- (-1802.829) (-1802.805) [-1802.081] (-1813.917) * [-1804.869] (-1804.894) (-1804.061) (-1805.797) -- 0:00:50 228000 -- (-1806.556) [-1803.645] (-1802.675) (-1806.820) * (-1805.122) (-1804.745) (-1803.987) [-1804.938] -- 0:00:50 228500 -- (-1805.041) (-1804.971) [-1802.674] (-1806.366) * (-1802.049) (-1803.710) (-1806.708) [-1802.261] -- 0:00:50 229000 -- (-1804.728) [-1803.714] (-1802.686) (-1806.368) * (-1802.931) [-1804.495] (-1804.089) (-1803.059) -- 0:00:50 229500 -- (-1804.033) [-1802.742] (-1802.408) (-1804.156) * (-1802.840) [-1803.218] (-1802.763) (-1803.271) -- 0:00:50 230000 -- (-1803.731) (-1804.219) [-1803.167] (-1803.637) * [-1803.520] (-1803.167) (-1802.154) (-1803.857) -- 0:00:50 Average standard deviation of split frequencies: 0.016463 230500 -- (-1803.390) (-1801.929) [-1803.865] (-1803.657) * [-1803.845] (-1803.153) (-1803.193) (-1802.777) -- 0:00:50 231000 -- (-1802.734) (-1803.012) (-1804.306) [-1802.957] * (-1802.988) (-1802.666) (-1803.896) [-1805.477] -- 0:00:49 231500 -- [-1802.764] (-1802.393) (-1802.840) (-1803.134) * (-1803.069) (-1801.827) (-1804.859) [-1803.598] -- 0:00:53 232000 -- (-1802.140) (-1804.296) (-1801.807) [-1803.347] * [-1803.345] (-1803.055) (-1805.056) (-1804.101) -- 0:00:52 232500 -- (-1804.494) [-1802.677] (-1803.758) (-1804.158) * (-1804.258) (-1802.034) [-1803.478] (-1810.079) -- 0:00:52 233000 -- (-1802.619) (-1804.267) (-1804.925) [-1804.041] * [-1803.713] (-1802.792) (-1803.332) (-1804.035) -- 0:00:52 233500 -- (-1802.146) (-1803.113) [-1804.631] (-1806.017) * (-1804.231) (-1802.792) [-1805.775] (-1804.608) -- 0:00:52 234000 -- [-1802.867] (-1803.976) (-1811.145) (-1803.472) * [-1804.262] (-1802.371) (-1806.141) (-1805.320) -- 0:00:52 234500 -- (-1802.142) [-1804.539] (-1807.689) (-1803.450) * (-1802.490) [-1812.617] (-1803.347) (-1805.166) -- 0:00:52 235000 -- [-1802.781] (-1803.574) (-1805.573) (-1802.460) * [-1804.166] (-1808.051) (-1804.139) (-1805.357) -- 0:00:52 Average standard deviation of split frequencies: 0.015040 235500 -- [-1801.821] (-1804.745) (-1804.960) (-1802.351) * (-1802.579) [-1802.054] (-1802.491) (-1809.619) -- 0:00:51 236000 -- (-1802.240) (-1804.441) [-1803.950] (-1802.290) * (-1803.008) (-1801.800) [-1802.537] (-1808.819) -- 0:00:51 236500 -- (-1802.829) (-1803.793) [-1806.619] (-1802.816) * (-1802.556) (-1802.404) [-1802.707] (-1806.163) -- 0:00:51 237000 -- (-1802.269) (-1806.449) [-1802.186] (-1805.850) * (-1802.873) [-1802.529] (-1801.829) (-1806.107) -- 0:00:51 237500 -- [-1802.492] (-1802.501) (-1802.231) (-1803.378) * (-1802.794) [-1803.242] (-1804.949) (-1802.128) -- 0:00:51 238000 -- (-1803.165) (-1802.469) (-1802.714) [-1803.365] * [-1802.874] (-1803.266) (-1803.137) (-1802.235) -- 0:00:51 238500 -- (-1806.597) (-1803.838) (-1802.715) [-1803.634] * (-1803.186) (-1810.006) (-1802.531) [-1802.750] -- 0:00:51 239000 -- (-1806.213) (-1802.062) (-1804.213) [-1802.198] * [-1803.699] (-1806.952) (-1803.877) (-1802.474) -- 0:00:50 239500 -- (-1806.976) (-1802.182) (-1802.302) [-1802.401] * (-1802.568) [-1806.832] (-1803.937) (-1804.151) -- 0:00:50 240000 -- [-1804.271] (-1803.381) (-1801.872) (-1804.093) * (-1803.124) (-1810.669) [-1804.057] (-1810.053) -- 0:00:50 Average standard deviation of split frequencies: 0.014255 240500 -- (-1804.344) (-1802.867) (-1805.722) [-1805.928] * (-1802.864) [-1803.746] (-1802.948) (-1802.348) -- 0:00:50 241000 -- (-1804.378) [-1802.797] (-1805.773) (-1803.990) * [-1802.806] (-1804.261) (-1804.752) (-1803.917) -- 0:00:50 241500 -- (-1802.422) (-1804.349) [-1803.108] (-1802.848) * (-1802.229) [-1802.770] (-1806.931) (-1803.678) -- 0:00:50 242000 -- (-1803.900) (-1802.626) (-1802.424) [-1802.848] * [-1802.065] (-1803.253) (-1805.526) (-1803.262) -- 0:00:50 242500 -- (-1805.337) (-1802.704) [-1803.462] (-1803.413) * (-1804.383) (-1801.840) (-1802.776) [-1803.572] -- 0:00:49 243000 -- (-1806.137) (-1803.151) [-1803.282] (-1804.135) * [-1802.575] (-1802.704) (-1808.088) (-1802.045) -- 0:00:49 243500 -- (-1804.267) (-1804.429) [-1803.114] (-1804.052) * (-1802.063) [-1801.796] (-1803.649) (-1804.424) -- 0:00:49 244000 -- (-1803.537) [-1804.566] (-1803.624) (-1802.940) * (-1802.009) (-1803.725) [-1801.573] (-1807.061) -- 0:00:49 244500 -- (-1804.363) (-1802.341) [-1804.451] (-1802.835) * (-1803.323) (-1806.362) [-1802.170] (-1809.505) -- 0:00:49 245000 -- (-1802.701) [-1802.346] (-1805.236) (-1807.640) * [-1803.391] (-1805.856) (-1803.108) (-1805.999) -- 0:00:49 Average standard deviation of split frequencies: 0.013717 245500 -- (-1804.553) [-1804.342] (-1804.393) (-1807.923) * (-1802.618) [-1810.070] (-1804.500) (-1805.436) -- 0:00:49 246000 -- [-1804.972] (-1802.780) (-1803.982) (-1804.621) * (-1804.653) (-1804.414) (-1802.078) [-1807.524] -- 0:00:49 246500 -- [-1803.498] (-1804.191) (-1805.152) (-1803.906) * [-1805.333] (-1805.131) (-1803.738) (-1806.221) -- 0:00:48 247000 -- (-1804.105) (-1806.011) [-1807.813] (-1804.861) * (-1806.196) (-1803.742) [-1804.902] (-1803.531) -- 0:00:51 247500 -- [-1803.879] (-1802.001) (-1806.026) (-1805.658) * (-1807.405) [-1802.635] (-1802.478) (-1803.882) -- 0:00:51 248000 -- [-1803.872] (-1802.788) (-1804.771) (-1806.374) * (-1807.704) (-1802.456) (-1803.883) [-1802.910] -- 0:00:51 248500 -- [-1805.426] (-1802.293) (-1803.980) (-1804.921) * (-1805.231) [-1804.422] (-1803.867) (-1802.437) -- 0:00:51 249000 -- (-1805.426) [-1805.079] (-1807.093) (-1806.312) * (-1804.183) [-1802.992] (-1805.567) (-1802.089) -- 0:00:51 249500 -- [-1803.223] (-1806.604) (-1804.129) (-1804.756) * (-1803.330) (-1806.891) (-1806.236) [-1803.049] -- 0:00:51 250000 -- (-1803.525) (-1805.791) [-1807.604] (-1804.840) * (-1806.224) (-1807.278) (-1802.874) [-1802.100] -- 0:00:51 Average standard deviation of split frequencies: 0.014381 250500 -- (-1803.691) [-1804.602] (-1804.343) (-1805.833) * [-1804.966] (-1804.340) (-1801.684) (-1803.229) -- 0:00:50 251000 -- (-1803.184) (-1808.757) (-1805.616) [-1804.079] * (-1805.283) (-1803.449) [-1801.933] (-1803.970) -- 0:00:50 251500 -- (-1806.163) [-1805.019] (-1801.943) (-1804.442) * (-1805.026) (-1804.746) [-1804.340] (-1807.106) -- 0:00:50 252000 -- (-1805.912) (-1806.515) (-1801.943) [-1805.608] * (-1805.604) (-1805.557) (-1805.644) [-1804.000] -- 0:00:50 252500 -- [-1804.982] (-1807.105) (-1804.079) (-1805.999) * (-1805.685) [-1807.674] (-1803.935) (-1804.612) -- 0:00:50 253000 -- (-1808.424) (-1804.298) (-1801.584) [-1803.478] * (-1805.372) [-1805.723] (-1803.345) (-1804.587) -- 0:00:50 253500 -- [-1802.330] (-1804.444) (-1803.467) (-1803.506) * [-1808.645] (-1804.097) (-1802.344) (-1804.190) -- 0:00:50 254000 -- [-1803.518] (-1803.303) (-1803.013) (-1802.556) * (-1804.231) (-1803.555) (-1804.017) [-1806.135] -- 0:00:49 254500 -- [-1804.440] (-1802.245) (-1802.942) (-1808.065) * (-1805.445) (-1803.838) (-1803.980) [-1803.575] -- 0:00:49 255000 -- [-1802.152] (-1804.246) (-1802.618) (-1804.903) * (-1802.992) [-1803.510] (-1807.018) (-1803.717) -- 0:00:49 Average standard deviation of split frequencies: 0.012998 255500 -- (-1805.541) (-1802.063) [-1805.137] (-1804.634) * (-1802.042) [-1803.664] (-1803.304) (-1804.620) -- 0:00:49 256000 -- (-1805.365) (-1801.848) [-1803.003] (-1804.808) * [-1803.267] (-1803.267) (-1804.283) (-1804.360) -- 0:00:49 256500 -- (-1807.251) (-1801.613) (-1803.795) [-1802.848] * (-1804.017) (-1803.426) (-1803.181) [-1807.984] -- 0:00:49 257000 -- (-1805.856) [-1803.627] (-1804.753) (-1804.948) * (-1802.850) (-1805.138) [-1801.973] (-1805.130) -- 0:00:49 257500 -- [-1802.845] (-1806.940) (-1802.922) (-1802.044) * (-1803.694) [-1806.928] (-1802.061) (-1806.142) -- 0:00:49 258000 -- [-1803.714] (-1803.731) (-1806.338) (-1802.137) * [-1804.813] (-1804.880) (-1805.095) (-1804.166) -- 0:00:48 258500 -- (-1806.392) (-1803.135) (-1807.442) [-1804.169] * (-1803.974) [-1802.838] (-1805.827) (-1804.979) -- 0:00:48 259000 -- [-1802.660] (-1807.099) (-1806.164) (-1809.073) * (-1805.700) (-1802.924) [-1806.853] (-1809.114) -- 0:00:48 259500 -- [-1803.367] (-1802.745) (-1803.084) (-1808.076) * (-1806.432) (-1806.162) (-1804.844) [-1806.415] -- 0:00:48 260000 -- (-1804.177) (-1802.716) (-1803.576) [-1804.832] * [-1806.474] (-1805.387) (-1805.753) (-1804.139) -- 0:00:48 Average standard deviation of split frequencies: 0.013191 260500 -- (-1804.454) (-1802.933) [-1802.417] (-1810.288) * (-1805.986) [-1804.757] (-1806.727) (-1802.496) -- 0:00:48 261000 -- [-1806.134] (-1802.644) (-1804.451) (-1808.487) * (-1803.873) (-1803.793) [-1807.223] (-1802.251) -- 0:00:48 261500 -- [-1803.760] (-1803.519) (-1803.788) (-1802.464) * [-1803.130] (-1804.456) (-1807.399) (-1804.932) -- 0:00:48 262000 -- [-1804.342] (-1804.699) (-1802.631) (-1804.363) * (-1803.495) (-1805.283) (-1805.117) [-1805.232] -- 0:00:47 262500 -- [-1804.002] (-1807.550) (-1805.143) (-1804.381) * (-1802.493) (-1808.765) [-1805.188] (-1808.038) -- 0:00:50 263000 -- [-1803.101] (-1804.654) (-1803.691) (-1806.197) * [-1802.678] (-1806.342) (-1805.041) (-1802.502) -- 0:00:50 263500 -- (-1803.399) (-1806.588) (-1803.581) [-1804.586] * (-1802.274) (-1803.903) (-1804.725) [-1802.804] -- 0:00:50 264000 -- (-1803.171) [-1805.049] (-1802.467) (-1805.764) * (-1803.312) (-1803.902) [-1802.846] (-1802.642) -- 0:00:50 264500 -- [-1802.536] (-1804.400) (-1802.676) (-1804.214) * (-1803.197) [-1804.347] (-1802.259) (-1802.642) -- 0:00:50 265000 -- (-1804.101) (-1804.223) (-1803.446) [-1803.644] * (-1803.893) [-1805.368] (-1802.961) (-1806.799) -- 0:00:49 Average standard deviation of split frequencies: 0.013656 265500 -- [-1802.386] (-1808.704) (-1803.024) (-1802.572) * (-1803.201) [-1803.933] (-1802.161) (-1806.062) -- 0:00:49 266000 -- (-1803.796) (-1808.597) (-1802.675) [-1802.002] * [-1805.328] (-1804.141) (-1802.489) (-1806.701) -- 0:00:49 266500 -- (-1806.978) (-1805.236) [-1804.993] (-1803.936) * (-1804.266) [-1802.859] (-1803.136) (-1803.801) -- 0:00:49 267000 -- (-1802.854) (-1805.245) (-1808.273) [-1809.237] * (-1802.589) (-1802.654) [-1804.011] (-1806.790) -- 0:00:49 267500 -- [-1802.593] (-1802.365) (-1807.133) (-1803.394) * (-1802.279) (-1802.694) (-1802.960) [-1804.029] -- 0:00:49 268000 -- [-1802.055] (-1802.735) (-1806.869) (-1802.891) * (-1802.684) (-1803.659) (-1803.659) [-1802.415] -- 0:00:49 268500 -- (-1802.476) (-1803.271) [-1807.467] (-1803.384) * (-1803.086) [-1804.969] (-1803.829) (-1801.719) -- 0:00:49 269000 -- [-1802.439] (-1804.911) (-1807.496) (-1805.722) * (-1805.477) (-1804.407) [-1806.179] (-1803.884) -- 0:00:48 269500 -- (-1804.352) (-1802.386) [-1804.317] (-1805.651) * (-1808.197) (-1806.325) (-1803.672) [-1802.897] -- 0:00:48 270000 -- (-1802.872) (-1802.386) [-1803.251] (-1804.985) * [-1807.949] (-1804.887) (-1802.705) (-1807.293) -- 0:00:48 Average standard deviation of split frequencies: 0.013011 270500 -- (-1803.952) [-1804.871] (-1802.171) (-1803.363) * (-1802.663) (-1804.816) [-1802.759] (-1803.561) -- 0:00:48 271000 -- (-1802.978) [-1804.281] (-1802.235) (-1803.466) * (-1804.041) (-1808.102) [-1802.947] (-1803.545) -- 0:00:48 271500 -- [-1802.689] (-1802.917) (-1803.586) (-1805.733) * [-1803.335] (-1808.870) (-1803.099) (-1802.953) -- 0:00:48 272000 -- [-1807.019] (-1802.473) (-1803.572) (-1802.395) * [-1804.616] (-1805.135) (-1805.789) (-1803.904) -- 0:00:48 272500 -- (-1806.114) [-1802.971] (-1805.034) (-1803.753) * [-1804.791] (-1802.935) (-1803.624) (-1805.874) -- 0:00:48 273000 -- (-1804.065) (-1803.654) (-1802.250) [-1803.219] * [-1804.281] (-1802.953) (-1802.481) (-1803.748) -- 0:00:47 273500 -- [-1803.940] (-1802.659) (-1803.768) (-1809.563) * (-1802.112) (-1807.174) (-1804.188) [-1807.749] -- 0:00:47 274000 -- [-1805.334] (-1804.403) (-1804.105) (-1808.292) * [-1802.954] (-1806.855) (-1804.812) (-1808.380) -- 0:00:47 274500 -- (-1805.209) (-1803.820) [-1807.890] (-1807.271) * (-1801.891) [-1803.623] (-1806.105) (-1804.581) -- 0:00:47 275000 -- (-1804.888) (-1804.721) (-1806.552) [-1805.137] * (-1802.815) (-1803.910) [-1803.849] (-1803.711) -- 0:00:47 Average standard deviation of split frequencies: 0.013463 275500 -- [-1804.322] (-1803.458) (-1801.878) (-1808.948) * (-1802.519) [-1803.820] (-1803.763) (-1809.697) -- 0:00:47 276000 -- (-1804.283) (-1806.306) [-1802.153] (-1806.328) * (-1803.338) (-1804.653) [-1802.383] (-1809.124) -- 0:00:47 276500 -- (-1805.585) (-1802.106) [-1802.096] (-1805.831) * (-1803.382) (-1803.121) (-1802.544) [-1805.165] -- 0:00:47 277000 -- [-1805.366] (-1805.289) (-1804.004) (-1803.482) * (-1803.455) (-1803.953) (-1805.007) [-1805.670] -- 0:00:46 277500 -- [-1802.587] (-1807.103) (-1802.504) (-1803.592) * (-1802.825) (-1803.232) (-1809.545) [-1802.796] -- 0:00:49 278000 -- [-1804.136] (-1806.609) (-1802.885) (-1805.129) * (-1804.312) [-1805.196] (-1812.498) (-1803.342) -- 0:00:49 278500 -- (-1804.312) [-1802.825] (-1803.342) (-1810.404) * (-1802.454) (-1804.146) [-1808.544] (-1805.534) -- 0:00:49 279000 -- [-1802.199] (-1802.912) (-1806.492) (-1805.130) * [-1803.343] (-1802.821) (-1804.353) (-1806.812) -- 0:00:49 279500 -- (-1802.072) (-1806.482) [-1803.236] (-1805.562) * (-1804.304) (-1803.966) [-1804.900] (-1806.566) -- 0:00:48 280000 -- (-1803.205) (-1808.332) (-1804.250) [-1803.844] * (-1805.095) (-1803.881) (-1803.634) [-1806.442] -- 0:00:48 Average standard deviation of split frequencies: 0.013239 280500 -- [-1803.304] (-1815.832) (-1803.248) (-1804.319) * (-1805.353) (-1802.368) (-1805.333) [-1802.621] -- 0:00:48 281000 -- [-1802.515] (-1809.335) (-1803.072) (-1804.518) * (-1805.816) [-1803.037] (-1804.411) (-1803.184) -- 0:00:48 281500 -- (-1804.562) (-1806.380) [-1801.961] (-1806.312) * (-1803.093) (-1802.589) (-1804.487) [-1803.231] -- 0:00:48 282000 -- (-1804.129) (-1803.754) [-1802.670] (-1802.665) * (-1805.063) [-1802.813] (-1803.031) (-1802.875) -- 0:00:48 282500 -- (-1804.412) (-1803.440) [-1802.884] (-1802.277) * (-1803.772) [-1805.115] (-1801.696) (-1804.097) -- 0:00:48 283000 -- (-1804.585) (-1804.517) [-1801.479] (-1806.322) * (-1802.956) (-1802.286) [-1802.334] (-1804.905) -- 0:00:48 283500 -- (-1802.241) (-1801.547) [-1802.790] (-1803.182) * (-1803.303) (-1803.827) [-1802.059] (-1804.417) -- 0:00:48 284000 -- (-1802.261) (-1803.929) (-1802.599) [-1802.011] * (-1804.709) (-1803.344) (-1803.411) [-1803.078] -- 0:00:47 284500 -- (-1802.405) (-1804.753) (-1801.917) [-1802.517] * (-1805.125) (-1804.651) [-1801.780] (-1802.990) -- 0:00:47 285000 -- (-1803.216) [-1805.239] (-1802.655) (-1802.179) * (-1805.512) (-1805.632) (-1804.543) [-1803.302] -- 0:00:47 Average standard deviation of split frequencies: 0.013003 285500 -- (-1803.663) (-1802.790) (-1806.261) [-1802.186] * (-1805.903) [-1806.404] (-1802.264) (-1803.802) -- 0:00:47 286000 -- (-1802.449) [-1802.638] (-1803.802) (-1804.501) * (-1809.827) [-1801.659] (-1806.250) (-1805.067) -- 0:00:47 286500 -- (-1802.507) (-1802.898) [-1803.656] (-1805.135) * [-1802.722] (-1801.708) (-1809.532) (-1805.208) -- 0:00:47 287000 -- [-1802.448] (-1802.899) (-1806.791) (-1802.247) * [-1803.428] (-1801.876) (-1805.750) (-1805.619) -- 0:00:47 287500 -- (-1802.245) (-1803.406) [-1805.120] (-1802.063) * (-1803.654) (-1802.957) [-1802.025] (-1801.803) -- 0:00:47 288000 -- (-1802.295) (-1803.403) [-1806.103] (-1802.043) * (-1805.609) [-1804.739] (-1801.891) (-1802.963) -- 0:00:46 288500 -- [-1801.999] (-1810.650) (-1803.595) (-1803.737) * (-1804.713) (-1804.423) [-1802.952] (-1801.583) -- 0:00:46 289000 -- [-1804.479] (-1806.287) (-1806.325) (-1802.436) * (-1804.642) (-1804.469) (-1803.967) [-1801.589] -- 0:00:46 289500 -- [-1808.481] (-1806.515) (-1806.783) (-1802.414) * (-1803.596) (-1806.623) (-1802.114) [-1803.087] -- 0:00:46 290000 -- (-1806.321) [-1803.068] (-1805.837) (-1804.565) * (-1804.320) (-1802.154) (-1804.833) [-1802.597] -- 0:00:46 Average standard deviation of split frequencies: 0.012688 290500 -- [-1804.670] (-1804.169) (-1803.858) (-1802.465) * [-1806.035] (-1804.934) (-1805.820) (-1805.358) -- 0:00:46 291000 -- (-1803.512) (-1803.634) [-1802.317] (-1801.835) * [-1804.704] (-1804.571) (-1804.855) (-1804.366) -- 0:00:46 291500 -- (-1806.692) [-1803.293] (-1802.658) (-1802.662) * (-1803.809) [-1805.022] (-1803.436) (-1805.773) -- 0:00:46 292000 -- (-1803.266) [-1803.299] (-1804.908) (-1804.113) * [-1802.807] (-1803.383) (-1801.722) (-1805.660) -- 0:00:46 292500 -- (-1804.867) [-1802.669] (-1804.447) (-1802.914) * (-1803.627) (-1807.248) [-1804.103] (-1803.841) -- 0:00:48 293000 -- (-1803.241) (-1806.189) [-1806.173] (-1803.920) * (-1805.249) (-1805.099) (-1802.866) [-1802.224] -- 0:00:48 293500 -- (-1802.808) (-1802.911) [-1804.002] (-1808.305) * (-1805.506) [-1806.070] (-1810.863) (-1802.230) -- 0:00:48 294000 -- (-1802.696) [-1802.840] (-1803.718) (-1805.017) * (-1809.527) (-1805.672) [-1807.973] (-1802.798) -- 0:00:48 294500 -- (-1804.224) (-1803.209) [-1804.769] (-1806.651) * [-1806.979] (-1810.310) (-1807.063) (-1803.933) -- 0:00:47 295000 -- (-1804.220) (-1806.765) (-1802.412) [-1803.803] * (-1804.616) [-1803.920] (-1805.600) (-1805.768) -- 0:00:47 Average standard deviation of split frequencies: 0.012033 295500 -- (-1803.016) [-1802.939] (-1804.388) (-1806.113) * (-1803.552) (-1803.591) (-1805.805) [-1803.279] -- 0:00:47 296000 -- (-1802.284) (-1803.009) (-1803.243) [-1805.220] * (-1802.638) (-1803.559) [-1805.565] (-1804.662) -- 0:00:47 296500 -- (-1805.783) (-1802.126) (-1803.777) [-1803.728] * (-1802.268) (-1805.108) (-1802.720) [-1803.849] -- 0:00:47 297000 -- (-1805.888) (-1806.392) (-1804.319) [-1802.817] * (-1805.368) (-1804.062) [-1802.583] (-1808.366) -- 0:00:47 297500 -- (-1806.974) [-1806.817] (-1803.049) (-1805.761) * [-1806.437] (-1802.798) (-1804.711) (-1802.761) -- 0:00:47 298000 -- (-1805.782) (-1806.733) (-1803.933) [-1804.126] * (-1803.462) (-1802.790) (-1803.990) [-1802.222] -- 0:00:47 298500 -- (-1805.729) (-1803.024) (-1804.012) [-1803.729] * [-1803.334] (-1805.638) (-1803.007) (-1804.488) -- 0:00:47 299000 -- (-1805.540) [-1804.148] (-1802.348) (-1802.432) * (-1803.937) (-1802.943) [-1803.724] (-1803.340) -- 0:00:46 299500 -- (-1804.774) (-1803.658) [-1802.332] (-1808.193) * (-1806.897) (-1802.936) (-1804.525) [-1803.987] -- 0:00:46 300000 -- (-1803.409) (-1803.288) (-1805.583) [-1806.747] * (-1804.633) (-1803.987) [-1802.829] (-1803.657) -- 0:00:46 Average standard deviation of split frequencies: 0.011672 300500 -- (-1802.940) (-1804.262) [-1804.692] (-1805.300) * (-1802.330) (-1802.619) (-1804.437) [-1802.981] -- 0:00:46 301000 -- [-1803.412] (-1802.243) (-1802.385) (-1803.234) * (-1803.198) [-1802.619] (-1804.526) (-1805.731) -- 0:00:46 301500 -- [-1803.351] (-1802.408) (-1801.754) (-1803.600) * (-1808.545) (-1802.582) (-1806.474) [-1807.282] -- 0:00:46 302000 -- (-1803.249) (-1801.814) (-1802.669) [-1803.934] * (-1805.697) [-1803.167] (-1803.826) (-1808.480) -- 0:00:46 302500 -- (-1804.886) (-1803.085) [-1801.952] (-1804.626) * [-1804.968] (-1802.944) (-1803.841) (-1801.714) -- 0:00:46 303000 -- (-1804.492) (-1802.118) [-1802.280] (-1803.704) * [-1803.495] (-1803.069) (-1803.635) (-1802.224) -- 0:00:46 303500 -- (-1805.275) (-1802.079) (-1804.083) [-1803.259] * (-1807.480) (-1803.782) (-1805.188) [-1804.110] -- 0:00:45 304000 -- [-1804.727] (-1802.778) (-1803.291) (-1803.438) * (-1806.447) [-1804.539] (-1804.357) (-1804.974) -- 0:00:45 304500 -- [-1804.398] (-1802.825) (-1802.440) (-1803.759) * (-1805.566) (-1804.470) [-1802.923] (-1806.711) -- 0:00:45 305000 -- (-1802.785) [-1803.600] (-1802.505) (-1804.360) * (-1805.290) (-1805.481) (-1802.737) [-1804.867] -- 0:00:45 Average standard deviation of split frequencies: 0.011432 305500 -- (-1804.670) (-1802.718) (-1803.350) [-1805.292] * (-1807.196) [-1802.190] (-1803.771) (-1802.380) -- 0:00:45 306000 -- (-1805.061) (-1803.027) [-1806.899] (-1803.372) * (-1804.126) (-1804.911) [-1804.754] (-1802.421) -- 0:00:45 306500 -- (-1802.645) (-1805.307) [-1802.806] (-1806.126) * (-1803.305) (-1804.433) [-1802.964] (-1808.051) -- 0:00:45 307000 -- [-1802.704] (-1806.597) (-1804.163) (-1802.438) * (-1803.795) (-1803.018) [-1803.004] (-1807.494) -- 0:00:45 307500 -- (-1807.254) (-1805.368) (-1806.412) [-1804.910] * (-1803.646) (-1806.380) [-1805.127] (-1806.245) -- 0:00:45 308000 -- (-1802.475) (-1803.189) [-1802.860] (-1802.696) * [-1809.422] (-1802.122) (-1803.848) (-1802.638) -- 0:00:47 308500 -- (-1802.107) (-1802.534) (-1812.252) [-1802.862] * (-1811.938) (-1805.602) [-1805.888] (-1801.961) -- 0:00:47 309000 -- [-1802.056] (-1803.848) (-1802.595) (-1804.800) * (-1809.919) [-1808.181] (-1802.899) (-1803.715) -- 0:00:46 309500 -- (-1806.350) (-1806.252) [-1803.224] (-1804.815) * [-1802.277] (-1805.745) (-1803.535) (-1801.800) -- 0:00:46 310000 -- (-1803.662) (-1802.355) (-1804.833) [-1803.275] * (-1805.151) (-1805.587) (-1802.183) [-1803.278] -- 0:00:46 Average standard deviation of split frequencies: 0.011886 310500 -- (-1805.166) [-1805.748] (-1804.311) (-1802.538) * (-1807.784) [-1803.129] (-1802.670) (-1802.791) -- 0:00:46 311000 -- (-1805.061) (-1805.675) (-1804.845) [-1802.849] * [-1804.253] (-1802.617) (-1803.807) (-1804.861) -- 0:00:46 311500 -- (-1810.976) (-1802.571) [-1803.338] (-1802.506) * (-1803.021) (-1804.050) (-1804.686) [-1802.597] -- 0:00:46 312000 -- [-1806.185] (-1802.356) (-1804.755) (-1802.063) * (-1803.611) (-1803.483) (-1802.901) [-1802.506] -- 0:00:46 312500 -- (-1808.284) [-1802.187] (-1806.770) (-1802.976) * [-1806.821] (-1806.548) (-1802.901) (-1804.832) -- 0:00:46 313000 -- (-1803.832) (-1807.291) (-1803.674) [-1803.884] * (-1806.068) [-1805.130] (-1809.840) (-1804.524) -- 0:00:46 313500 -- (-1804.857) (-1809.750) (-1803.498) [-1805.570] * (-1804.283) [-1803.779] (-1804.852) (-1802.329) -- 0:00:45 314000 -- [-1804.930] (-1809.738) (-1803.750) (-1803.370) * (-1807.881) (-1803.250) (-1803.429) [-1802.329] -- 0:00:45 314500 -- (-1802.850) [-1802.109] (-1806.033) (-1806.113) * (-1804.799) (-1803.220) (-1804.210) [-1805.335] -- 0:00:45 315000 -- (-1803.261) [-1801.950] (-1806.646) (-1803.370) * (-1804.304) (-1805.884) [-1803.168] (-1802.890) -- 0:00:45 Average standard deviation of split frequencies: 0.011603 315500 -- [-1803.947] (-1801.910) (-1809.581) (-1803.521) * (-1804.773) (-1805.642) [-1806.165] (-1802.667) -- 0:00:45 316000 -- (-1806.189) (-1802.272) (-1807.000) [-1804.452] * (-1803.798) (-1804.270) (-1805.102) [-1804.390] -- 0:00:45 316500 -- (-1805.065) [-1802.773] (-1803.817) (-1804.636) * (-1804.726) [-1803.723] (-1801.740) (-1803.286) -- 0:00:45 317000 -- (-1805.384) (-1803.558) [-1804.122] (-1806.774) * [-1802.941] (-1803.901) (-1801.621) (-1805.820) -- 0:00:45 317500 -- (-1808.991) (-1804.787) [-1806.038] (-1804.495) * (-1802.805) [-1806.343] (-1801.845) (-1806.054) -- 0:00:45 318000 -- (-1809.651) [-1808.012] (-1804.981) (-1802.924) * [-1802.682] (-1807.104) (-1801.853) (-1804.807) -- 0:00:45 318500 -- (-1807.842) (-1815.390) (-1803.368) [-1805.451] * (-1802.934) (-1805.819) (-1802.531) [-1807.900] -- 0:00:44 319000 -- (-1802.988) (-1809.248) (-1806.573) [-1804.954] * (-1803.916) [-1805.797] (-1802.520) (-1806.031) -- 0:00:44 319500 -- [-1803.081] (-1809.039) (-1803.313) (-1807.685) * (-1804.172) (-1805.881) (-1802.789) [-1804.403] -- 0:00:44 320000 -- (-1802.168) (-1803.517) [-1804.099] (-1805.860) * [-1804.390] (-1805.753) (-1802.425) (-1805.392) -- 0:00:44 Average standard deviation of split frequencies: 0.011588 320500 -- (-1804.178) [-1803.007] (-1804.210) (-1804.823) * (-1803.201) (-1809.239) [-1805.228] (-1805.083) -- 0:00:44 321000 -- [-1803.554] (-1803.069) (-1804.463) (-1803.330) * [-1802.848] (-1806.324) (-1803.634) (-1804.721) -- 0:00:44 321500 -- (-1803.705) [-1802.695] (-1811.544) (-1806.565) * (-1802.390) [-1808.930] (-1804.035) (-1803.256) -- 0:00:44 322000 -- (-1802.305) [-1803.181] (-1805.948) (-1804.714) * [-1804.472] (-1802.156) (-1803.662) (-1802.776) -- 0:00:44 322500 -- [-1802.382] (-1810.893) (-1805.785) (-1803.807) * [-1803.516] (-1802.734) (-1802.462) (-1803.889) -- 0:00:44 323000 -- (-1802.276) (-1806.826) (-1803.143) [-1802.644] * (-1803.718) (-1802.550) (-1802.842) [-1802.886] -- 0:00:44 323500 -- [-1803.498] (-1804.728) (-1802.297) (-1805.873) * (-1806.981) [-1802.661] (-1802.653) (-1803.293) -- 0:00:46 324000 -- (-1802.345) (-1804.047) (-1802.356) [-1804.141] * (-1803.794) (-1802.593) (-1804.960) [-1801.693] -- 0:00:45 324500 -- [-1802.468] (-1802.760) (-1804.324) (-1805.303) * (-1802.383) [-1805.129] (-1805.326) (-1804.476) -- 0:00:45 325000 -- (-1802.603) [-1802.260] (-1804.179) (-1805.819) * (-1803.972) (-1804.234) [-1802.502] (-1806.765) -- 0:00:45 Average standard deviation of split frequencies: 0.011729 325500 -- (-1803.117) (-1802.345) [-1804.543] (-1802.979) * (-1807.215) (-1807.634) [-1803.930] (-1802.941) -- 0:00:45 326000 -- (-1802.612) (-1804.076) [-1804.489] (-1806.821) * [-1801.585] (-1805.699) (-1802.173) (-1803.212) -- 0:00:45 326500 -- (-1803.811) [-1806.726] (-1806.032) (-1805.019) * [-1804.101] (-1805.712) (-1802.090) (-1804.392) -- 0:00:45 327000 -- [-1803.546] (-1803.862) (-1803.936) (-1806.515) * [-1804.405] (-1802.578) (-1803.026) (-1804.439) -- 0:00:45 327500 -- (-1803.968) (-1805.459) (-1804.119) [-1802.547] * (-1802.652) [-1802.783] (-1803.270) (-1805.915) -- 0:00:45 328000 -- (-1805.900) [-1804.838] (-1804.255) (-1803.784) * (-1801.906) (-1803.630) (-1803.457) [-1804.256] -- 0:00:45 328500 -- (-1811.746) (-1806.749) (-1805.369) [-1803.033] * (-1801.906) [-1803.845] (-1802.389) (-1803.932) -- 0:00:44 329000 -- (-1805.488) (-1804.400) (-1803.366) [-1803.337] * (-1801.906) [-1805.268] (-1804.928) (-1805.131) -- 0:00:44 329500 -- (-1806.972) (-1805.953) (-1809.459) [-1801.897] * [-1801.906] (-1804.777) (-1804.075) (-1806.583) -- 0:00:44 330000 -- (-1805.435) (-1801.889) (-1806.419) [-1803.381] * (-1802.200) (-1805.125) [-1804.489] (-1803.792) -- 0:00:44 Average standard deviation of split frequencies: 0.010315 330500 -- (-1803.933) [-1802.289] (-1803.865) (-1803.302) * (-1802.143) (-1803.025) [-1803.024] (-1806.949) -- 0:00:44 331000 -- (-1802.869) (-1802.563) [-1805.469] (-1803.706) * (-1803.010) (-1802.803) [-1802.572] (-1804.648) -- 0:00:44 331500 -- (-1804.474) [-1804.430] (-1803.956) (-1804.352) * (-1802.362) (-1805.023) (-1804.521) [-1805.961] -- 0:00:44 332000 -- [-1802.053] (-1804.805) (-1808.307) (-1807.544) * (-1804.547) (-1805.019) (-1802.555) [-1804.191] -- 0:00:44 332500 -- (-1802.020) [-1803.136] (-1803.547) (-1805.772) * (-1803.994) (-1804.465) [-1803.319] (-1807.736) -- 0:00:44 333000 -- (-1802.263) [-1805.615] (-1804.261) (-1807.336) * (-1803.623) [-1803.980] (-1805.213) (-1801.975) -- 0:00:44 333500 -- (-1802.324) (-1804.101) [-1805.175] (-1808.527) * [-1804.093] (-1805.034) (-1804.385) (-1803.400) -- 0:00:43 334000 -- (-1801.999) (-1803.492) (-1805.403) [-1802.871] * (-1803.173) (-1806.095) (-1804.032) [-1804.336] -- 0:00:43 334500 -- (-1802.759) (-1805.932) (-1804.818) [-1802.346] * (-1803.248) [-1804.875] (-1804.806) (-1801.836) -- 0:00:43 335000 -- (-1803.225) [-1803.589] (-1806.717) (-1806.217) * (-1802.999) (-1805.034) [-1802.508] (-1805.379) -- 0:00:43 Average standard deviation of split frequencies: 0.011224 335500 -- (-1808.102) (-1802.177) (-1806.772) [-1805.608] * (-1805.591) (-1805.519) (-1804.068) [-1803.282] -- 0:00:43 336000 -- [-1805.961] (-1801.536) (-1802.688) (-1804.469) * [-1804.191] (-1808.592) (-1804.478) (-1804.101) -- 0:00:43 336500 -- (-1807.401) (-1803.521) [-1804.999] (-1807.425) * (-1802.891) (-1809.326) [-1806.869] (-1801.899) -- 0:00:43 337000 -- (-1812.580) (-1815.323) (-1804.683) [-1807.362] * (-1806.006) (-1804.366) (-1806.275) [-1802.837] -- 0:00:43 337500 -- (-1804.417) (-1802.921) (-1802.084) [-1803.964] * (-1803.165) (-1801.977) (-1806.575) [-1803.646] -- 0:00:43 338000 -- (-1802.915) (-1802.611) [-1804.723] (-1807.867) * (-1803.242) [-1804.619] (-1808.557) (-1802.544) -- 0:00:43 338500 -- (-1805.009) (-1804.113) [-1804.499] (-1807.636) * (-1803.242) [-1803.163] (-1803.798) (-1802.911) -- 0:00:42 339000 -- (-1803.627) [-1803.052] (-1801.569) (-1806.554) * (-1804.978) (-1805.863) [-1803.379] (-1805.601) -- 0:00:42 339500 -- (-1803.627) (-1802.433) [-1806.089] (-1807.714) * (-1804.748) (-1803.157) [-1803.253] (-1803.451) -- 0:00:44 340000 -- (-1802.031) (-1802.909) [-1804.457] (-1806.882) * (-1805.069) [-1804.280] (-1803.310) (-1803.535) -- 0:00:44 Average standard deviation of split frequencies: 0.011608 340500 -- (-1803.226) (-1802.676) [-1805.819] (-1804.816) * [-1804.115] (-1805.000) (-1803.178) (-1802.190) -- 0:00:44 341000 -- (-1805.582) (-1802.109) (-1807.290) [-1804.049] * (-1803.117) (-1805.801) (-1801.950) [-1802.614] -- 0:00:44 341500 -- [-1804.209] (-1802.705) (-1808.060) (-1804.039) * (-1804.341) [-1804.941] (-1802.152) (-1803.706) -- 0:00:44 342000 -- [-1803.200] (-1807.699) (-1804.289) (-1804.743) * (-1805.380) (-1805.812) [-1802.155] (-1808.307) -- 0:00:44 342500 -- (-1805.732) (-1808.602) (-1804.170) [-1802.584] * (-1806.167) [-1802.780] (-1803.744) (-1806.689) -- 0:00:44 343000 -- (-1803.892) [-1802.742] (-1804.069) (-1803.955) * (-1803.864) (-1801.882) (-1806.159) [-1802.739] -- 0:00:44 343500 -- (-1804.795) [-1803.701] (-1802.381) (-1803.843) * [-1803.619] (-1805.216) (-1804.872) (-1805.388) -- 0:00:43 344000 -- (-1806.580) (-1802.379) (-1802.657) [-1803.335] * (-1803.268) (-1803.401) (-1802.467) [-1806.414] -- 0:00:43 344500 -- (-1806.853) [-1807.519] (-1803.207) (-1803.057) * (-1805.677) (-1803.717) [-1802.711] (-1806.069) -- 0:00:43 345000 -- (-1807.592) (-1804.314) [-1803.893] (-1805.718) * (-1806.122) (-1802.491) [-1803.123] (-1806.204) -- 0:00:43 Average standard deviation of split frequencies: 0.010419 345500 -- (-1807.649) [-1804.218] (-1803.493) (-1803.664) * [-1802.996] (-1804.739) (-1803.042) (-1808.042) -- 0:00:43 346000 -- (-1804.715) (-1803.837) [-1805.712] (-1803.160) * [-1803.811] (-1803.718) (-1806.584) (-1806.186) -- 0:00:43 346500 -- (-1802.273) (-1807.225) [-1802.389] (-1804.750) * [-1807.696] (-1803.009) (-1806.456) (-1806.450) -- 0:00:43 347000 -- (-1803.650) (-1806.219) (-1803.028) [-1802.489] * [-1803.275] (-1803.734) (-1804.600) (-1804.759) -- 0:00:43 347500 -- [-1803.658] (-1808.143) (-1802.452) (-1802.907) * (-1803.371) [-1804.776] (-1804.531) (-1806.012) -- 0:00:43 348000 -- (-1808.438) (-1809.530) (-1803.076) [-1802.890] * (-1802.609) (-1802.461) (-1802.432) [-1803.569] -- 0:00:43 348500 -- [-1802.862] (-1801.992) (-1802.917) (-1803.478) * (-1802.608) [-1804.475] (-1802.264) (-1802.087) -- 0:00:42 349000 -- (-1802.454) (-1805.357) (-1803.075) [-1802.697] * [-1803.977] (-1804.315) (-1805.017) (-1802.676) -- 0:00:42 349500 -- (-1802.904) (-1802.457) (-1803.105) [-1803.953] * [-1806.303] (-1807.826) (-1802.851) (-1810.023) -- 0:00:42 350000 -- (-1803.506) (-1806.687) [-1804.853] (-1804.232) * [-1802.811] (-1804.916) (-1802.504) (-1807.972) -- 0:00:42 Average standard deviation of split frequencies: 0.010043 350500 -- (-1805.448) (-1805.295) [-1803.055] (-1803.745) * (-1804.205) [-1808.759] (-1806.191) (-1807.747) -- 0:00:42 351000 -- (-1804.355) [-1803.656] (-1802.694) (-1803.504) * (-1804.155) (-1806.314) (-1806.263) [-1803.739] -- 0:00:42 351500 -- (-1805.371) (-1803.827) (-1802.815) [-1802.869] * (-1804.858) (-1803.283) [-1804.032] (-1802.906) -- 0:00:42 352000 -- [-1804.354] (-1802.375) (-1802.142) (-1804.703) * [-1803.782] (-1802.134) (-1802.374) (-1801.871) -- 0:00:42 352500 -- (-1806.882) (-1804.862) (-1803.368) [-1803.885] * (-1809.685) (-1807.379) [-1802.489] (-1802.123) -- 0:00:42 353000 -- [-1806.859] (-1802.660) (-1805.782) (-1804.110) * (-1807.196) [-1802.818] (-1806.495) (-1802.456) -- 0:00:42 353500 -- (-1807.178) [-1803.465] (-1804.453) (-1802.869) * (-1804.664) [-1802.627] (-1801.875) (-1803.975) -- 0:00:42 354000 -- [-1803.518] (-1803.360) (-1806.210) (-1804.900) * (-1803.533) [-1802.103] (-1805.358) (-1806.853) -- 0:00:41 354500 -- (-1807.200) (-1804.588) (-1806.670) [-1803.362] * (-1801.631) (-1805.361) (-1801.762) [-1802.551] -- 0:00:41 355000 -- [-1802.712] (-1807.047) (-1803.794) (-1803.741) * (-1801.937) (-1806.552) (-1801.774) [-1803.063] -- 0:00:43 Average standard deviation of split frequencies: 0.009892 355500 -- (-1803.876) (-1806.940) (-1804.674) [-1802.589] * (-1803.985) (-1805.132) [-1802.514] (-1803.014) -- 0:00:43 356000 -- (-1805.853) (-1804.668) [-1802.212] (-1801.857) * (-1802.053) (-1805.052) [-1802.513] (-1804.342) -- 0:00:43 356500 -- [-1802.843] (-1811.782) (-1804.723) (-1802.889) * [-1802.118] (-1805.333) (-1802.621) (-1802.812) -- 0:00:43 357000 -- (-1804.247) [-1803.043] (-1803.769) (-1803.868) * (-1805.955) (-1804.389) [-1803.452] (-1803.108) -- 0:00:43 357500 -- (-1805.019) (-1802.129) (-1803.864) [-1803.255] * (-1804.731) [-1802.797] (-1807.722) (-1803.864) -- 0:00:43 358000 -- (-1803.023) (-1804.687) (-1803.309) [-1802.280] * (-1803.953) (-1805.071) [-1807.241] (-1804.832) -- 0:00:43 358500 -- (-1803.315) (-1806.617) (-1803.743) [-1802.367] * (-1804.330) [-1804.026] (-1805.585) (-1807.417) -- 0:00:42 359000 -- [-1802.323] (-1803.422) (-1805.437) (-1802.392) * (-1805.966) (-1805.068) [-1803.888] (-1805.884) -- 0:00:42 359500 -- [-1804.159] (-1803.747) (-1805.448) (-1802.045) * (-1806.183) [-1806.760] (-1805.487) (-1807.649) -- 0:00:42 360000 -- [-1804.462] (-1803.047) (-1806.621) (-1806.018) * (-1802.814) (-1803.641) [-1805.036] (-1807.482) -- 0:00:42 Average standard deviation of split frequencies: 0.009995 360500 -- [-1801.884] (-1802.784) (-1805.440) (-1802.857) * (-1802.601) (-1802.749) (-1804.109) [-1802.898] -- 0:00:42 361000 -- [-1803.249] (-1803.100) (-1802.724) (-1802.897) * (-1802.627) (-1807.218) (-1807.444) [-1803.067] -- 0:00:42 361500 -- [-1802.882] (-1802.673) (-1805.746) (-1804.629) * (-1803.089) [-1804.319] (-1803.767) (-1808.511) -- 0:00:42 362000 -- (-1805.391) [-1804.435] (-1802.690) (-1806.695) * [-1804.707] (-1804.747) (-1804.650) (-1807.192) -- 0:00:42 362500 -- (-1804.093) [-1803.367] (-1802.657) (-1806.933) * (-1803.467) [-1804.030] (-1805.307) (-1810.887) -- 0:00:42 363000 -- (-1804.190) (-1803.390) (-1802.154) [-1802.129] * [-1803.022] (-1804.788) (-1807.478) (-1810.676) -- 0:00:42 363500 -- (-1801.944) [-1803.899] (-1803.067) (-1803.866) * (-1807.052) [-1802.583] (-1808.368) (-1802.744) -- 0:00:42 364000 -- (-1804.168) (-1803.731) [-1803.077] (-1803.103) * [-1805.358] (-1802.382) (-1804.884) (-1808.143) -- 0:00:41 364500 -- (-1803.913) (-1804.298) (-1803.135) [-1804.357] * (-1804.742) [-1801.666] (-1804.860) (-1807.872) -- 0:00:41 365000 -- (-1802.167) (-1804.213) (-1804.374) [-1804.438] * (-1802.184) [-1803.769] (-1804.816) (-1806.092) -- 0:00:41 Average standard deviation of split frequencies: 0.009243 365500 -- (-1804.314) [-1803.983] (-1802.557) (-1805.322) * [-1803.681] (-1804.910) (-1804.228) (-1806.493) -- 0:00:41 366000 -- (-1807.026) (-1802.110) [-1801.763] (-1802.870) * (-1803.840) (-1804.120) (-1803.759) [-1804.767] -- 0:00:41 366500 -- [-1805.250] (-1802.690) (-1802.445) (-1804.678) * [-1801.941] (-1802.039) (-1803.167) (-1804.237) -- 0:00:41 367000 -- [-1802.160] (-1803.139) (-1806.622) (-1804.418) * (-1802.519) [-1801.819] (-1802.774) (-1804.394) -- 0:00:41 367500 -- [-1805.710] (-1804.632) (-1805.285) (-1803.383) * [-1803.871] (-1801.630) (-1803.890) (-1803.704) -- 0:00:41 368000 -- (-1801.763) (-1804.279) (-1804.236) [-1803.238] * (-1801.983) [-1802.253] (-1803.707) (-1806.273) -- 0:00:41 368500 -- [-1801.909] (-1808.740) (-1804.236) (-1805.113) * [-1804.127] (-1802.609) (-1803.400) (-1804.258) -- 0:00:41 369000 -- (-1806.740) [-1803.347] (-1803.954) (-1804.589) * (-1801.834) (-1802.245) [-1801.906] (-1803.576) -- 0:00:41 369500 -- (-1804.640) (-1808.700) [-1803.849] (-1806.475) * (-1804.220) (-1803.443) [-1802.026] (-1808.487) -- 0:00:42 370000 -- [-1803.205] (-1804.301) (-1803.282) (-1807.086) * (-1807.320) [-1802.822] (-1803.204) (-1808.411) -- 0:00:42 Average standard deviation of split frequencies: 0.008478 370500 -- [-1806.069] (-1804.145) (-1808.358) (-1804.063) * (-1807.329) (-1803.262) [-1803.204] (-1802.249) -- 0:00:42 371000 -- (-1803.414) [-1801.975] (-1812.668) (-1805.091) * (-1808.878) (-1805.195) (-1804.997) [-1804.640] -- 0:00:42 371500 -- [-1803.270] (-1802.457) (-1805.507) (-1804.780) * (-1804.527) [-1805.366] (-1804.699) (-1802.919) -- 0:00:42 372000 -- [-1803.813] (-1803.010) (-1805.636) (-1803.244) * (-1804.564) (-1804.392) (-1802.609) [-1801.890] -- 0:00:42 372500 -- (-1802.127) [-1801.900] (-1807.020) (-1804.538) * (-1807.682) (-1803.736) (-1804.588) [-1802.770] -- 0:00:42 373000 -- [-1802.690] (-1802.607) (-1803.584) (-1802.457) * (-1802.270) (-1803.712) (-1806.058) [-1802.954] -- 0:00:42 373500 -- (-1802.532) (-1804.022) [-1803.297] (-1804.112) * (-1803.962) (-1802.326) [-1803.531] (-1802.546) -- 0:00:41 374000 -- [-1802.966] (-1802.505) (-1802.725) (-1805.062) * (-1801.785) (-1802.174) (-1804.131) [-1804.263] -- 0:00:41 374500 -- (-1804.959) (-1804.638) (-1808.392) [-1805.859] * (-1802.000) [-1802.501] (-1804.281) (-1804.674) -- 0:00:41 375000 -- (-1802.534) (-1803.946) (-1806.077) [-1806.500] * (-1802.542) (-1803.345) (-1804.986) [-1802.477] -- 0:00:41 Average standard deviation of split frequencies: 0.009194 375500 -- [-1803.188] (-1801.658) (-1803.351) (-1804.961) * (-1805.216) (-1803.386) [-1804.078] (-1804.267) -- 0:00:41 376000 -- (-1803.261) (-1801.659) [-1804.144] (-1805.729) * (-1804.187) [-1804.789] (-1803.871) (-1802.902) -- 0:00:41 376500 -- (-1802.531) (-1802.094) (-1802.610) [-1803.530] * [-1803.934] (-1802.356) (-1807.444) (-1802.260) -- 0:00:41 377000 -- (-1805.522) (-1801.957) (-1805.568) [-1803.530] * (-1804.866) [-1803.178] (-1807.567) (-1808.105) -- 0:00:41 377500 -- (-1804.393) (-1802.512) [-1807.084] (-1803.318) * (-1804.288) (-1807.669) [-1802.624] (-1807.445) -- 0:00:41 378000 -- (-1804.086) [-1804.515] (-1805.174) (-1803.313) * (-1806.600) (-1806.364) (-1803.787) [-1808.251] -- 0:00:41 378500 -- (-1804.230) (-1802.491) (-1807.010) [-1803.069] * (-1804.580) (-1804.230) (-1802.288) [-1805.749] -- 0:00:41 379000 -- [-1805.520] (-1804.176) (-1809.981) (-1803.069) * (-1803.720) [-1804.040] (-1802.109) (-1805.930) -- 0:00:40 379500 -- (-1804.688) (-1803.470) (-1806.404) [-1802.624] * [-1803.853] (-1803.881) (-1802.753) (-1805.653) -- 0:00:40 380000 -- (-1802.350) [-1802.605] (-1806.630) (-1802.952) * [-1802.495] (-1804.626) (-1801.649) (-1804.616) -- 0:00:40 Average standard deviation of split frequencies: 0.009543 380500 -- (-1801.851) [-1802.682] (-1806.367) (-1805.705) * (-1804.837) (-1804.046) [-1802.395] (-1804.138) -- 0:00:40 381000 -- [-1802.837] (-1805.010) (-1802.516) (-1805.023) * (-1807.390) (-1803.883) (-1806.956) [-1803.950] -- 0:00:40 381500 -- [-1802.605] (-1803.480) (-1804.191) (-1805.518) * (-1803.277) (-1802.854) (-1806.215) [-1806.959] -- 0:00:40 382000 -- [-1802.486] (-1803.215) (-1805.161) (-1803.918) * (-1803.520) (-1802.827) [-1804.865] (-1809.665) -- 0:00:40 382500 -- (-1802.519) (-1803.304) [-1804.650] (-1806.348) * (-1803.505) (-1802.914) [-1803.956] (-1802.408) -- 0:00:40 383000 -- [-1802.663] (-1803.247) (-1802.970) (-1804.790) * (-1802.507) (-1802.552) (-1803.966) [-1802.585] -- 0:00:40 383500 -- [-1803.422] (-1803.280) (-1804.656) (-1804.795) * (-1803.170) (-1802.797) (-1806.329) [-1803.223] -- 0:00:40 384000 -- (-1802.133) (-1804.251) [-1804.965] (-1804.627) * (-1805.675) (-1802.576) (-1803.993) [-1804.293] -- 0:00:40 384500 -- [-1802.265] (-1802.993) (-1803.353) (-1803.349) * (-1804.869) (-1804.122) (-1806.888) [-1802.591] -- 0:00:40 385000 -- (-1802.310) [-1802.047] (-1803.047) (-1803.119) * (-1803.866) [-1806.443] (-1803.451) (-1803.074) -- 0:00:39 Average standard deviation of split frequencies: 0.009499 385500 -- (-1802.776) (-1803.429) (-1805.120) [-1802.153] * (-1804.970) (-1804.733) [-1804.163] (-1804.246) -- 0:00:41 386000 -- (-1803.496) [-1803.346] (-1805.457) (-1803.475) * [-1806.519] (-1803.030) (-1803.217) (-1806.624) -- 0:00:41 386500 -- (-1806.216) (-1805.082) (-1802.473) [-1803.938] * (-1805.882) (-1803.823) [-1803.639] (-1805.100) -- 0:00:41 387000 -- [-1806.005] (-1805.341) (-1804.221) (-1808.150) * (-1806.390) [-1804.350] (-1803.583) (-1802.804) -- 0:00:41 387500 -- (-1807.105) (-1803.501) (-1803.696) [-1807.309] * (-1804.271) (-1804.005) (-1806.340) [-1802.799] -- 0:00:41 388000 -- (-1802.019) [-1804.249] (-1802.299) (-1808.968) * [-1803.993] (-1804.236) (-1805.322) (-1804.428) -- 0:00:41 388500 -- (-1803.373) (-1805.722) [-1801.887] (-1803.718) * (-1808.558) (-1804.698) [-1803.781] (-1802.832) -- 0:00:40 389000 -- [-1804.338] (-1803.421) (-1803.258) (-1803.720) * [-1805.067] (-1803.874) (-1805.706) (-1802.602) -- 0:00:40 389500 -- [-1803.100] (-1804.018) (-1802.508) (-1804.701) * (-1805.346) (-1806.419) (-1803.536) [-1801.953] -- 0:00:40 390000 -- (-1803.096) (-1805.950) [-1802.594] (-1804.974) * (-1807.399) (-1802.842) (-1802.652) [-1802.658] -- 0:00:40 Average standard deviation of split frequencies: 0.008782 390500 -- (-1802.951) (-1804.872) (-1805.127) [-1804.686] * (-1807.703) [-1802.715] (-1804.464) (-1802.139) -- 0:00:40 391000 -- (-1804.321) [-1803.095] (-1804.905) (-1804.060) * (-1801.925) (-1802.736) [-1803.264] (-1802.572) -- 0:00:40 391500 -- (-1808.455) (-1803.065) [-1808.220] (-1804.457) * (-1803.553) (-1805.525) [-1802.101] (-1803.179) -- 0:00:40 392000 -- (-1804.310) [-1803.059] (-1805.103) (-1803.128) * (-1809.042) [-1803.663] (-1803.326) (-1804.361) -- 0:00:40 392500 -- (-1803.422) (-1803.059) (-1802.308) [-1806.070] * (-1805.954) (-1803.295) (-1805.431) [-1805.018] -- 0:00:40 393000 -- (-1804.309) (-1802.296) (-1804.148) [-1804.865] * [-1807.076] (-1807.932) (-1804.351) (-1805.000) -- 0:00:40 393500 -- (-1804.927) (-1803.885) [-1804.140] (-1802.046) * [-1803.788] (-1807.473) (-1804.112) (-1803.896) -- 0:00:40 394000 -- (-1802.457) (-1802.308) [-1801.903] (-1806.279) * [-1802.967] (-1801.850) (-1803.507) (-1804.377) -- 0:00:39 394500 -- (-1803.751) (-1804.272) (-1802.967) [-1806.497] * (-1807.587) (-1803.787) [-1804.274] (-1804.025) -- 0:00:39 395000 -- (-1803.677) [-1802.528] (-1802.764) (-1804.247) * (-1807.213) (-1805.511) (-1803.680) [-1803.850] -- 0:00:39 Average standard deviation of split frequencies: 0.009259 395500 -- (-1803.499) (-1802.719) [-1803.590] (-1802.406) * (-1805.964) (-1803.179) (-1802.898) [-1802.896] -- 0:00:39 396000 -- [-1803.884] (-1812.089) (-1803.151) (-1803.472) * (-1804.733) (-1802.460) (-1802.742) [-1806.497] -- 0:00:39 396500 -- [-1803.939] (-1804.531) (-1802.372) (-1805.321) * (-1802.699) [-1802.450] (-1806.373) (-1805.954) -- 0:00:39 397000 -- (-1805.781) (-1802.930) (-1802.359) [-1806.112] * [-1802.234] (-1805.725) (-1807.031) (-1804.957) -- 0:00:39 397500 -- [-1806.835] (-1803.108) (-1803.075) (-1805.632) * (-1803.115) (-1804.465) [-1802.477] (-1804.481) -- 0:00:39 398000 -- (-1803.778) (-1804.079) [-1804.263] (-1807.119) * (-1804.163) (-1802.235) (-1803.057) [-1801.911] -- 0:00:39 398500 -- [-1803.897] (-1801.416) (-1802.698) (-1805.687) * (-1806.124) (-1802.210) (-1803.998) [-1803.028] -- 0:00:39 399000 -- (-1804.269) (-1803.980) [-1803.914] (-1805.954) * (-1804.016) (-1804.444) [-1805.911] (-1803.421) -- 0:00:39 399500 -- (-1803.520) (-1804.676) (-1803.622) [-1802.837] * (-1803.866) (-1803.194) [-1804.281] (-1803.854) -- 0:00:39 400000 -- (-1803.801) (-1803.333) (-1804.141) [-1802.871] * (-1802.880) [-1803.287] (-1805.004) (-1806.457) -- 0:00:39 Average standard deviation of split frequencies: 0.008305 400500 -- (-1804.281) (-1804.313) (-1806.056) [-1802.272] * [-1802.454] (-1802.639) (-1802.635) (-1805.163) -- 0:00:40 401000 -- (-1803.284) (-1802.320) [-1805.270] (-1804.305) * [-1801.891] (-1802.643) (-1803.109) (-1804.636) -- 0:00:40 401500 -- [-1803.239] (-1807.794) (-1805.780) (-1803.924) * (-1804.895) [-1803.001] (-1802.337) (-1804.878) -- 0:00:40 402000 -- (-1802.238) (-1805.593) (-1803.873) [-1805.181] * [-1802.191] (-1803.420) (-1803.882) (-1804.094) -- 0:00:40 402500 -- [-1802.507] (-1804.395) (-1807.266) (-1802.715) * (-1802.877) (-1806.253) (-1804.300) [-1803.383] -- 0:00:40 403000 -- (-1804.639) (-1804.754) (-1805.347) [-1804.820] * [-1801.980] (-1804.226) (-1807.973) (-1802.852) -- 0:00:39 403500 -- (-1802.699) (-1807.713) [-1803.382] (-1803.815) * (-1803.784) [-1804.773] (-1808.737) (-1803.231) -- 0:00:39 404000 -- (-1803.239) [-1805.974] (-1804.281) (-1807.841) * (-1807.467) (-1803.062) [-1808.319] (-1803.225) -- 0:00:39 404500 -- [-1802.700] (-1803.357) (-1804.944) (-1803.911) * (-1804.031) (-1802.090) (-1804.966) [-1803.223] -- 0:00:39 405000 -- (-1803.871) (-1804.026) (-1807.647) [-1805.586] * (-1803.765) (-1802.735) [-1802.464] (-1802.729) -- 0:00:39 Average standard deviation of split frequencies: 0.009289 405500 -- (-1809.161) (-1802.918) (-1804.106) [-1804.330] * (-1802.317) (-1804.183) [-1802.324] (-1803.086) -- 0:00:39 406000 -- (-1806.827) [-1802.616] (-1807.016) (-1803.711) * (-1802.501) (-1806.873) (-1803.623) [-1802.364] -- 0:00:39 406500 -- [-1803.358] (-1805.809) (-1804.152) (-1802.805) * (-1804.590) (-1806.498) (-1802.985) [-1807.057] -- 0:00:39 407000 -- (-1803.678) (-1802.800) (-1802.911) [-1802.996] * (-1806.232) (-1805.483) [-1807.028] (-1803.392) -- 0:00:39 407500 -- (-1808.030) (-1802.920) [-1803.014] (-1803.000) * [-1803.869] (-1809.338) (-1807.003) (-1802.698) -- 0:00:39 408000 -- [-1802.217] (-1804.148) (-1804.219) (-1803.124) * (-1808.801) (-1806.464) (-1803.980) [-1801.998] -- 0:00:39 408500 -- (-1801.875) (-1802.744) [-1803.057] (-1802.098) * (-1802.633) (-1802.210) [-1803.292] (-1805.838) -- 0:00:39 409000 -- [-1806.419] (-1802.139) (-1804.343) (-1805.904) * [-1806.884] (-1802.593) (-1803.131) (-1806.046) -- 0:00:39 409500 -- (-1806.204) [-1805.066] (-1802.913) (-1807.984) * (-1806.553) (-1802.654) [-1802.894] (-1805.207) -- 0:00:38 410000 -- (-1803.883) [-1803.639] (-1804.478) (-1808.089) * [-1801.948] (-1802.920) (-1802.983) (-1804.052) -- 0:00:38 Average standard deviation of split frequencies: 0.009848 410500 -- (-1803.699) [-1804.809] (-1802.589) (-1805.675) * [-1801.935] (-1802.477) (-1803.023) (-1804.018) -- 0:00:38 411000 -- (-1807.669) (-1806.583) [-1806.123] (-1805.618) * (-1806.353) (-1802.638) (-1803.135) [-1804.200] -- 0:00:38 411500 -- (-1805.210) [-1804.152] (-1807.171) (-1807.599) * [-1804.709] (-1803.015) (-1806.527) (-1803.752) -- 0:00:38 412000 -- [-1805.122] (-1804.246) (-1808.213) (-1807.845) * (-1803.047) (-1803.773) [-1803.848] (-1802.494) -- 0:00:38 412500 -- (-1806.865) [-1803.056] (-1804.085) (-1805.425) * (-1803.127) (-1803.840) (-1804.564) [-1802.345] -- 0:00:38 413000 -- (-1803.137) [-1802.471] (-1803.925) (-1803.759) * [-1805.719] (-1803.355) (-1805.005) (-1804.428) -- 0:00:38 413500 -- (-1802.280) (-1801.530) (-1810.111) [-1804.679] * (-1807.573) (-1802.414) [-1802.818] (-1802.827) -- 0:00:38 414000 -- [-1805.152] (-1802.494) (-1803.028) (-1802.585) * [-1801.467] (-1804.137) (-1802.564) (-1802.536) -- 0:00:38 414500 -- (-1804.047) (-1803.023) (-1804.648) [-1802.619] * (-1802.769) (-1803.379) [-1802.825] (-1803.398) -- 0:00:38 415000 -- (-1802.485) (-1803.005) (-1804.316) [-1803.739] * (-1802.078) [-1801.787] (-1802.110) (-1809.278) -- 0:00:38 Average standard deviation of split frequencies: 0.010557 415500 -- [-1804.541] (-1802.097) (-1806.421) (-1808.387) * (-1802.071) (-1801.829) (-1801.731) [-1804.101] -- 0:00:37 416000 -- [-1802.961] (-1804.837) (-1804.843) (-1807.291) * (-1803.967) (-1806.653) (-1807.057) [-1804.097] -- 0:00:37 416500 -- [-1803.565] (-1802.709) (-1804.669) (-1803.745) * (-1804.117) (-1805.552) [-1806.832] (-1804.896) -- 0:00:39 417000 -- [-1808.986] (-1802.772) (-1805.015) (-1803.641) * (-1804.148) [-1804.072] (-1805.986) (-1807.448) -- 0:00:39 417500 -- (-1804.275) (-1806.477) [-1804.858] (-1802.528) * (-1804.424) [-1803.171] (-1802.614) (-1805.905) -- 0:00:39 418000 -- (-1801.566) (-1805.940) (-1803.405) [-1803.968] * (-1804.818) [-1804.644] (-1802.387) (-1804.833) -- 0:00:38 418500 -- [-1803.708] (-1804.322) (-1805.187) (-1803.360) * (-1805.716) (-1806.016) [-1803.087] (-1805.448) -- 0:00:38 419000 -- [-1805.095] (-1805.772) (-1811.976) (-1803.799) * [-1804.116] (-1803.327) (-1805.412) (-1803.331) -- 0:00:38 419500 -- [-1802.388] (-1807.351) (-1806.484) (-1803.820) * [-1803.108] (-1802.927) (-1802.607) (-1803.880) -- 0:00:38 420000 -- [-1802.210] (-1805.981) (-1804.595) (-1804.034) * [-1805.688] (-1802.350) (-1805.026) (-1803.497) -- 0:00:38 Average standard deviation of split frequencies: 0.010321 420500 -- (-1802.937) (-1802.596) (-1807.106) [-1805.127] * [-1803.339] (-1808.559) (-1802.142) (-1802.341) -- 0:00:38 421000 -- [-1802.830] (-1803.576) (-1802.415) (-1805.990) * [-1803.705] (-1808.289) (-1803.432) (-1802.522) -- 0:00:38 421500 -- (-1804.876) (-1803.222) [-1804.119] (-1806.202) * [-1803.572] (-1802.517) (-1805.893) (-1802.468) -- 0:00:38 422000 -- (-1804.584) (-1804.131) [-1806.211] (-1806.372) * (-1803.888) [-1807.184] (-1802.633) (-1802.228) -- 0:00:38 422500 -- (-1805.120) [-1803.353] (-1811.279) (-1802.906) * [-1804.846] (-1804.915) (-1806.657) (-1802.275) -- 0:00:38 423000 -- (-1805.176) (-1805.295) [-1803.899] (-1803.740) * [-1805.852] (-1805.118) (-1803.045) (-1804.254) -- 0:00:38 423500 -- (-1804.097) [-1804.197] (-1806.211) (-1803.670) * (-1803.636) (-1803.891) [-1803.464] (-1803.299) -- 0:00:38 424000 -- (-1803.721) [-1805.188] (-1803.811) (-1803.470) * (-1803.614) (-1802.518) (-1804.392) [-1803.114] -- 0:00:38 424500 -- (-1803.520) [-1801.768] (-1803.244) (-1802.793) * [-1808.421] (-1802.241) (-1805.795) (-1804.565) -- 0:00:37 425000 -- (-1802.849) (-1801.771) [-1805.115] (-1802.511) * [-1805.144] (-1806.603) (-1806.197) (-1802.162) -- 0:00:37 Average standard deviation of split frequencies: 0.010425 425500 -- (-1802.841) (-1801.790) [-1806.244] (-1802.735) * (-1802.562) (-1807.274) [-1803.053] (-1803.411) -- 0:00:37 426000 -- (-1806.191) [-1803.538] (-1804.234) (-1807.504) * (-1802.180) [-1806.485] (-1807.325) (-1802.316) -- 0:00:37 426500 -- (-1804.686) (-1805.032) (-1804.731) [-1804.188] * (-1802.281) (-1805.344) (-1803.152) [-1801.950] -- 0:00:37 427000 -- (-1804.556) (-1808.140) (-1802.422) [-1804.632] * [-1803.958] (-1802.526) (-1807.628) (-1803.565) -- 0:00:37 427500 -- [-1801.846] (-1805.338) (-1804.333) (-1803.282) * [-1802.670] (-1802.873) (-1805.871) (-1803.928) -- 0:00:37 428000 -- (-1802.888) [-1805.228] (-1802.895) (-1801.975) * [-1802.316] (-1803.930) (-1801.861) (-1803.595) -- 0:00:37 428500 -- (-1802.964) (-1803.557) [-1804.268] (-1805.905) * (-1806.656) [-1802.580] (-1801.868) (-1802.649) -- 0:00:37 429000 -- (-1801.724) [-1804.651] (-1804.339) (-1805.789) * (-1805.012) (-1805.015) (-1802.750) [-1802.918] -- 0:00:37 429500 -- (-1802.803) (-1805.327) [-1802.829] (-1807.739) * (-1804.961) [-1805.080] (-1802.750) (-1806.948) -- 0:00:37 430000 -- (-1803.704) (-1804.358) (-1803.398) [-1804.726] * [-1807.588] (-1805.898) (-1803.447) (-1809.574) -- 0:00:37 Average standard deviation of split frequencies: 0.011349 430500 -- (-1802.493) (-1803.296) (-1803.504) [-1802.213] * (-1804.813) (-1805.163) (-1808.770) [-1805.470] -- 0:00:37 431000 -- (-1802.612) (-1805.923) (-1803.818) [-1802.751] * (-1805.228) [-1804.951] (-1805.049) (-1805.931) -- 0:00:36 431500 -- (-1802.348) [-1802.993] (-1806.903) (-1807.483) * [-1803.756] (-1804.115) (-1804.543) (-1807.289) -- 0:00:36 432000 -- (-1803.901) (-1804.998) [-1807.276] (-1806.745) * [-1802.566] (-1810.652) (-1810.221) (-1803.339) -- 0:00:38 432500 -- (-1803.579) (-1804.528) (-1803.987) [-1804.410] * (-1804.241) (-1805.783) (-1805.524) [-1803.904] -- 0:00:38 433000 -- (-1804.344) (-1807.664) [-1802.888] (-1804.482) * (-1805.307) [-1804.082] (-1804.472) (-1803.434) -- 0:00:37 433500 -- (-1804.518) (-1807.734) [-1802.142] (-1803.374) * (-1804.169) [-1802.308] (-1803.474) (-1803.860) -- 0:00:37 434000 -- (-1801.834) (-1803.795) [-1802.881] (-1802.388) * (-1805.798) [-1801.997] (-1803.064) (-1805.574) -- 0:00:37 434500 -- (-1804.473) (-1806.282) (-1805.415) [-1807.097] * (-1808.052) [-1802.932] (-1803.282) (-1804.829) -- 0:00:37 435000 -- [-1803.895] (-1806.725) (-1803.232) (-1803.780) * (-1803.745) (-1804.607) (-1804.385) [-1807.477] -- 0:00:37 Average standard deviation of split frequencies: 0.011097 435500 -- (-1804.698) [-1805.275] (-1804.040) (-1805.580) * [-1802.948] (-1804.001) (-1803.321) (-1805.766) -- 0:00:37 436000 -- [-1806.183] (-1804.102) (-1804.521) (-1811.455) * (-1804.896) (-1803.745) [-1803.054] (-1804.288) -- 0:00:37 436500 -- (-1806.753) [-1803.914] (-1803.333) (-1806.632) * (-1803.247) [-1803.323] (-1802.452) (-1803.303) -- 0:00:37 437000 -- (-1803.866) (-1803.182) (-1802.214) [-1802.335] * (-1804.680) (-1803.362) (-1804.911) [-1803.395] -- 0:00:37 437500 -- [-1804.302] (-1804.652) (-1802.214) (-1801.917) * [-1803.407] (-1802.082) (-1806.352) (-1806.514) -- 0:00:37 438000 -- [-1805.782] (-1801.935) (-1803.641) (-1802.580) * (-1803.334) [-1803.317] (-1804.917) (-1803.471) -- 0:00:37 438500 -- (-1806.249) (-1802.694) (-1802.402) [-1801.878] * [-1805.891] (-1804.862) (-1804.395) (-1805.167) -- 0:00:37 439000 -- [-1802.911] (-1802.158) (-1802.648) (-1801.892) * (-1809.014) [-1804.764] (-1804.790) (-1804.679) -- 0:00:37 439500 -- (-1803.490) (-1803.900) [-1802.648] (-1801.981) * (-1805.622) (-1803.551) (-1804.530) [-1802.727] -- 0:00:36 440000 -- (-1803.346) [-1805.596] (-1804.823) (-1802.649) * (-1802.358) (-1802.892) (-1804.262) [-1803.511] -- 0:00:36 Average standard deviation of split frequencies: 0.010519 440500 -- (-1809.473) [-1806.149] (-1805.743) (-1803.349) * [-1802.237] (-1803.462) (-1804.216) (-1802.979) -- 0:00:36 441000 -- [-1807.895] (-1803.211) (-1803.026) (-1802.498) * [-1803.021] (-1802.404) (-1802.320) (-1802.311) -- 0:00:36 441500 -- [-1806.808] (-1804.103) (-1803.738) (-1802.917) * (-1803.551) (-1805.643) [-1802.285] (-1804.960) -- 0:00:36 442000 -- (-1806.013) (-1803.150) (-1806.393) [-1803.817] * (-1803.177) (-1805.705) [-1804.220] (-1802.987) -- 0:00:36 442500 -- (-1804.835) (-1802.553) [-1804.072] (-1804.545) * (-1802.750) (-1803.598) (-1806.517) [-1805.821] -- 0:00:36 443000 -- [-1808.493] (-1802.372) (-1805.882) (-1803.328) * [-1805.769] (-1804.438) (-1803.119) (-1802.718) -- 0:00:36 443500 -- (-1806.593) (-1806.603) [-1805.787] (-1803.413) * (-1802.456) (-1804.509) [-1803.243] (-1802.100) -- 0:00:36 444000 -- (-1803.748) (-1802.725) (-1805.812) [-1803.329] * (-1801.914) (-1803.806) [-1803.045] (-1810.698) -- 0:00:36 444500 -- [-1802.343] (-1803.556) (-1801.887) (-1802.966) * (-1802.033) [-1803.054] (-1803.679) (-1803.805) -- 0:00:36 445000 -- (-1810.893) (-1803.055) [-1802.949] (-1803.888) * (-1803.990) (-1804.087) [-1805.555] (-1803.513) -- 0:00:36 Average standard deviation of split frequencies: 0.010276 445500 -- [-1803.201] (-1804.488) (-1804.754) (-1805.385) * [-1804.207] (-1802.882) (-1803.830) (-1802.921) -- 0:00:36 446000 -- (-1807.785) (-1804.615) [-1805.174] (-1803.368) * (-1810.281) [-1806.524] (-1801.847) (-1806.084) -- 0:00:36 446500 -- (-1808.203) [-1804.202] (-1802.013) (-1803.244) * [-1802.675] (-1808.406) (-1804.024) (-1804.359) -- 0:00:35 447000 -- (-1805.647) [-1804.637] (-1802.882) (-1803.222) * (-1803.344) (-1802.845) [-1804.244] (-1801.661) -- 0:00:35 447500 -- (-1806.997) (-1802.494) (-1802.265) [-1803.336] * (-1805.306) [-1803.628] (-1802.814) (-1802.444) -- 0:00:37 448000 -- (-1803.089) [-1802.371] (-1802.222) (-1805.830) * (-1804.392) (-1803.797) [-1803.390] (-1802.495) -- 0:00:36 448500 -- (-1806.050) [-1804.307] (-1803.070) (-1804.136) * (-1805.053) (-1806.093) [-1806.273] (-1803.426) -- 0:00:36 449000 -- (-1807.991) (-1802.728) [-1806.676] (-1803.885) * (-1806.386) (-1803.379) [-1801.985] (-1803.012) -- 0:00:36 449500 -- (-1804.944) [-1801.932] (-1807.672) (-1805.379) * [-1803.620] (-1804.548) (-1801.823) (-1804.492) -- 0:00:36 450000 -- (-1803.786) [-1802.204] (-1806.832) (-1806.340) * (-1802.403) (-1806.007) [-1802.148] (-1804.171) -- 0:00:36 Average standard deviation of split frequencies: 0.009937 450500 -- [-1807.280] (-1802.844) (-1809.891) (-1803.166) * [-1802.877] (-1803.568) (-1803.556) (-1802.766) -- 0:00:36 451000 -- (-1805.868) (-1802.241) [-1804.708] (-1803.743) * [-1802.655] (-1802.940) (-1802.960) (-1802.987) -- 0:00:36 451500 -- [-1802.813] (-1802.879) (-1806.634) (-1807.477) * (-1805.031) (-1803.750) (-1803.580) [-1804.449] -- 0:00:36 452000 -- (-1803.785) (-1801.689) (-1805.705) [-1804.389] * (-1803.130) (-1810.601) [-1804.211] (-1806.868) -- 0:00:36 452500 -- (-1804.055) (-1802.688) (-1802.573) [-1801.809] * [-1802.507] (-1807.652) (-1805.317) (-1807.003) -- 0:00:36 453000 -- [-1804.038] (-1802.002) (-1806.251) (-1803.641) * [-1803.611] (-1803.702) (-1803.121) (-1804.741) -- 0:00:36 453500 -- (-1804.002) [-1801.972] (-1803.412) (-1802.756) * (-1804.089) (-1804.815) [-1805.014] (-1805.604) -- 0:00:36 454000 -- [-1806.241] (-1801.990) (-1808.667) (-1802.965) * (-1803.796) (-1804.615) [-1802.893] (-1804.892) -- 0:00:36 454500 -- (-1803.910) (-1803.607) [-1807.685] (-1807.241) * (-1804.318) (-1801.799) [-1803.600] (-1806.579) -- 0:00:36 455000 -- [-1805.983] (-1802.590) (-1804.009) (-1805.323) * [-1807.859] (-1803.894) (-1803.166) (-1804.129) -- 0:00:35 Average standard deviation of split frequencies: 0.009706 455500 -- (-1804.692) (-1805.679) [-1803.248] (-1804.681) * (-1802.504) [-1802.204] (-1807.345) (-1804.594) -- 0:00:35 456000 -- (-1805.916) (-1803.473) (-1802.890) [-1802.481] * (-1802.224) (-1803.230) (-1805.628) [-1803.637] -- 0:00:35 456500 -- (-1808.772) (-1802.174) [-1803.777] (-1803.431) * [-1802.223] (-1802.925) (-1806.048) (-1804.993) -- 0:00:35 457000 -- (-1807.096) (-1802.347) [-1803.422] (-1805.657) * [-1802.199] (-1802.361) (-1806.736) (-1804.266) -- 0:00:35 457500 -- (-1802.341) [-1802.254] (-1803.476) (-1804.974) * (-1808.727) (-1806.038) (-1806.369) [-1802.700] -- 0:00:35 458000 -- (-1803.469) (-1802.286) (-1803.331) [-1803.252] * (-1802.349) (-1805.495) (-1811.539) [-1803.756] -- 0:00:35 458500 -- (-1804.487) [-1802.342] (-1804.647) (-1803.936) * (-1803.753) [-1806.857] (-1803.999) (-1808.004) -- 0:00:35 459000 -- (-1809.421) (-1802.480) (-1804.649) [-1805.663] * [-1803.710] (-1805.122) (-1803.789) (-1802.654) -- 0:00:35 459500 -- (-1806.727) (-1802.813) (-1803.789) [-1804.458] * [-1802.820] (-1804.849) (-1804.914) (-1802.977) -- 0:00:35 460000 -- [-1803.573] (-1805.456) (-1803.850) (-1805.712) * (-1802.358) [-1803.371] (-1804.022) (-1805.625) -- 0:00:35 Average standard deviation of split frequencies: 0.009778 460500 -- (-1802.854) (-1805.232) (-1803.351) [-1804.710] * (-1802.879) (-1803.188) [-1803.110] (-1803.002) -- 0:00:35 461000 -- [-1806.696] (-1802.869) (-1809.608) (-1804.081) * (-1804.003) (-1805.341) [-1802.930] (-1802.049) -- 0:00:35 461500 -- (-1804.980) [-1803.870] (-1807.023) (-1803.766) * (-1803.715) (-1802.648) (-1803.000) [-1801.549] -- 0:00:35 462000 -- (-1806.025) (-1802.679) [-1802.720] (-1803.245) * [-1807.221] (-1803.927) (-1803.509) (-1804.328) -- 0:00:34 462500 -- [-1806.161] (-1805.360) (-1805.101) (-1803.895) * (-1804.085) (-1805.055) (-1803.785) [-1803.261] -- 0:00:34 463000 -- (-1803.414) [-1802.419] (-1805.499) (-1807.705) * [-1805.577] (-1805.375) (-1803.957) (-1803.576) -- 0:00:34 463500 -- [-1807.497] (-1801.586) (-1807.573) (-1805.520) * (-1807.519) (-1804.694) [-1803.842] (-1803.790) -- 0:00:35 464000 -- (-1806.492) [-1801.792] (-1806.028) (-1802.509) * (-1805.618) (-1801.962) (-1805.090) [-1803.717] -- 0:00:35 464500 -- (-1805.334) [-1803.639] (-1803.147) (-1802.181) * [-1802.700] (-1801.844) (-1807.654) (-1802.323) -- 0:00:35 465000 -- [-1804.008] (-1804.837) (-1803.787) (-1802.612) * (-1803.141) (-1801.816) [-1805.795] (-1804.762) -- 0:00:35 Average standard deviation of split frequencies: 0.009779 465500 -- [-1806.791] (-1803.413) (-1802.819) (-1801.932) * (-1802.227) [-1805.780] (-1804.095) (-1805.246) -- 0:00:35 466000 -- [-1802.651] (-1801.824) (-1804.531) (-1801.725) * (-1802.324) (-1801.911) (-1804.041) [-1806.879] -- 0:00:35 466500 -- (-1802.716) [-1801.557] (-1803.025) (-1802.525) * [-1803.329] (-1805.717) (-1803.943) (-1803.400) -- 0:00:35 467000 -- [-1802.553] (-1806.596) (-1804.658) (-1802.553) * (-1805.696) [-1803.335] (-1803.080) (-1804.091) -- 0:00:35 467500 -- (-1807.170) [-1804.601] (-1806.472) (-1803.233) * (-1803.266) [-1804.473] (-1803.056) (-1803.479) -- 0:00:35 468000 -- [-1804.968] (-1804.899) (-1802.904) (-1802.207) * (-1801.911) (-1809.816) [-1804.152] (-1803.653) -- 0:00:35 468500 -- (-1804.195) [-1803.616] (-1802.876) (-1803.761) * (-1805.156) [-1804.541] (-1803.697) (-1806.929) -- 0:00:35 469000 -- (-1805.019) (-1802.596) (-1801.685) [-1806.918] * (-1803.612) (-1804.637) [-1806.508] (-1806.590) -- 0:00:35 469500 -- (-1803.598) (-1804.305) [-1802.610] (-1804.550) * (-1802.668) (-1803.597) (-1804.379) [-1805.672] -- 0:00:35 470000 -- (-1804.780) (-1803.502) (-1803.083) [-1802.035] * (-1803.812) (-1803.196) [-1807.074] (-1803.610) -- 0:00:34 Average standard deviation of split frequencies: 0.009960 470500 -- (-1804.156) (-1806.560) (-1806.365) [-1804.128] * (-1804.374) [-1806.240] (-1809.648) (-1802.816) -- 0:00:34 471000 -- [-1802.724] (-1805.338) (-1806.114) (-1804.977) * (-1803.811) (-1804.878) (-1805.325) [-1802.826] -- 0:00:34 471500 -- [-1805.793] (-1804.402) (-1805.117) (-1804.454) * (-1804.980) (-1805.699) [-1805.532] (-1803.632) -- 0:00:34 472000 -- (-1803.789) [-1803.216] (-1806.288) (-1804.352) * [-1806.556] (-1803.381) (-1804.066) (-1806.447) -- 0:00:34 472500 -- (-1803.375) (-1805.913) (-1802.811) [-1801.685] * (-1804.197) [-1805.967] (-1802.510) (-1804.273) -- 0:00:34 473000 -- (-1805.353) (-1802.618) [-1801.999] (-1803.412) * (-1804.501) [-1802.623] (-1802.051) (-1802.646) -- 0:00:34 473500 -- (-1802.722) (-1803.225) [-1803.029] (-1801.874) * (-1805.406) [-1802.717] (-1804.430) (-1803.917) -- 0:00:34 474000 -- (-1803.099) (-1803.264) [-1804.176] (-1802.748) * (-1802.933) (-1802.135) (-1804.331) [-1803.627] -- 0:00:34 474500 -- (-1804.877) [-1804.678] (-1804.001) (-1803.955) * (-1803.430) [-1804.881] (-1802.965) (-1807.175) -- 0:00:34 475000 -- (-1806.850) (-1802.588) (-1803.407) [-1807.316] * (-1806.878) [-1802.473] (-1802.251) (-1804.649) -- 0:00:34 Average standard deviation of split frequencies: 0.010234 475500 -- (-1805.749) (-1802.947) (-1804.231) [-1803.529] * [-1804.296] (-1803.608) (-1803.216) (-1803.013) -- 0:00:34 476000 -- (-1807.794) (-1804.796) (-1802.648) [-1803.519] * (-1803.174) (-1803.955) (-1803.230) [-1802.807] -- 0:00:34 476500 -- [-1801.788] (-1803.138) (-1805.806) (-1802.490) * (-1802.317) [-1802.676] (-1804.737) (-1801.897) -- 0:00:34 477000 -- (-1802.573) (-1807.969) (-1804.690) [-1803.861] * [-1802.951] (-1802.732) (-1802.248) (-1802.337) -- 0:00:33 477500 -- (-1802.752) (-1805.498) (-1803.976) [-1804.821] * (-1801.538) [-1802.015] (-1802.467) (-1805.250) -- 0:00:33 478000 -- (-1801.628) (-1803.446) (-1803.634) [-1803.562] * (-1802.040) [-1802.348] (-1804.560) (-1806.677) -- 0:00:33 478500 -- (-1803.663) (-1805.665) [-1803.228] (-1803.189) * (-1803.851) (-1802.917) [-1802.265] (-1806.684) -- 0:00:33 479000 -- [-1803.946] (-1805.707) (-1805.339) (-1809.816) * [-1802.717] (-1804.222) (-1803.864) (-1805.295) -- 0:00:34 479500 -- (-1806.089) (-1801.869) [-1805.985] (-1803.744) * [-1802.631] (-1803.755) (-1803.872) (-1802.559) -- 0:00:34 480000 -- (-1807.388) (-1803.090) [-1802.600] (-1803.815) * (-1803.373) (-1803.062) (-1805.731) [-1804.261] -- 0:00:34 Average standard deviation of split frequencies: 0.009371 480500 -- (-1808.773) (-1803.438) [-1803.060] (-1803.117) * [-1803.767] (-1803.599) (-1805.439) (-1805.452) -- 0:00:34 481000 -- (-1807.220) [-1802.858] (-1803.805) (-1803.988) * (-1804.482) [-1803.628] (-1804.016) (-1804.564) -- 0:00:34 481500 -- (-1808.747) (-1803.526) [-1808.487] (-1802.559) * (-1815.360) [-1803.269] (-1804.006) (-1804.475) -- 0:00:34 482000 -- (-1802.885) (-1803.513) (-1805.983) [-1802.869] * (-1807.474) (-1804.445) (-1804.785) [-1806.393] -- 0:00:34 482500 -- (-1804.263) (-1803.990) (-1806.557) [-1804.250] * (-1804.916) (-1802.079) [-1803.977] (-1803.787) -- 0:00:34 483000 -- (-1803.365) (-1803.573) [-1812.845] (-1803.115) * (-1806.218) (-1804.382) (-1804.138) [-1802.991] -- 0:00:34 483500 -- (-1804.188) (-1803.412) (-1806.386) [-1804.322] * (-1805.378) (-1807.215) [-1808.262] (-1804.504) -- 0:00:34 484000 -- (-1803.438) (-1805.399) [-1803.146] (-1804.835) * [-1803.726] (-1808.083) (-1806.733) (-1805.282) -- 0:00:34 484500 -- [-1805.120] (-1805.976) (-1803.153) (-1804.214) * (-1804.793) (-1803.616) [-1805.090] (-1802.579) -- 0:00:34 485000 -- [-1802.701] (-1804.764) (-1806.604) (-1804.621) * [-1804.458] (-1802.532) (-1802.428) (-1802.177) -- 0:00:33 Average standard deviation of split frequencies: 0.009053 485500 -- [-1802.780] (-1803.639) (-1803.597) (-1804.452) * (-1802.335) [-1806.213] (-1802.198) (-1804.952) -- 0:00:33 486000 -- (-1802.124) (-1802.757) (-1804.117) [-1804.269] * (-1804.275) (-1806.707) (-1802.545) [-1803.079] -- 0:00:33 486500 -- (-1802.877) (-1802.457) (-1803.265) [-1805.234] * [-1805.012] (-1804.213) (-1804.764) (-1801.702) -- 0:00:33 487000 -- (-1803.579) [-1802.679] (-1804.068) (-1805.342) * (-1804.625) (-1805.312) [-1808.006] (-1803.274) -- 0:00:33 487500 -- (-1802.561) [-1803.274] (-1802.937) (-1805.847) * [-1803.471] (-1806.311) (-1806.426) (-1804.176) -- 0:00:33 488000 -- [-1802.865] (-1803.635) (-1803.881) (-1803.110) * (-1802.932) [-1807.396] (-1805.552) (-1803.411) -- 0:00:33 488500 -- [-1802.159] (-1803.743) (-1803.371) (-1803.879) * (-1805.985) [-1804.012] (-1807.913) (-1804.062) -- 0:00:33 489000 -- (-1803.826) (-1803.660) (-1804.151) [-1803.853] * (-1806.446) (-1803.765) [-1806.247] (-1803.305) -- 0:00:33 489500 -- (-1802.509) (-1803.615) (-1803.550) [-1807.424] * [-1805.155] (-1804.773) (-1802.031) (-1804.508) -- 0:00:33 490000 -- [-1801.828] (-1802.780) (-1802.709) (-1803.704) * [-1805.205] (-1805.148) (-1802.033) (-1808.046) -- 0:00:33 Average standard deviation of split frequencies: 0.009127 490500 -- (-1801.847) (-1802.978) (-1805.002) [-1802.572] * [-1802.127] (-1804.534) (-1802.867) (-1809.503) -- 0:00:33 491000 -- (-1801.888) [-1804.643] (-1803.323) (-1802.375) * (-1802.679) [-1804.338] (-1803.636) (-1807.019) -- 0:00:33 491500 -- [-1802.710] (-1803.086) (-1803.289) (-1802.529) * (-1802.322) (-1805.027) [-1803.700] (-1802.344) -- 0:00:33 492000 -- [-1807.149] (-1804.722) (-1802.409) (-1802.533) * [-1804.831] (-1804.078) (-1803.357) (-1803.757) -- 0:00:33 492500 -- (-1807.237) (-1802.066) [-1802.329] (-1802.580) * [-1804.591] (-1803.091) (-1803.167) (-1803.143) -- 0:00:32 493000 -- [-1801.956] (-1803.009) (-1802.188) (-1802.171) * (-1803.881) (-1806.200) (-1802.396) [-1804.221] -- 0:00:32 493500 -- (-1807.326) [-1802.867] (-1803.389) (-1801.818) * [-1803.804] (-1802.459) (-1803.134) (-1803.337) -- 0:00:32 494000 -- (-1804.011) (-1803.611) (-1805.999) [-1802.294] * [-1806.156] (-1802.313) (-1805.907) (-1804.729) -- 0:00:32 494500 -- [-1804.952] (-1807.244) (-1802.288) (-1804.224) * [-1804.651] (-1803.262) (-1806.872) (-1807.944) -- 0:00:33 495000 -- (-1802.137) (-1803.123) (-1805.638) [-1805.931] * [-1803.720] (-1805.761) (-1806.044) (-1807.209) -- 0:00:33 Average standard deviation of split frequencies: 0.009293 495500 -- (-1804.149) [-1803.407] (-1804.465) (-1804.467) * (-1805.545) (-1806.518) (-1803.914) [-1802.787] -- 0:00:33 496000 -- (-1802.918) (-1803.701) [-1805.796] (-1804.769) * (-1802.215) [-1803.667] (-1804.858) (-1805.539) -- 0:00:33 496500 -- (-1803.202) (-1804.218) [-1806.104] (-1803.204) * (-1803.763) (-1802.516) [-1801.617] (-1801.999) -- 0:00:33 497000 -- (-1805.452) (-1803.892) (-1805.760) [-1803.784] * (-1803.149) [-1802.491] (-1801.899) (-1802.001) -- 0:00:33 497500 -- (-1805.892) (-1803.126) [-1805.958] (-1806.439) * (-1804.603) [-1802.568] (-1802.488) (-1805.067) -- 0:00:33 498000 -- (-1804.257) (-1803.343) (-1804.971) [-1806.199] * (-1805.576) (-1802.499) (-1802.647) [-1806.372] -- 0:00:33 498500 -- [-1807.543] (-1804.567) (-1804.638) (-1803.814) * [-1802.607] (-1803.613) (-1806.280) (-1804.976) -- 0:00:33 499000 -- (-1807.616) [-1803.220] (-1804.444) (-1804.759) * (-1803.403) [-1805.156] (-1808.684) (-1805.275) -- 0:00:33 499500 -- (-1805.966) (-1802.497) [-1802.698] (-1804.308) * (-1803.454) (-1803.624) [-1804.588] (-1802.384) -- 0:00:33 500000 -- (-1803.640) [-1801.943] (-1803.342) (-1803.978) * (-1803.558) (-1802.148) (-1804.256) [-1801.653] -- 0:00:33 Average standard deviation of split frequencies: 0.009729 500500 -- (-1803.572) [-1807.213] (-1803.822) (-1805.435) * (-1806.091) (-1801.945) [-1802.485] (-1804.132) -- 0:00:32 501000 -- (-1805.074) (-1802.992) (-1802.999) [-1803.341] * [-1804.884] (-1802.229) (-1803.095) (-1809.716) -- 0:00:32 501500 -- (-1805.636) (-1803.685) (-1804.204) [-1803.798] * (-1804.882) [-1802.994] (-1802.088) (-1806.462) -- 0:00:32 502000 -- (-1803.355) [-1802.077] (-1803.153) (-1803.919) * [-1803.496] (-1802.112) (-1807.021) (-1808.012) -- 0:00:32 502500 -- (-1804.211) (-1804.941) [-1802.515] (-1802.458) * (-1802.285) [-1802.047] (-1804.137) (-1804.831) -- 0:00:32 503000 -- (-1805.370) (-1804.903) (-1803.874) [-1804.990] * (-1803.579) (-1802.222) (-1802.145) [-1802.573] -- 0:00:32 503500 -- (-1802.726) [-1803.372] (-1802.330) (-1812.213) * (-1807.987) (-1803.046) (-1802.524) [-1803.716] -- 0:00:32 504000 -- (-1806.695) [-1805.715] (-1805.813) (-1804.456) * (-1801.820) [-1803.313] (-1804.977) (-1802.753) -- 0:00:32 504500 -- (-1805.717) (-1804.192) [-1804.566] (-1807.654) * (-1802.137) [-1802.828] (-1805.340) (-1801.980) -- 0:00:32 505000 -- (-1804.975) (-1802.795) [-1805.051] (-1806.958) * [-1802.911] (-1807.072) (-1806.254) (-1804.991) -- 0:00:32 Average standard deviation of split frequencies: 0.009368 505500 -- (-1804.578) (-1803.369) (-1807.296) [-1804.170] * [-1806.150] (-1805.778) (-1805.765) (-1805.645) -- 0:00:32 506000 -- (-1802.758) (-1801.932) [-1803.084] (-1803.688) * (-1801.878) (-1811.554) [-1803.234] (-1805.508) -- 0:00:32 506500 -- [-1802.533] (-1809.918) (-1806.219) (-1803.581) * (-1802.151) (-1806.951) [-1806.111] (-1806.776) -- 0:00:32 507000 -- (-1803.065) (-1803.106) [-1802.601] (-1803.003) * [-1802.129] (-1806.725) (-1804.958) (-1805.613) -- 0:00:32 507500 -- [-1802.114] (-1803.721) (-1803.000) (-1802.536) * (-1803.700) [-1806.683] (-1803.784) (-1805.453) -- 0:00:32 508000 -- (-1803.854) (-1804.314) (-1804.405) [-1803.722] * (-1803.303) [-1802.714] (-1804.990) (-1803.611) -- 0:00:31 508500 -- (-1804.546) (-1806.431) (-1803.716) [-1806.744] * (-1806.533) (-1807.087) [-1802.826] (-1803.561) -- 0:00:31 509000 -- [-1801.773] (-1807.452) (-1803.506) (-1805.281) * (-1804.651) (-1805.167) [-1803.616] (-1804.617) -- 0:00:31 509500 -- (-1804.340) (-1804.014) [-1804.505] (-1805.725) * (-1805.290) (-1803.228) (-1808.655) [-1801.868] -- 0:00:31 510000 -- (-1807.246) (-1804.230) [-1803.053] (-1807.794) * (-1807.074) (-1807.337) (-1803.889) [-1802.432] -- 0:00:32 Average standard deviation of split frequencies: 0.009744 510500 -- (-1809.880) (-1805.285) [-1805.592] (-1804.053) * (-1802.382) (-1803.701) [-1802.206] (-1807.591) -- 0:00:32 511000 -- [-1804.680] (-1805.429) (-1805.331) (-1804.792) * (-1808.705) (-1804.471) [-1802.211] (-1802.296) -- 0:00:32 511500 -- [-1801.830] (-1804.995) (-1803.483) (-1803.964) * (-1803.927) (-1803.630) (-1803.983) [-1803.636] -- 0:00:32 512000 -- (-1802.477) (-1803.151) (-1802.848) [-1803.921] * (-1804.924) [-1801.763] (-1803.672) (-1801.636) -- 0:00:32 512500 -- (-1802.480) (-1806.392) [-1804.633] (-1806.713) * (-1803.234) (-1804.491) (-1804.085) [-1801.636] -- 0:00:32 513000 -- (-1802.549) [-1803.519] (-1807.210) (-1802.435) * (-1803.487) (-1803.484) (-1805.708) [-1803.491] -- 0:00:32 513500 -- (-1805.369) [-1805.621] (-1805.131) (-1803.185) * (-1803.813) (-1802.804) [-1804.048] (-1803.966) -- 0:00:32 514000 -- (-1803.869) (-1803.304) [-1803.859] (-1803.346) * (-1803.023) (-1804.144) [-1803.676] (-1803.870) -- 0:00:32 514500 -- (-1804.814) (-1803.457) [-1801.999] (-1806.159) * (-1802.363) (-1804.908) [-1803.610] (-1809.074) -- 0:00:32 515000 -- [-1802.777] (-1803.281) (-1801.794) (-1806.354) * (-1802.893) (-1804.393) [-1802.148] (-1807.938) -- 0:00:32 Average standard deviation of split frequencies: 0.009846 515500 -- [-1804.750] (-1806.005) (-1804.443) (-1809.240) * (-1804.060) (-1804.492) [-1803.937] (-1804.178) -- 0:00:31 516000 -- (-1804.112) [-1804.669] (-1804.503) (-1802.228) * (-1802.834) (-1805.180) (-1803.782) [-1802.425] -- 0:00:31 516500 -- (-1804.264) [-1803.242] (-1802.262) (-1803.566) * (-1804.712) (-1805.308) (-1803.716) [-1801.923] -- 0:00:31 517000 -- (-1802.431) (-1803.440) [-1802.722] (-1802.565) * (-1805.698) (-1804.174) (-1804.106) [-1801.786] -- 0:00:31 517500 -- (-1806.890) (-1803.429) [-1802.526] (-1804.687) * (-1808.809) (-1803.308) [-1804.757] (-1802.361) -- 0:00:31 518000 -- (-1811.031) [-1804.263] (-1805.588) (-1806.753) * [-1804.723] (-1803.454) (-1804.386) (-1806.442) -- 0:00:31 518500 -- (-1803.985) (-1807.323) [-1803.467] (-1807.633) * [-1806.419] (-1802.692) (-1807.135) (-1808.168) -- 0:00:31 519000 -- (-1803.670) [-1811.544] (-1804.873) (-1804.905) * (-1804.586) (-1802.899) (-1805.377) [-1807.256] -- 0:00:31 519500 -- (-1807.077) (-1804.673) (-1804.699) [-1803.159] * (-1804.692) (-1804.016) (-1804.211) [-1803.255] -- 0:00:31 520000 -- (-1805.660) [-1803.921] (-1803.628) (-1806.369) * (-1802.588) (-1804.598) (-1803.835) [-1802.657] -- 0:00:31 Average standard deviation of split frequencies: 0.009657 520500 -- (-1807.050) (-1803.736) (-1802.645) [-1804.547] * (-1802.382) (-1802.587) [-1802.237] (-1804.034) -- 0:00:31 521000 -- [-1805.505] (-1809.685) (-1811.095) (-1802.494) * (-1802.588) (-1803.790) [-1801.764] (-1802.917) -- 0:00:31 521500 -- (-1805.364) (-1803.012) (-1804.755) [-1802.699] * [-1804.591] (-1802.273) (-1801.733) (-1803.141) -- 0:00:31 522000 -- (-1803.466) (-1803.097) (-1804.560) [-1801.993] * [-1803.485] (-1802.260) (-1803.919) (-1802.220) -- 0:00:31 522500 -- (-1811.989) (-1804.331) [-1803.526] (-1802.458) * (-1803.908) (-1804.340) (-1803.032) [-1803.669] -- 0:00:31 523000 -- (-1805.479) (-1804.435) (-1803.941) [-1802.322] * [-1802.976] (-1805.193) (-1802.637) (-1803.534) -- 0:00:31 523500 -- (-1806.571) (-1801.950) (-1803.441) [-1802.084] * (-1804.868) [-1803.774] (-1803.659) (-1801.884) -- 0:00:30 524000 -- (-1806.806) (-1804.892) (-1803.725) [-1802.393] * [-1806.169] (-1805.821) (-1804.558) (-1801.945) -- 0:00:30 524500 -- [-1804.462] (-1806.367) (-1803.230) (-1802.420) * (-1808.281) [-1801.931] (-1802.210) (-1802.391) -- 0:00:30 525000 -- (-1805.428) [-1804.212] (-1803.559) (-1803.891) * (-1806.566) (-1803.132) [-1803.531] (-1802.418) -- 0:00:30 Average standard deviation of split frequencies: 0.009360 525500 -- [-1804.358] (-1802.801) (-1805.362) (-1805.105) * [-1804.305] (-1803.425) (-1805.238) (-1801.906) -- 0:00:31 526000 -- (-1803.784) (-1802.728) [-1802.729] (-1805.061) * (-1806.535) (-1802.363) [-1806.674] (-1802.987) -- 0:00:31 526500 -- (-1805.873) (-1804.214) [-1803.276] (-1805.654) * (-1806.441) [-1802.265] (-1804.258) (-1803.780) -- 0:00:31 527000 -- (-1802.912) [-1803.312] (-1804.062) (-1804.054) * (-1803.043) (-1805.627) [-1802.021] (-1807.210) -- 0:00:31 527500 -- (-1803.175) (-1802.956) [-1802.809] (-1805.983) * (-1802.368) (-1803.340) (-1804.884) [-1803.386] -- 0:00:31 528000 -- [-1804.385] (-1803.383) (-1803.154) (-1802.865) * (-1801.998) [-1803.328] (-1812.659) (-1803.576) -- 0:00:31 528500 -- (-1802.405) (-1807.144) (-1803.884) [-1805.899] * (-1802.825) [-1803.458] (-1807.564) (-1803.001) -- 0:00:31 529000 -- (-1804.465) (-1809.052) [-1803.305] (-1803.947) * (-1803.393) (-1806.203) (-1804.612) [-1803.000] -- 0:00:31 529500 -- (-1806.438) [-1805.472] (-1805.574) (-1803.733) * [-1809.497] (-1803.039) (-1805.466) (-1805.247) -- 0:00:31 530000 -- (-1803.880) [-1804.241] (-1804.593) (-1803.836) * (-1807.246) [-1803.309] (-1807.177) (-1804.736) -- 0:00:31 Average standard deviation of split frequencies: 0.009722 530500 -- (-1806.238) [-1802.047] (-1804.003) (-1813.561) * (-1808.676) (-1802.180) [-1804.375] (-1802.464) -- 0:00:30 531000 -- (-1811.815) [-1802.137] (-1805.004) (-1807.278) * [-1804.924] (-1802.514) (-1804.223) (-1805.190) -- 0:00:30 531500 -- (-1806.016) [-1802.264] (-1804.448) (-1803.483) * (-1802.464) [-1804.579] (-1804.370) (-1804.064) -- 0:00:30 532000 -- [-1806.172] (-1803.744) (-1803.726) (-1806.923) * (-1803.001) [-1803.134] (-1803.914) (-1803.337) -- 0:00:30 532500 -- (-1803.699) (-1801.971) (-1804.108) [-1802.745] * [-1803.992] (-1802.114) (-1805.652) (-1802.033) -- 0:00:30 533000 -- [-1802.144] (-1804.585) (-1803.845) (-1805.990) * [-1804.566] (-1802.988) (-1803.751) (-1802.615) -- 0:00:30 533500 -- (-1803.085) [-1803.290] (-1803.639) (-1806.247) * (-1803.035) [-1803.180] (-1802.866) (-1802.348) -- 0:00:30 534000 -- (-1804.022) (-1803.548) [-1803.929] (-1804.068) * [-1802.069] (-1804.596) (-1802.192) (-1805.551) -- 0:00:30 534500 -- [-1805.482] (-1803.784) (-1810.974) (-1803.651) * (-1802.620) (-1806.522) [-1802.741] (-1806.220) -- 0:00:30 535000 -- (-1804.349) (-1808.241) (-1806.459) [-1802.721] * [-1803.784] (-1804.741) (-1803.321) (-1806.001) -- 0:00:30 Average standard deviation of split frequencies: 0.009088 535500 -- (-1802.362) (-1803.017) [-1805.517] (-1803.461) * (-1804.098) [-1802.773] (-1803.168) (-1803.901) -- 0:00:30 536000 -- (-1802.551) (-1801.870) [-1805.131] (-1804.190) * (-1805.225) [-1804.156] (-1807.597) (-1801.989) -- 0:00:30 536500 -- (-1802.550) (-1802.278) [-1802.740] (-1803.761) * (-1806.507) (-1805.533) (-1804.674) [-1803.111] -- 0:00:30 537000 -- (-1803.682) (-1802.803) (-1804.902) [-1803.589] * (-1802.831) (-1804.616) [-1802.078] (-1802.610) -- 0:00:30 537500 -- (-1803.470) [-1801.987] (-1804.054) (-1804.248) * (-1803.660) (-1807.726) [-1802.391] (-1802.925) -- 0:00:30 538000 -- (-1803.151) (-1804.825) (-1806.924) [-1806.542] * (-1805.893) (-1805.272) [-1802.505] (-1803.358) -- 0:00:30 538500 -- (-1804.936) (-1803.194) [-1802.267] (-1802.568) * (-1807.944) (-1805.046) [-1806.106] (-1802.278) -- 0:00:29 539000 -- (-1803.390) (-1804.274) (-1804.344) [-1802.489] * [-1803.153] (-1806.984) (-1807.860) (-1806.333) -- 0:00:29 539500 -- (-1802.149) (-1803.755) [-1804.178] (-1807.075) * [-1806.039] (-1804.705) (-1807.437) (-1805.055) -- 0:00:29 540000 -- (-1803.427) (-1804.925) [-1804.727] (-1803.607) * (-1806.758) [-1805.183] (-1802.549) (-1804.077) -- 0:00:29 Average standard deviation of split frequencies: 0.009688 540500 -- (-1801.931) (-1806.288) (-1804.425) [-1804.669] * (-1806.550) [-1803.143] (-1802.705) (-1803.161) -- 0:00:29 541000 -- (-1802.960) (-1805.844) (-1804.302) [-1803.440] * (-1810.433) (-1803.411) [-1802.502] (-1803.560) -- 0:00:30 541500 -- (-1802.867) (-1802.832) [-1803.995] (-1802.613) * [-1806.801] (-1802.853) (-1802.983) (-1807.032) -- 0:00:30 542000 -- (-1802.995) (-1804.189) [-1804.662] (-1804.952) * (-1806.641) [-1802.402] (-1803.449) (-1810.943) -- 0:00:30 542500 -- (-1802.825) (-1803.590) (-1808.475) [-1804.184] * (-1803.256) [-1806.023] (-1806.245) (-1804.533) -- 0:00:30 543000 -- (-1801.746) (-1805.772) (-1806.533) [-1803.384] * (-1804.233) (-1802.654) (-1802.964) [-1805.226] -- 0:00:30 543500 -- (-1801.838) (-1804.802) [-1806.365] (-1804.425) * (-1805.797) (-1802.441) [-1802.936] (-1805.272) -- 0:00:30 544000 -- [-1802.353] (-1803.977) (-1804.458) (-1808.758) * (-1805.173) [-1803.539] (-1808.817) (-1802.776) -- 0:00:30 544500 -- [-1803.100] (-1803.694) (-1803.638) (-1806.116) * (-1802.049) [-1809.530] (-1802.852) (-1802.720) -- 0:00:30 545000 -- [-1804.171] (-1802.200) (-1802.299) (-1802.102) * (-1801.911) [-1806.191] (-1804.980) (-1806.090) -- 0:00:30 Average standard deviation of split frequencies: 0.009065 545500 -- [-1804.466] (-1808.763) (-1802.510) (-1804.006) * (-1804.105) [-1803.964] (-1804.153) (-1805.814) -- 0:00:29 546000 -- (-1804.977) (-1806.726) [-1802.548] (-1804.175) * (-1803.195) (-1802.833) [-1808.118] (-1805.937) -- 0:00:29 546500 -- (-1804.785) [-1807.277] (-1802.147) (-1803.579) * (-1802.767) (-1803.927) (-1807.591) [-1804.392] -- 0:00:29 547000 -- [-1803.890] (-1804.117) (-1802.835) (-1804.061) * [-1801.866] (-1804.333) (-1802.507) (-1804.547) -- 0:00:29 547500 -- (-1802.486) [-1804.859] (-1804.440) (-1802.812) * (-1803.039) (-1807.459) [-1802.378] (-1801.906) -- 0:00:29 548000 -- (-1808.339) [-1804.860] (-1803.323) (-1805.979) * (-1802.904) (-1805.527) [-1802.198] (-1802.582) -- 0:00:29 548500 -- (-1808.095) [-1803.828] (-1804.787) (-1804.283) * (-1803.184) (-1802.330) [-1803.579] (-1806.633) -- 0:00:29 549000 -- [-1805.222] (-1805.358) (-1804.676) (-1804.549) * [-1802.809] (-1803.111) (-1802.956) (-1803.872) -- 0:00:29 549500 -- [-1801.953] (-1805.604) (-1805.612) (-1804.088) * (-1804.074) [-1802.974] (-1802.766) (-1803.075) -- 0:00:29 550000 -- (-1802.435) [-1804.649] (-1805.699) (-1804.664) * (-1803.817) (-1802.675) (-1803.124) [-1802.036] -- 0:00:29 Average standard deviation of split frequencies: 0.008989 550500 -- (-1802.117) (-1807.024) (-1804.020) [-1807.238] * (-1803.808) [-1803.542] (-1803.480) (-1803.029) -- 0:00:29 551000 -- (-1803.681) [-1803.904] (-1803.459) (-1803.371) * (-1806.661) (-1803.845) (-1803.983) [-1802.015] -- 0:00:29 551500 -- (-1805.345) [-1802.991] (-1806.360) (-1805.766) * (-1805.423) (-1803.990) (-1803.569) [-1802.005] -- 0:00:29 552000 -- (-1803.505) (-1803.244) [-1805.502] (-1803.161) * (-1804.783) (-1804.594) (-1804.079) [-1802.220] -- 0:00:29 552500 -- (-1802.863) (-1802.545) (-1802.816) [-1803.995] * [-1805.029] (-1804.874) (-1803.736) (-1803.620) -- 0:00:29 553000 -- (-1801.687) [-1802.885] (-1805.292) (-1805.863) * (-1801.711) (-1806.050) (-1805.221) [-1802.906] -- 0:00:29 553500 -- (-1802.585) (-1801.688) [-1804.623] (-1804.244) * (-1802.393) (-1802.692) [-1804.758] (-1803.697) -- 0:00:29 554000 -- (-1805.629) (-1803.114) (-1803.535) [-1808.072] * [-1804.331] (-1802.474) (-1805.600) (-1806.473) -- 0:00:28 554500 -- (-1807.408) [-1806.542] (-1804.764) (-1803.265) * (-1805.609) (-1802.159) (-1808.269) [-1805.623] -- 0:00:28 555000 -- [-1803.311] (-1802.216) (-1805.356) (-1804.217) * (-1804.263) (-1808.588) [-1803.662] (-1805.355) -- 0:00:28 Average standard deviation of split frequencies: 0.008337 555500 -- (-1804.243) (-1804.856) [-1804.193] (-1804.216) * (-1803.418) (-1807.370) (-1803.062) [-1806.813] -- 0:00:28 556000 -- (-1805.573) (-1805.335) [-1802.837] (-1803.553) * (-1804.067) [-1805.443] (-1805.503) (-1802.184) -- 0:00:28 556500 -- (-1812.984) (-1810.726) (-1803.544) [-1803.561] * (-1804.664) [-1802.209] (-1805.124) (-1802.073) -- 0:00:29 557000 -- (-1805.650) [-1805.495] (-1803.458) (-1803.114) * [-1802.500] (-1811.150) (-1804.490) (-1807.962) -- 0:00:29 557500 -- (-1808.726) [-1808.538] (-1803.419) (-1805.786) * (-1804.533) (-1804.151) [-1805.389] (-1805.145) -- 0:00:29 558000 -- (-1802.671) (-1804.237) (-1803.463) [-1802.739] * (-1805.060) (-1802.920) [-1802.994] (-1803.626) -- 0:00:29 558500 -- (-1802.763) (-1804.799) [-1803.417] (-1807.858) * (-1806.510) [-1804.205] (-1802.924) (-1802.032) -- 0:00:29 559000 -- (-1802.919) (-1803.932) (-1802.787) [-1804.043] * (-1803.639) (-1802.963) [-1802.415] (-1808.276) -- 0:00:29 559500 -- (-1807.275) [-1804.045] (-1802.004) (-1803.748) * (-1804.051) (-1803.028) (-1802.728) [-1805.217] -- 0:00:29 560000 -- (-1804.707) (-1803.012) [-1802.079] (-1803.137) * (-1802.931) [-1802.547] (-1802.752) (-1805.550) -- 0:00:29 Average standard deviation of split frequencies: 0.008455 560500 -- [-1802.908] (-1805.777) (-1805.576) (-1803.052) * (-1802.898) (-1802.281) [-1806.215] (-1804.384) -- 0:00:29 561000 -- (-1804.200) [-1803.325] (-1803.636) (-1802.749) * (-1802.302) (-1801.961) (-1805.161) [-1806.860] -- 0:00:28 561500 -- (-1807.635) (-1802.907) (-1804.313) [-1802.750] * (-1802.389) (-1802.595) [-1803.592] (-1805.248) -- 0:00:28 562000 -- [-1802.764] (-1802.285) (-1807.162) (-1802.564) * (-1806.540) (-1802.380) [-1802.327] (-1803.471) -- 0:00:28 562500 -- (-1801.811) (-1801.988) (-1803.374) [-1804.938] * (-1804.172) (-1804.694) [-1804.053] (-1802.675) -- 0:00:28 563000 -- (-1802.425) (-1803.072) [-1810.696] (-1803.923) * (-1804.446) (-1804.311) [-1802.832] (-1804.272) -- 0:00:28 563500 -- (-1802.978) [-1803.336] (-1803.884) (-1803.990) * [-1805.103] (-1805.847) (-1802.683) (-1803.416) -- 0:00:28 564000 -- (-1803.633) (-1802.534) (-1806.043) [-1802.256] * [-1803.204] (-1805.130) (-1806.278) (-1804.414) -- 0:00:28 564500 -- (-1803.032) [-1801.989] (-1804.027) (-1802.611) * [-1806.068] (-1804.556) (-1806.524) (-1806.941) -- 0:00:28 565000 -- (-1804.192) (-1806.607) [-1806.478] (-1802.747) * (-1801.704) [-1803.418] (-1803.552) (-1807.844) -- 0:00:28 Average standard deviation of split frequencies: 0.008699 565500 -- (-1802.912) (-1801.751) (-1803.748) [-1802.559] * (-1803.037) [-1803.594] (-1803.211) (-1806.388) -- 0:00:28 566000 -- (-1804.578) (-1803.394) (-1804.502) [-1803.618] * (-1805.359) (-1801.787) (-1804.460) [-1805.704] -- 0:00:28 566500 -- (-1804.193) (-1804.452) [-1806.123] (-1803.104) * [-1804.475] (-1804.355) (-1807.348) (-1804.831) -- 0:00:28 567000 -- (-1803.622) (-1803.951) (-1803.410) [-1804.311] * (-1805.990) (-1802.914) [-1803.125] (-1805.023) -- 0:00:28 567500 -- (-1803.131) [-1804.046] (-1803.113) (-1803.162) * (-1806.075) [-1801.829] (-1804.819) (-1803.675) -- 0:00:28 568000 -- (-1803.458) (-1802.728) [-1802.834] (-1803.874) * (-1803.637) [-1802.308] (-1805.983) (-1803.675) -- 0:00:28 568500 -- (-1806.163) [-1802.857] (-1807.772) (-1802.583) * [-1803.602] (-1802.721) (-1802.996) (-1803.160) -- 0:00:28 569000 -- (-1802.409) (-1805.552) [-1804.883] (-1807.279) * [-1808.127] (-1803.815) (-1803.262) (-1802.778) -- 0:00:28 569500 -- [-1806.361] (-1804.567) (-1807.462) (-1802.400) * (-1808.304) (-1803.897) (-1804.678) [-1803.265] -- 0:00:27 570000 -- [-1804.618] (-1803.983) (-1804.716) (-1802.814) * [-1804.227] (-1803.991) (-1807.802) (-1803.600) -- 0:00:27 Average standard deviation of split frequencies: 0.008628 570500 -- (-1804.115) (-1805.422) (-1803.771) [-1803.189] * (-1803.430) (-1804.497) [-1805.530] (-1802.138) -- 0:00:27 571000 -- (-1807.577) (-1804.084) (-1802.066) [-1805.699] * (-1802.991) (-1812.309) [-1802.555] (-1802.600) -- 0:00:27 571500 -- (-1806.710) (-1804.079) [-1802.247] (-1807.629) * (-1810.543) (-1805.881) (-1806.957) [-1804.094] -- 0:00:27 572000 -- [-1804.827] (-1805.020) (-1804.786) (-1806.628) * [-1805.183] (-1804.473) (-1806.560) (-1804.836) -- 0:00:28 572500 -- (-1803.065) (-1804.739) [-1802.341] (-1811.953) * [-1802.751] (-1802.801) (-1802.579) (-1806.815) -- 0:00:28 573000 -- (-1806.753) [-1807.115] (-1802.111) (-1803.257) * (-1802.126) [-1804.141] (-1802.009) (-1802.010) -- 0:00:28 573500 -- (-1802.886) [-1806.458] (-1803.295) (-1803.091) * [-1802.100] (-1803.983) (-1804.632) (-1803.085) -- 0:00:28 574000 -- (-1802.252) (-1806.266) (-1803.275) [-1802.412] * (-1801.923) (-1804.035) (-1802.981) [-1802.865] -- 0:00:28 574500 -- (-1801.440) (-1808.903) (-1806.131) [-1803.994] * [-1804.189] (-1803.216) (-1803.943) (-1801.665) -- 0:00:28 575000 -- [-1804.324] (-1805.425) (-1805.837) (-1806.655) * [-1804.187] (-1804.438) (-1804.859) (-1801.957) -- 0:00:28 Average standard deviation of split frequencies: 0.008457 575500 -- (-1803.958) (-1805.356) [-1805.875] (-1806.095) * [-1804.160] (-1805.210) (-1809.475) (-1804.610) -- 0:00:28 576000 -- (-1803.546) (-1803.789) [-1803.919] (-1806.532) * (-1803.845) [-1805.360] (-1808.554) (-1804.059) -- 0:00:27 576500 -- (-1804.382) (-1802.771) (-1803.992) [-1803.272] * (-1806.530) (-1802.410) (-1806.372) [-1802.588] -- 0:00:27 577000 -- (-1804.379) (-1802.134) (-1803.348) [-1804.390] * (-1803.835) (-1803.321) [-1807.785] (-1802.946) -- 0:00:27 577500 -- [-1803.003] (-1801.917) (-1803.665) (-1802.717) * (-1803.537) (-1803.705) [-1804.109] (-1802.578) -- 0:00:27 578000 -- [-1803.656] (-1803.043) (-1804.486) (-1802.786) * (-1809.180) (-1803.950) (-1802.594) [-1802.766] -- 0:00:27 578500 -- (-1802.490) [-1802.284] (-1804.070) (-1804.675) * (-1805.076) (-1802.765) (-1802.601) [-1802.786] -- 0:00:27 579000 -- (-1802.511) (-1807.937) (-1805.715) [-1801.881] * (-1805.293) (-1803.168) (-1803.119) [-1802.322] -- 0:00:27 579500 -- (-1802.459) (-1805.937) (-1808.537) [-1801.940] * (-1803.813) (-1803.558) [-1804.096] (-1802.960) -- 0:00:27 580000 -- [-1802.673] (-1804.001) (-1804.683) (-1802.020) * (-1802.955) (-1803.940) [-1802.502] (-1802.785) -- 0:00:27 Average standard deviation of split frequencies: 0.008344 580500 -- (-1803.023) (-1804.246) [-1802.964] (-1802.013) * [-1803.147] (-1806.764) (-1802.283) (-1802.226) -- 0:00:27 581000 -- [-1802.488] (-1802.255) (-1804.646) (-1803.225) * (-1807.720) (-1804.727) (-1803.265) [-1803.382] -- 0:00:27 581500 -- (-1806.955) (-1802.111) (-1805.113) [-1803.185] * (-1807.502) (-1806.586) [-1805.914] (-1802.029) -- 0:00:27 582000 -- (-1813.598) [-1803.765] (-1803.152) (-1808.178) * (-1801.997) (-1805.976) (-1803.721) [-1801.701] -- 0:00:27 582500 -- (-1801.570) [-1802.488] (-1803.141) (-1807.101) * (-1802.567) (-1804.337) (-1803.110) [-1802.477] -- 0:00:27 583000 -- (-1801.570) [-1804.892] (-1804.082) (-1805.587) * (-1804.240) (-1804.324) (-1807.061) [-1802.568] -- 0:00:27 583500 -- (-1804.582) (-1802.328) [-1804.052] (-1807.466) * (-1804.593) [-1803.484] (-1807.194) (-1802.568) -- 0:00:27 584000 -- (-1804.967) [-1802.759] (-1803.786) (-1805.507) * (-1808.797) (-1804.444) (-1804.760) [-1804.689] -- 0:00:27 584500 -- (-1804.286) [-1803.653] (-1804.849) (-1805.303) * (-1803.022) (-1804.063) [-1804.492] (-1804.359) -- 0:00:27 585000 -- [-1805.856] (-1804.822) (-1804.919) (-1802.224) * (-1801.767) (-1802.369) (-1801.678) [-1803.967] -- 0:00:26 Average standard deviation of split frequencies: 0.008581 585500 -- (-1808.558) (-1806.066) [-1804.320] (-1805.464) * (-1804.007) (-1802.747) (-1803.143) [-1804.866] -- 0:00:26 586000 -- [-1812.259] (-1803.980) (-1803.550) (-1803.014) * (-1804.762) [-1806.401] (-1805.911) (-1802.132) -- 0:00:26 586500 -- (-1809.354) (-1804.552) [-1802.055] (-1803.096) * [-1803.414] (-1805.012) (-1803.331) (-1807.376) -- 0:00:27 587000 -- (-1805.245) (-1807.257) (-1806.248) [-1802.321] * (-1807.006) [-1804.248] (-1802.398) (-1807.534) -- 0:00:27 587500 -- (-1804.906) (-1808.366) [-1807.648] (-1805.454) * [-1803.640] (-1804.141) (-1802.843) (-1810.336) -- 0:00:27 588000 -- (-1804.173) (-1802.932) (-1805.273) [-1802.902] * (-1804.877) [-1802.646] (-1806.135) (-1809.483) -- 0:00:27 588500 -- (-1805.432) [-1803.052] (-1804.753) (-1803.090) * (-1804.039) [-1802.061] (-1803.934) (-1806.235) -- 0:00:27 589000 -- (-1805.508) [-1809.437] (-1802.106) (-1803.279) * (-1806.216) (-1802.909) [-1805.231] (-1805.397) -- 0:00:27 589500 -- (-1804.135) (-1802.507) [-1804.084] (-1804.397) * (-1810.430) (-1804.355) [-1803.833] (-1803.447) -- 0:00:27 590000 -- (-1807.056) (-1802.952) (-1804.647) [-1803.167] * [-1804.795] (-1802.843) (-1806.720) (-1808.175) -- 0:00:27 Average standard deviation of split frequencies: 0.007464 590500 -- (-1806.313) [-1802.952] (-1802.867) (-1803.126) * (-1804.232) (-1804.617) (-1805.003) [-1808.596] -- 0:00:27 591000 -- [-1807.661] (-1803.588) (-1804.815) (-1808.818) * (-1803.833) (-1804.026) (-1806.218) [-1805.554] -- 0:00:26 591500 -- (-1805.960) [-1809.228] (-1803.459) (-1803.317) * (-1804.505) [-1802.838] (-1806.342) (-1803.394) -- 0:00:26 592000 -- (-1805.504) (-1808.360) [-1802.968] (-1804.533) * (-1806.748) (-1805.333) (-1804.071) [-1802.892] -- 0:00:26 592500 -- (-1803.181) (-1802.967) (-1807.757) [-1806.021] * [-1806.492] (-1805.936) (-1807.450) (-1802.265) -- 0:00:26 593000 -- (-1804.832) (-1806.792) [-1807.178] (-1806.586) * (-1804.022) [-1803.174] (-1808.678) (-1808.420) -- 0:00:26 593500 -- (-1803.484) (-1804.986) (-1803.924) [-1802.791] * (-1803.792) [-1803.773] (-1804.078) (-1809.999) -- 0:00:26 594000 -- (-1806.250) (-1802.382) (-1803.241) [-1802.728] * (-1802.753) (-1802.042) (-1804.587) [-1806.795] -- 0:00:26 594500 -- (-1802.835) (-1802.435) [-1803.175] (-1803.967) * (-1808.363) (-1802.428) (-1803.649) [-1802.529] -- 0:00:26 595000 -- (-1805.246) [-1803.463] (-1802.390) (-1806.446) * (-1802.794) [-1803.235] (-1805.399) (-1802.442) -- 0:00:26 Average standard deviation of split frequencies: 0.008173 595500 -- (-1805.013) (-1803.358) [-1804.159] (-1808.369) * [-1802.623] (-1810.747) (-1804.103) (-1810.081) -- 0:00:26 596000 -- (-1805.792) (-1807.193) (-1801.652) [-1804.438] * [-1803.026] (-1806.500) (-1806.097) (-1803.160) -- 0:00:26 596500 -- (-1806.488) [-1803.813] (-1802.179) (-1807.430) * (-1804.777) (-1804.219) (-1801.899) [-1802.506] -- 0:00:26 597000 -- (-1806.714) [-1804.300] (-1801.739) (-1803.251) * (-1804.104) (-1805.321) [-1801.833] (-1804.670) -- 0:00:26 597500 -- (-1802.395) (-1806.698) (-1801.984) [-1802.024] * [-1804.232] (-1804.357) (-1801.833) (-1805.425) -- 0:00:26 598000 -- [-1802.749] (-1806.919) (-1802.017) (-1803.575) * (-1808.116) (-1804.515) (-1805.364) [-1803.601] -- 0:00:26 598500 -- (-1802.941) [-1802.642] (-1802.161) (-1804.192) * (-1803.543) [-1804.284] (-1802.757) (-1805.062) -- 0:00:26 599000 -- (-1805.421) (-1801.939) [-1802.749] (-1804.525) * (-1802.661) (-1804.210) (-1802.935) [-1803.316] -- 0:00:26 599500 -- (-1807.250) (-1801.869) [-1802.690] (-1804.434) * (-1802.480) (-1809.263) (-1802.120) [-1805.546] -- 0:00:26 600000 -- (-1802.526) [-1802.339] (-1803.516) (-1803.765) * (-1802.206) [-1808.881] (-1806.548) (-1802.598) -- 0:00:25 Average standard deviation of split frequencies: 0.007848 600500 -- (-1803.898) (-1805.995) (-1803.478) [-1803.187] * (-1805.448) [-1805.172] (-1803.581) (-1802.888) -- 0:00:25 601000 -- (-1803.340) (-1804.066) (-1803.302) [-1802.143] * (-1805.658) (-1805.256) [-1803.232] (-1805.081) -- 0:00:25 601500 -- (-1804.527) (-1803.073) (-1802.940) [-1803.225] * (-1806.010) [-1803.084] (-1802.898) (-1802.779) -- 0:00:25 602000 -- (-1803.768) (-1803.167) [-1802.627] (-1803.923) * [-1803.414] (-1802.991) (-1807.160) (-1801.744) -- 0:00:26 602500 -- (-1805.786) [-1803.425] (-1803.649) (-1805.758) * (-1804.882) [-1802.293] (-1803.699) (-1805.931) -- 0:00:26 603000 -- [-1802.562] (-1803.232) (-1806.533) (-1805.893) * (-1807.565) [-1805.165] (-1803.319) (-1803.402) -- 0:00:26 603500 -- (-1803.429) (-1803.869) (-1803.551) [-1803.754] * (-1809.456) (-1805.158) [-1803.339] (-1803.324) -- 0:00:26 604000 -- (-1804.651) (-1802.696) [-1803.861] (-1804.818) * (-1805.093) (-1805.330) (-1802.659) [-1804.694] -- 0:00:26 604500 -- (-1808.636) [-1802.911] (-1803.066) (-1806.203) * (-1805.091) (-1806.195) [-1802.400] (-1804.600) -- 0:00:26 605000 -- (-1803.244) [-1804.021] (-1804.912) (-1803.064) * [-1807.996] (-1810.279) (-1803.881) (-1804.079) -- 0:00:26 Average standard deviation of split frequencies: 0.007733 605500 -- (-1804.954) (-1803.258) (-1805.011) [-1804.219] * [-1803.520] (-1808.841) (-1802.405) (-1805.426) -- 0:00:26 606000 -- (-1802.394) (-1803.891) (-1803.419) [-1803.600] * (-1804.140) (-1809.203) (-1806.139) [-1806.169] -- 0:00:26 606500 -- (-1802.767) (-1802.911) (-1805.432) [-1802.656] * [-1804.767] (-1807.697) (-1804.402) (-1805.015) -- 0:00:25 607000 -- (-1804.491) [-1802.443] (-1803.515) (-1802.640) * (-1803.249) [-1804.485] (-1803.275) (-1802.864) -- 0:00:25 607500 -- (-1804.136) (-1803.776) [-1803.123] (-1801.923) * (-1802.479) [-1803.249] (-1803.356) (-1803.706) -- 0:00:25 608000 -- (-1804.185) (-1804.619) (-1803.009) [-1802.962] * (-1803.177) (-1802.732) (-1803.665) [-1802.484] -- 0:00:25 608500 -- (-1804.866) (-1804.361) [-1802.979] (-1804.234) * [-1804.876] (-1804.386) (-1802.343) (-1803.033) -- 0:00:25 609000 -- [-1802.283] (-1804.225) (-1802.765) (-1804.262) * [-1802.216] (-1802.532) (-1803.360) (-1803.022) -- 0:00:25 609500 -- (-1807.591) (-1806.711) [-1802.860] (-1802.663) * [-1802.638] (-1801.954) (-1803.786) (-1803.230) -- 0:00:25 610000 -- [-1802.510] (-1807.837) (-1802.468) (-1804.096) * (-1804.155) (-1802.533) [-1802.884] (-1803.469) -- 0:00:25 Average standard deviation of split frequencies: 0.007720 610500 -- (-1804.217) (-1802.471) [-1802.345] (-1804.186) * [-1802.896] (-1802.533) (-1807.809) (-1804.430) -- 0:00:25 611000 -- (-1803.954) (-1804.876) [-1802.319] (-1806.545) * [-1805.955] (-1804.232) (-1804.636) (-1805.185) -- 0:00:25 611500 -- (-1804.195) [-1803.451] (-1802.514) (-1804.625) * [-1805.780] (-1802.430) (-1802.870) (-1804.899) -- 0:00:25 612000 -- [-1806.620] (-1801.681) (-1801.972) (-1803.896) * (-1807.460) [-1805.792] (-1802.870) (-1804.323) -- 0:00:25 612500 -- (-1804.760) (-1802.302) (-1802.370) [-1803.851] * (-1803.948) (-1805.977) (-1802.519) [-1803.890] -- 0:00:25 613000 -- [-1807.502] (-1802.147) (-1805.589) (-1803.265) * (-1805.789) (-1804.204) [-1806.781] (-1802.875) -- 0:00:25 613500 -- (-1802.990) [-1802.120] (-1803.942) (-1802.381) * (-1805.601) (-1805.360) (-1805.349) [-1803.378] -- 0:00:25 614000 -- [-1802.734] (-1801.558) (-1803.290) (-1802.762) * [-1808.697] (-1805.620) (-1802.633) (-1803.299) -- 0:00:25 614500 -- (-1804.054) (-1802.112) [-1802.006] (-1808.350) * (-1804.173) (-1804.726) (-1804.502) [-1803.223] -- 0:00:25 615000 -- (-1803.475) (-1802.103) [-1802.358] (-1803.068) * (-1804.035) (-1804.694) [-1805.938] (-1803.754) -- 0:00:25 Average standard deviation of split frequencies: 0.007844 615500 -- (-1804.063) (-1804.493) [-1802.708] (-1803.712) * [-1804.664] (-1803.663) (-1804.237) (-1803.373) -- 0:00:24 616000 -- (-1803.670) (-1803.786) [-1803.833] (-1804.796) * (-1802.284) (-1805.152) (-1805.347) [-1803.103] -- 0:00:24 616500 -- [-1805.016] (-1801.500) (-1804.621) (-1806.216) * [-1802.912] (-1802.382) (-1805.921) (-1804.663) -- 0:00:24 617000 -- (-1806.038) [-1801.921] (-1803.898) (-1805.907) * (-1807.271) (-1802.987) (-1803.795) [-1805.011] -- 0:00:24 617500 -- (-1806.474) [-1802.268] (-1804.379) (-1802.793) * [-1814.247] (-1804.072) (-1804.672) (-1804.820) -- 0:00:25 618000 -- (-1804.883) (-1805.726) (-1803.350) [-1805.247] * (-1809.229) (-1802.512) [-1804.382] (-1806.379) -- 0:00:25 618500 -- (-1804.493) (-1804.151) [-1802.662] (-1802.920) * (-1804.112) (-1802.852) [-1804.580] (-1803.693) -- 0:00:25 619000 -- (-1804.501) (-1802.815) [-1802.595] (-1807.970) * [-1802.516] (-1803.867) (-1802.765) (-1805.390) -- 0:00:25 619500 -- (-1806.698) (-1803.403) (-1808.613) [-1804.609] * (-1803.952) (-1802.105) [-1802.643] (-1808.404) -- 0:00:25 620000 -- (-1804.022) (-1802.844) [-1803.248] (-1803.476) * (-1806.704) (-1802.105) (-1802.814) [-1807.900] -- 0:00:25 Average standard deviation of split frequencies: 0.008489 620500 -- (-1802.545) [-1805.604] (-1803.232) (-1805.046) * (-1804.224) [-1804.558] (-1802.236) (-1802.950) -- 0:00:25 621000 -- (-1801.705) (-1806.007) (-1802.861) [-1806.517] * (-1805.148) (-1805.333) [-1802.236] (-1805.280) -- 0:00:25 621500 -- (-1803.083) [-1803.343] (-1807.384) (-1802.317) * (-1808.721) [-1803.291] (-1804.159) (-1806.609) -- 0:00:24 622000 -- [-1804.677] (-1803.541) (-1809.571) (-1803.660) * (-1808.285) (-1802.529) [-1804.100] (-1802.756) -- 0:00:24 622500 -- [-1806.758] (-1806.005) (-1809.477) (-1802.711) * (-1806.913) (-1803.745) [-1802.905] (-1804.516) -- 0:00:24 623000 -- [-1802.663] (-1803.757) (-1804.393) (-1803.873) * (-1804.848) (-1804.453) [-1804.963] (-1803.766) -- 0:00:24 623500 -- (-1804.696) [-1803.703] (-1804.076) (-1802.590) * (-1802.441) (-1803.557) (-1805.417) [-1802.729] -- 0:00:24 624000 -- (-1803.076) (-1804.624) [-1802.289] (-1802.932) * (-1803.787) (-1805.695) [-1802.608] (-1804.486) -- 0:00:24 624500 -- (-1803.444) (-1801.848) (-1806.138) [-1802.038] * [-1802.368] (-1807.774) (-1802.478) (-1802.716) -- 0:00:24 625000 -- [-1803.500] (-1803.709) (-1802.574) (-1802.440) * [-1802.757] (-1803.597) (-1803.121) (-1806.186) -- 0:00:24 Average standard deviation of split frequencies: 0.008549 625500 -- (-1801.830) (-1803.709) (-1805.552) [-1804.510] * (-1804.219) [-1803.189] (-1802.442) (-1803.025) -- 0:00:24 626000 -- (-1801.821) (-1805.885) [-1804.905] (-1802.493) * (-1802.777) [-1803.412] (-1803.341) (-1805.250) -- 0:00:24 626500 -- [-1801.915] (-1803.962) (-1808.263) (-1804.142) * (-1805.569) [-1802.239] (-1803.347) (-1803.935) -- 0:00:24 627000 -- (-1804.017) (-1807.894) [-1803.959] (-1804.106) * (-1806.213) [-1804.498] (-1803.055) (-1804.546) -- 0:00:24 627500 -- (-1803.645) [-1804.403] (-1804.559) (-1804.842) * (-1805.407) (-1805.365) [-1803.021] (-1803.055) -- 0:00:24 628000 -- (-1802.100) (-1805.109) (-1805.579) [-1802.039] * (-1808.491) (-1804.768) (-1803.795) [-1805.666] -- 0:00:24 628500 -- (-1802.579) (-1804.777) [-1804.820] (-1805.074) * (-1806.061) [-1803.005] (-1805.041) (-1803.580) -- 0:00:24 629000 -- (-1804.047) (-1804.991) [-1804.307] (-1804.013) * (-1806.251) (-1802.937) (-1808.916) [-1804.707] -- 0:00:24 629500 -- (-1802.726) [-1802.422] (-1802.758) (-1802.631) * (-1805.215) [-1803.274] (-1802.731) (-1806.525) -- 0:00:24 630000 -- (-1803.460) [-1802.098] (-1810.360) (-1803.214) * (-1802.491) [-1802.250] (-1804.497) (-1806.323) -- 0:00:24 Average standard deviation of split frequencies: 0.008970 630500 -- (-1802.223) [-1806.705] (-1811.807) (-1804.668) * (-1805.019) [-1805.213] (-1807.547) (-1804.869) -- 0:00:24 631000 -- [-1804.780] (-1804.448) (-1811.157) (-1802.551) * [-1806.695] (-1806.739) (-1803.468) (-1803.990) -- 0:00:23 631500 -- [-1803.219] (-1806.272) (-1802.969) (-1803.813) * (-1803.223) (-1803.434) [-1803.767] (-1805.921) -- 0:00:23 632000 -- [-1802.697] (-1804.311) (-1804.278) (-1806.277) * (-1802.602) (-1806.228) [-1807.879] (-1806.091) -- 0:00:23 632500 -- (-1803.060) (-1802.742) (-1805.367) [-1808.460] * (-1803.106) (-1802.588) (-1806.731) [-1802.379] -- 0:00:23 633000 -- (-1802.846) [-1803.415] (-1805.842) (-1803.984) * (-1803.211) (-1803.406) [-1803.814] (-1802.986) -- 0:00:24 633500 -- (-1806.761) [-1803.112] (-1803.842) (-1803.946) * (-1802.780) (-1803.627) [-1804.840] (-1803.336) -- 0:00:24 634000 -- (-1805.145) (-1802.977) [-1805.315] (-1806.472) * (-1804.721) (-1803.918) [-1803.885] (-1803.646) -- 0:00:24 634500 -- (-1804.563) [-1806.810] (-1807.045) (-1804.201) * (-1808.965) [-1803.357] (-1804.039) (-1804.325) -- 0:00:24 635000 -- (-1805.699) (-1804.143) [-1802.091] (-1805.461) * (-1802.796) (-1802.092) [-1804.015] (-1803.888) -- 0:00:24 Average standard deviation of split frequencies: 0.008764 635500 -- (-1803.106) (-1807.498) (-1803.053) [-1805.708] * (-1802.618) [-1802.445] (-1811.503) (-1803.215) -- 0:00:24 636000 -- (-1808.282) [-1805.411] (-1802.161) (-1803.615) * [-1801.955] (-1802.848) (-1806.258) (-1802.355) -- 0:00:24 636500 -- (-1806.960) (-1802.588) (-1802.161) [-1803.971] * (-1805.366) (-1803.220) (-1804.327) [-1806.171] -- 0:00:23 637000 -- (-1801.942) (-1802.302) (-1802.325) [-1804.289] * (-1806.102) (-1805.132) [-1803.328] (-1806.011) -- 0:00:23 637500 -- (-1809.706) [-1804.510] (-1802.917) (-1804.424) * (-1802.906) (-1805.132) [-1802.462] (-1802.490) -- 0:00:23 638000 -- (-1802.200) [-1802.196] (-1802.445) (-1804.737) * (-1802.283) [-1804.490] (-1808.424) (-1805.097) -- 0:00:23 638500 -- [-1802.723] (-1803.680) (-1802.648) (-1809.110) * (-1805.966) (-1805.626) (-1803.677) [-1806.975] -- 0:00:23 639000 -- (-1801.980) (-1804.719) [-1803.534] (-1810.067) * (-1802.773) (-1803.332) (-1802.348) [-1803.274] -- 0:00:23 639500 -- [-1802.145] (-1801.977) (-1802.942) (-1803.122) * (-1804.133) [-1802.217] (-1803.488) (-1802.177) -- 0:00:23 640000 -- (-1803.626) (-1803.130) (-1803.186) [-1803.419] * (-1802.227) (-1802.361) (-1807.036) [-1802.283] -- 0:00:23 Average standard deviation of split frequencies: 0.008397 640500 -- (-1807.782) [-1803.166] (-1804.388) (-1803.769) * (-1802.208) (-1805.093) (-1803.487) [-1802.235] -- 0:00:23 641000 -- (-1804.961) (-1804.630) (-1803.067) [-1804.228] * (-1802.967) (-1803.430) [-1803.485] (-1802.273) -- 0:00:23 641500 -- [-1801.797] (-1806.430) (-1806.999) (-1803.992) * (-1803.483) [-1802.263] (-1801.927) (-1802.900) -- 0:00:23 642000 -- [-1801.842] (-1804.899) (-1806.551) (-1802.419) * [-1804.890] (-1802.750) (-1805.575) (-1802.926) -- 0:00:23 642500 -- (-1803.844) (-1805.565) (-1802.339) [-1802.302] * (-1802.478) (-1803.235) (-1804.085) [-1803.184] -- 0:00:23 643000 -- [-1802.447] (-1806.387) (-1806.103) (-1803.568) * [-1805.720] (-1805.043) (-1804.518) (-1803.214) -- 0:00:23 643500 -- (-1803.914) [-1804.014] (-1804.589) (-1803.865) * (-1803.479) [-1802.578] (-1806.169) (-1802.332) -- 0:00:23 644000 -- (-1806.212) [-1804.610] (-1803.245) (-1803.874) * [-1810.827] (-1802.920) (-1807.828) (-1804.659) -- 0:00:23 644500 -- (-1804.560) [-1805.740] (-1804.647) (-1806.185) * (-1804.997) [-1806.633] (-1803.005) (-1803.913) -- 0:00:23 645000 -- [-1802.815] (-1803.903) (-1805.116) (-1806.013) * (-1808.825) (-1803.575) [-1804.261] (-1803.243) -- 0:00:23 Average standard deviation of split frequencies: 0.008878 645500 -- (-1803.314) [-1806.575] (-1803.856) (-1804.196) * (-1803.281) [-1806.329] (-1803.336) (-1802.483) -- 0:00:23 646000 -- (-1802.975) (-1805.331) [-1804.144] (-1802.539) * (-1803.860) (-1804.059) [-1803.783] (-1803.495) -- 0:00:23 646500 -- (-1802.439) (-1807.296) (-1804.193) [-1804.306] * (-1804.008) (-1804.317) (-1805.129) [-1802.865] -- 0:00:22 647000 -- (-1801.823) [-1802.566] (-1802.202) (-1805.024) * [-1802.588] (-1805.506) (-1806.000) (-1802.050) -- 0:00:22 647500 -- (-1802.244) [-1802.952] (-1802.265) (-1803.094) * (-1802.002) (-1803.097) (-1804.427) [-1801.867] -- 0:00:22 648000 -- [-1803.358] (-1803.003) (-1802.265) (-1803.104) * [-1803.596] (-1803.027) (-1803.299) (-1802.272) -- 0:00:22 648500 -- [-1802.988] (-1803.892) (-1803.902) (-1808.098) * (-1804.115) (-1803.658) [-1801.624] (-1802.699) -- 0:00:23 649000 -- (-1807.476) (-1804.292) [-1803.931] (-1803.982) * (-1802.463) (-1803.120) [-1810.496] (-1807.855) -- 0:00:23 649500 -- (-1807.626) [-1804.514] (-1805.462) (-1803.754) * (-1805.421) (-1803.182) [-1801.826] (-1810.422) -- 0:00:23 650000 -- (-1804.109) (-1804.083) (-1801.816) [-1802.521] * (-1802.723) (-1802.334) [-1807.441] (-1809.411) -- 0:00:23 Average standard deviation of split frequencies: 0.008895 650500 -- [-1802.267] (-1805.619) (-1802.263) (-1801.964) * (-1804.597) (-1801.829) (-1803.407) [-1809.005] -- 0:00:23 651000 -- (-1803.773) (-1803.374) (-1802.287) [-1803.496] * (-1804.818) (-1801.948) (-1802.175) [-1802.791] -- 0:00:23 651500 -- (-1802.702) (-1804.337) (-1804.589) [-1803.196] * (-1802.106) [-1805.446] (-1802.941) (-1803.094) -- 0:00:23 652000 -- (-1804.680) (-1804.301) (-1807.779) [-1803.033] * (-1802.263) (-1805.217) (-1804.605) [-1802.921] -- 0:00:22 652500 -- (-1803.374) (-1806.566) [-1803.755] (-1801.643) * (-1806.324) (-1803.398) (-1806.034) [-1806.705] -- 0:00:22 653000 -- (-1808.414) (-1808.286) [-1802.284] (-1804.063) * (-1811.084) (-1803.067) [-1802.746] (-1804.271) -- 0:00:22 653500 -- (-1808.729) [-1805.681] (-1803.009) (-1804.112) * (-1807.484) [-1803.310] (-1805.363) (-1804.011) -- 0:00:22 654000 -- (-1807.369) [-1806.611] (-1806.540) (-1804.091) * [-1802.075] (-1805.567) (-1805.143) (-1804.205) -- 0:00:22 654500 -- (-1804.120) [-1810.047] (-1803.157) (-1805.334) * (-1803.310) (-1804.685) [-1802.635] (-1805.130) -- 0:00:22 655000 -- (-1804.489) [-1805.204] (-1808.211) (-1802.144) * [-1803.468] (-1804.196) (-1802.470) (-1806.214) -- 0:00:22 Average standard deviation of split frequencies: 0.008823 655500 -- [-1803.878] (-1806.431) (-1807.223) (-1802.777) * (-1805.064) [-1801.961] (-1804.330) (-1803.271) -- 0:00:22 656000 -- (-1806.994) [-1805.037] (-1803.830) (-1802.909) * [-1805.138] (-1803.402) (-1804.237) (-1803.332) -- 0:00:22 656500 -- (-1806.208) (-1803.389) [-1806.633] (-1803.483) * (-1806.684) (-1803.130) (-1802.831) [-1803.574] -- 0:00:22 657000 -- (-1802.590) (-1804.948) (-1809.854) [-1803.445] * [-1804.437] (-1802.204) (-1807.234) (-1807.446) -- 0:00:22 657500 -- (-1803.140) [-1803.554] (-1804.173) (-1803.160) * [-1802.496] (-1803.688) (-1804.411) (-1803.899) -- 0:00:22 658000 -- (-1803.273) (-1803.498) [-1807.691] (-1802.189) * (-1804.091) [-1802.575] (-1806.865) (-1802.563) -- 0:00:22 658500 -- (-1804.967) (-1804.587) (-1802.934) [-1802.823] * (-1802.349) (-1803.197) [-1806.295] (-1802.939) -- 0:00:22 659000 -- (-1803.729) [-1803.537] (-1804.731) (-1803.227) * (-1802.900) (-1802.919) (-1805.607) [-1802.211] -- 0:00:22 659500 -- [-1804.077] (-1805.241) (-1805.046) (-1803.969) * [-1803.110] (-1804.017) (-1806.232) (-1802.122) -- 0:00:22 660000 -- (-1803.448) [-1804.788] (-1805.031) (-1803.794) * (-1806.994) (-1807.905) [-1803.756] (-1801.958) -- 0:00:22 Average standard deviation of split frequencies: 0.009434 660500 -- [-1801.591] (-1802.886) (-1805.862) (-1803.669) * (-1802.042) (-1806.327) (-1804.257) [-1802.169] -- 0:00:22 661000 -- [-1802.852] (-1803.236) (-1803.403) (-1804.222) * (-1801.716) (-1804.574) (-1804.467) [-1802.193] -- 0:00:22 661500 -- (-1803.222) (-1803.608) [-1805.451] (-1805.797) * (-1802.953) (-1803.094) [-1801.827] (-1802.073) -- 0:00:22 662000 -- (-1805.195) (-1803.570) (-1806.586) [-1803.975] * [-1805.491] (-1805.059) (-1801.887) (-1805.590) -- 0:00:21 662500 -- [-1805.587] (-1803.625) (-1801.699) (-1803.635) * (-1803.474) [-1802.525] (-1802.392) (-1804.050) -- 0:00:21 663000 -- (-1805.656) [-1803.263] (-1802.399) (-1803.521) * (-1803.457) (-1802.662) (-1803.431) [-1804.041] -- 0:00:21 663500 -- [-1801.821] (-1806.331) (-1804.280) (-1802.445) * (-1807.286) (-1802.661) [-1805.303] (-1806.430) -- 0:00:21 664000 -- [-1805.536] (-1801.853) (-1804.465) (-1802.543) * (-1802.930) (-1801.668) [-1804.629] (-1804.772) -- 0:00:22 664500 -- (-1806.580) (-1802.108) (-1803.919) [-1802.616] * [-1803.722] (-1801.829) (-1806.050) (-1804.765) -- 0:00:22 665000 -- (-1805.649) (-1804.166) [-1802.535] (-1802.616) * [-1803.334] (-1804.792) (-1807.398) (-1802.347) -- 0:00:22 Average standard deviation of split frequencies: 0.009280 665500 -- (-1807.898) [-1802.634] (-1808.070) (-1803.446) * [-1802.669] (-1802.900) (-1805.453) (-1801.684) -- 0:00:22 666000 -- (-1808.039) (-1803.812) [-1803.638] (-1803.060) * (-1803.587) [-1802.716] (-1807.201) (-1806.676) -- 0:00:22 666500 -- [-1808.804] (-1806.213) (-1803.087) (-1802.394) * (-1804.339) [-1802.606] (-1803.100) (-1809.294) -- 0:00:22 667000 -- [-1803.400] (-1803.963) (-1803.525) (-1803.891) * [-1801.931] (-1806.213) (-1802.045) (-1806.144) -- 0:00:21 667500 -- (-1802.534) [-1804.927] (-1803.368) (-1803.531) * (-1804.653) [-1803.490] (-1801.957) (-1805.193) -- 0:00:21 668000 -- (-1803.466) [-1805.370] (-1802.180) (-1809.101) * [-1804.472] (-1802.028) (-1802.228) (-1803.989) -- 0:00:21 668500 -- [-1803.469] (-1802.878) (-1802.679) (-1803.488) * [-1803.003] (-1805.689) (-1805.533) (-1803.686) -- 0:00:21 669000 -- (-1804.183) [-1802.046] (-1805.896) (-1807.653) * (-1803.279) (-1803.394) (-1805.816) [-1804.765] -- 0:00:21 669500 -- [-1805.492] (-1802.843) (-1806.177) (-1809.664) * (-1803.804) (-1804.212) (-1804.552) [-1805.836] -- 0:00:21 670000 -- [-1803.889] (-1805.035) (-1805.987) (-1809.113) * (-1802.107) (-1802.317) [-1801.965] (-1803.953) -- 0:00:21 Average standard deviation of split frequencies: 0.009489 670500 -- [-1803.262] (-1804.824) (-1802.764) (-1804.915) * (-1803.670) (-1802.690) [-1803.816] (-1804.679) -- 0:00:21 671000 -- (-1804.135) [-1802.207] (-1803.123) (-1802.499) * (-1806.076) (-1804.078) (-1804.067) [-1802.504] -- 0:00:21 671500 -- (-1805.370) [-1804.733] (-1803.277) (-1802.849) * (-1802.873) (-1804.999) [-1804.212] (-1802.973) -- 0:00:21 672000 -- (-1806.315) (-1802.654) (-1804.354) [-1802.370] * (-1803.877) (-1804.090) [-1805.627] (-1803.690) -- 0:00:21 672500 -- (-1803.529) (-1803.211) (-1804.977) [-1801.974] * (-1802.712) (-1809.402) [-1806.255] (-1805.406) -- 0:00:21 673000 -- [-1802.763] (-1805.000) (-1804.471) (-1804.975) * [-1803.229] (-1806.310) (-1804.056) (-1804.354) -- 0:00:21 673500 -- (-1808.821) (-1806.173) [-1806.239] (-1803.454) * (-1802.462) (-1812.042) [-1806.516] (-1804.433) -- 0:00:21 674000 -- [-1803.912] (-1804.942) (-1808.311) (-1802.866) * [-1804.388] (-1803.112) (-1806.215) (-1806.468) -- 0:00:21 674500 -- (-1803.210) (-1803.901) (-1804.942) [-1803.641] * (-1803.969) (-1806.017) [-1805.605] (-1806.264) -- 0:00:21 675000 -- (-1805.794) (-1807.178) [-1805.385] (-1804.510) * (-1802.723) (-1803.494) (-1805.813) [-1805.084] -- 0:00:21 Average standard deviation of split frequencies: 0.008901 675500 -- (-1803.749) (-1804.829) [-1802.885] (-1804.252) * (-1804.296) [-1804.450] (-1802.507) (-1807.339) -- 0:00:21 676000 -- [-1802.286] (-1802.275) (-1806.126) (-1804.433) * (-1801.998) (-1803.199) [-1806.250] (-1805.781) -- 0:00:21 676500 -- [-1804.263] (-1802.465) (-1802.676) (-1806.232) * (-1805.289) (-1806.920) [-1803.951] (-1804.545) -- 0:00:21 677000 -- (-1803.915) (-1804.926) (-1802.941) [-1803.647] * [-1804.394] (-1802.547) (-1802.854) (-1806.733) -- 0:00:20 677500 -- [-1805.683] (-1802.145) (-1805.007) (-1802.527) * (-1802.838) (-1808.490) (-1803.920) [-1801.912] -- 0:00:20 678000 -- (-1804.473) [-1802.733] (-1801.694) (-1808.311) * (-1807.151) (-1802.775) [-1802.488] (-1801.895) -- 0:00:20 678500 -- (-1804.991) (-1803.295) (-1802.479) [-1805.644] * (-1806.247) [-1802.329] (-1805.292) (-1802.093) -- 0:00:20 679000 -- [-1806.778] (-1801.831) (-1807.307) (-1806.024) * (-1805.733) (-1801.998) (-1804.073) [-1802.517] -- 0:00:20 679500 -- [-1803.406] (-1805.291) (-1806.001) (-1805.259) * (-1804.770) [-1804.985] (-1804.639) (-1802.554) -- 0:00:20 680000 -- (-1805.051) (-1804.955) (-1803.856) [-1803.908] * (-1805.809) (-1802.146) [-1805.557] (-1803.251) -- 0:00:21 Average standard deviation of split frequencies: 0.008527 680500 -- (-1804.927) (-1810.664) (-1804.201) [-1803.153] * (-1804.436) [-1802.165] (-1807.902) (-1804.512) -- 0:00:21 681000 -- [-1803.328] (-1805.659) (-1806.110) (-1803.280) * (-1804.258) (-1803.011) [-1806.210] (-1801.943) -- 0:00:21 681500 -- (-1803.092) (-1803.584) (-1804.820) [-1802.943] * [-1808.029] (-1801.757) (-1807.485) (-1803.292) -- 0:00:21 682000 -- [-1803.562] (-1803.860) (-1804.666) (-1801.928) * (-1806.408) [-1805.842] (-1803.290) (-1804.247) -- 0:00:20 682500 -- [-1803.530] (-1802.251) (-1803.070) (-1802.348) * [-1804.276] (-1805.741) (-1803.319) (-1804.190) -- 0:00:20 683000 -- (-1801.968) (-1804.505) (-1804.149) [-1803.400] * (-1803.226) (-1804.809) [-1804.818] (-1802.796) -- 0:00:20 683500 -- (-1803.687) (-1807.363) [-1802.932] (-1804.048) * (-1803.445) (-1805.409) [-1803.125] (-1803.241) -- 0:00:20 684000 -- [-1806.186] (-1808.625) (-1803.269) (-1803.275) * (-1801.780) [-1805.309] (-1804.115) (-1802.644) -- 0:00:20 684500 -- (-1806.367) [-1803.572] (-1805.127) (-1801.930) * (-1804.581) (-1805.047) [-1803.108] (-1803.236) -- 0:00:20 685000 -- (-1804.500) (-1803.737) [-1804.206] (-1802.138) * (-1805.202) (-1804.056) [-1801.790] (-1807.172) -- 0:00:20 Average standard deviation of split frequencies: 0.009544 685500 -- [-1803.672] (-1802.024) (-1802.244) (-1802.443) * (-1806.133) (-1803.526) [-1801.859] (-1808.664) -- 0:00:20 686000 -- (-1809.267) (-1802.792) (-1802.438) [-1802.974] * (-1806.690) (-1803.265) (-1801.805) [-1805.252] -- 0:00:20 686500 -- (-1802.651) (-1802.413) [-1805.942] (-1803.987) * (-1803.797) (-1803.074) (-1803.035) [-1804.872] -- 0:00:20 687000 -- (-1803.505) (-1803.579) (-1804.256) [-1804.231] * (-1803.203) (-1801.872) (-1803.122) [-1803.110] -- 0:00:20 687500 -- (-1805.473) (-1804.167) [-1805.423] (-1802.653) * (-1804.434) (-1802.653) [-1801.800] (-1802.938) -- 0:00:20 688000 -- (-1804.640) (-1805.343) (-1804.593) [-1802.386] * (-1805.044) [-1803.109] (-1806.192) (-1804.165) -- 0:00:20 688500 -- [-1801.713] (-1806.928) (-1805.432) (-1804.196) * (-1809.310) (-1805.148) (-1807.853) [-1809.341] -- 0:00:20 689000 -- (-1803.063) (-1804.963) [-1802.329] (-1804.238) * (-1806.438) (-1802.350) [-1803.833] (-1804.568) -- 0:00:20 689500 -- (-1803.007) [-1804.172] (-1802.059) (-1807.109) * [-1805.952] (-1802.349) (-1803.177) (-1805.842) -- 0:00:20 690000 -- [-1802.901] (-1803.966) (-1804.631) (-1805.541) * [-1803.736] (-1802.117) (-1803.864) (-1803.184) -- 0:00:20 Average standard deviation of split frequencies: 0.009395 690500 -- (-1802.281) (-1811.212) [-1803.880] (-1802.312) * (-1804.007) (-1801.867) (-1803.698) [-1802.410] -- 0:00:20 691000 -- (-1802.221) (-1808.175) (-1803.854) [-1803.348] * [-1803.430] (-1803.075) (-1805.487) (-1803.026) -- 0:00:20 691500 -- [-1802.168] (-1807.826) (-1808.072) (-1803.273) * [-1802.870] (-1803.748) (-1806.261) (-1804.370) -- 0:00:20 692000 -- (-1803.126) (-1805.193) (-1803.891) [-1803.186] * (-1802.647) (-1807.940) (-1805.940) [-1804.663] -- 0:00:20 692500 -- (-1803.359) [-1803.501] (-1804.982) (-1804.431) * (-1805.274) (-1803.337) (-1803.075) [-1806.134] -- 0:00:19 693000 -- (-1802.303) (-1802.834) (-1804.314) [-1803.647] * (-1803.989) [-1804.344] (-1804.403) (-1806.712) -- 0:00:19 693500 -- [-1804.806] (-1803.069) (-1803.291) (-1801.445) * [-1803.659] (-1806.085) (-1804.748) (-1802.039) -- 0:00:19 694000 -- (-1804.160) [-1803.869] (-1805.293) (-1802.551) * [-1805.234] (-1803.256) (-1804.029) (-1805.047) -- 0:00:19 694500 -- [-1804.606] (-1802.159) (-1804.169) (-1801.959) * [-1803.999] (-1804.859) (-1806.415) (-1805.384) -- 0:00:19 695000 -- (-1802.717) [-1807.764] (-1801.722) (-1802.653) * (-1804.332) (-1805.919) (-1803.291) [-1803.168] -- 0:00:19 Average standard deviation of split frequencies: 0.009440 695500 -- (-1805.285) (-1814.494) (-1801.854) [-1804.674] * (-1805.047) (-1806.090) [-1808.166] (-1803.062) -- 0:00:20 696000 -- (-1804.852) [-1803.896] (-1809.705) (-1805.035) * [-1806.717] (-1804.318) (-1805.885) (-1802.393) -- 0:00:20 696500 -- (-1804.768) (-1809.862) (-1803.203) [-1804.552] * (-1804.946) (-1804.335) (-1808.128) [-1803.796] -- 0:00:20 697000 -- [-1802.384] (-1803.712) (-1803.208) (-1808.458) * (-1804.645) (-1803.057) [-1803.806] (-1804.771) -- 0:00:19 697500 -- (-1802.057) (-1803.549) [-1802.942] (-1807.462) * (-1803.557) [-1803.413] (-1805.146) (-1805.767) -- 0:00:19 698000 -- (-1803.460) [-1804.279] (-1802.706) (-1803.332) * (-1801.986) (-1804.799) [-1806.112] (-1804.875) -- 0:00:19 698500 -- (-1802.821) (-1807.193) (-1804.720) [-1803.332] * (-1804.153) (-1804.007) [-1803.033] (-1803.274) -- 0:00:19 699000 -- (-1803.259) [-1806.530] (-1804.104) (-1801.861) * (-1806.004) [-1802.313] (-1804.100) (-1802.427) -- 0:00:19 699500 -- [-1804.814] (-1806.516) (-1805.096) (-1803.191) * (-1809.306) [-1803.459] (-1805.967) (-1802.527) -- 0:00:19 700000 -- (-1807.014) [-1802.747] (-1802.791) (-1806.229) * (-1805.576) (-1802.209) [-1803.768] (-1809.030) -- 0:00:19 Average standard deviation of split frequencies: 0.009167 700500 -- [-1807.978] (-1804.757) (-1806.156) (-1806.758) * (-1803.669) (-1803.329) (-1804.505) [-1803.176] -- 0:00:19 701000 -- [-1803.182] (-1805.111) (-1805.954) (-1806.403) * [-1802.055] (-1804.169) (-1803.348) (-1803.099) -- 0:00:19 701500 -- (-1802.588) (-1811.683) (-1806.838) [-1804.726] * (-1803.699) (-1808.499) (-1803.680) [-1803.171] -- 0:00:19 702000 -- (-1805.599) [-1809.955] (-1803.458) (-1802.259) * (-1805.127) (-1803.334) (-1802.888) [-1802.943] -- 0:00:19 702500 -- (-1803.788) (-1808.746) (-1804.612) [-1802.004] * (-1803.870) [-1802.975] (-1802.410) (-1803.632) -- 0:00:19 703000 -- (-1804.475) (-1808.355) [-1803.041] (-1802.685) * (-1804.126) (-1802.561) [-1802.967] (-1805.544) -- 0:00:19 703500 -- [-1805.605] (-1804.110) (-1803.714) (-1803.457) * (-1807.284) (-1802.065) [-1804.243] (-1801.816) -- 0:00:19 704000 -- [-1803.265] (-1806.796) (-1806.000) (-1802.772) * (-1803.974) (-1801.908) (-1804.313) [-1803.937] -- 0:00:19 704500 -- (-1805.768) [-1802.689] (-1804.550) (-1805.013) * (-1803.728) (-1804.162) [-1802.059] (-1808.161) -- 0:00:19 705000 -- [-1804.873] (-1804.782) (-1804.482) (-1803.440) * [-1804.314] (-1801.668) (-1802.498) (-1804.932) -- 0:00:19 Average standard deviation of split frequencies: 0.008722 705500 -- (-1805.502) (-1805.989) [-1803.609] (-1802.323) * [-1805.357] (-1803.987) (-1807.080) (-1803.190) -- 0:00:19 706000 -- (-1802.973) [-1801.817] (-1804.435) (-1803.260) * (-1804.749) (-1803.141) (-1802.916) [-1802.106] -- 0:00:19 706500 -- [-1802.691] (-1803.637) (-1803.279) (-1802.372) * (-1804.630) (-1802.359) (-1806.774) [-1802.111] -- 0:00:19 707000 -- (-1809.576) (-1804.667) (-1805.570) [-1802.398] * (-1804.400) [-1804.427] (-1803.130) (-1802.399) -- 0:00:19 707500 -- (-1807.257) (-1808.356) (-1803.670) [-1806.738] * (-1805.408) [-1803.260] (-1803.609) (-1802.206) -- 0:00:19 708000 -- (-1809.177) (-1804.814) [-1803.013] (-1801.922) * (-1805.735) (-1802.486) [-1804.371] (-1805.486) -- 0:00:18 708500 -- (-1804.374) (-1804.106) [-1803.259] (-1802.110) * (-1803.049) (-1803.541) [-1803.270] (-1804.704) -- 0:00:18 709000 -- (-1803.947) (-1803.163) (-1802.655) [-1802.966] * (-1804.371) [-1803.227] (-1808.850) (-1804.706) -- 0:00:18 709500 -- (-1803.574) (-1804.783) [-1802.863] (-1803.552) * (-1804.586) (-1803.858) (-1803.605) [-1804.408] -- 0:00:18 710000 -- [-1802.942] (-1807.046) (-1805.839) (-1803.651) * (-1803.489) [-1805.277] (-1804.189) (-1806.952) -- 0:00:18 Average standard deviation of split frequencies: 0.008540 710500 -- (-1803.896) (-1805.452) (-1807.195) [-1802.906] * (-1803.690) (-1803.274) [-1802.403] (-1804.630) -- 0:00:18 711000 -- (-1803.906) (-1806.296) [-1803.553] (-1803.037) * (-1802.685) (-1805.728) (-1803.498) [-1803.739] -- 0:00:19 711500 -- [-1804.267] (-1805.148) (-1802.332) (-1803.037) * (-1801.908) (-1802.545) (-1805.553) [-1804.428] -- 0:00:19 712000 -- (-1803.322) [-1803.594] (-1802.832) (-1806.243) * (-1803.213) (-1804.492) [-1802.355] (-1804.962) -- 0:00:19 712500 -- [-1803.868] (-1803.436) (-1803.892) (-1804.209) * (-1803.786) (-1801.917) [-1803.067] (-1805.229) -- 0:00:18 713000 -- [-1801.992] (-1802.637) (-1805.479) (-1807.208) * [-1802.536] (-1802.487) (-1806.076) (-1801.915) -- 0:00:18 713500 -- (-1802.522) [-1802.162] (-1802.423) (-1807.915) * (-1803.371) (-1803.885) (-1806.088) [-1802.484] -- 0:00:18 714000 -- (-1803.721) [-1802.030] (-1802.900) (-1807.544) * (-1803.672) (-1804.443) [-1802.658] (-1803.572) -- 0:00:18 714500 -- (-1804.901) (-1802.461) (-1802.207) [-1807.355] * (-1802.859) [-1804.671] (-1804.916) (-1808.739) -- 0:00:18 715000 -- [-1803.027] (-1802.141) (-1803.210) (-1806.493) * (-1802.804) (-1807.146) (-1805.031) [-1805.298] -- 0:00:18 Average standard deviation of split frequencies: 0.008230 715500 -- (-1802.747) [-1802.625] (-1802.945) (-1802.427) * (-1804.823) [-1807.583] (-1803.607) (-1807.583) -- 0:00:18 716000 -- (-1804.058) (-1804.231) [-1803.015] (-1805.408) * [-1806.162] (-1808.140) (-1803.685) (-1808.211) -- 0:00:18 716500 -- (-1803.974) [-1801.968] (-1802.731) (-1804.202) * (-1810.064) [-1802.274] (-1803.264) (-1808.449) -- 0:00:18 717000 -- (-1807.605) (-1804.195) (-1803.608) [-1804.073] * (-1806.153) (-1802.624) (-1803.683) [-1803.842] -- 0:00:18 717500 -- (-1802.545) (-1805.741) (-1802.679) [-1802.714] * (-1807.483) [-1805.369] (-1803.730) (-1802.663) -- 0:00:18 718000 -- (-1802.341) [-1804.618] (-1804.283) (-1804.370) * [-1805.083] (-1806.987) (-1802.442) (-1805.245) -- 0:00:18 718500 -- (-1802.300) [-1801.906] (-1806.776) (-1803.289) * (-1804.872) (-1804.881) [-1802.587] (-1807.572) -- 0:00:18 719000 -- (-1805.374) [-1803.492] (-1803.905) (-1803.848) * (-1802.978) (-1803.536) [-1802.600] (-1804.675) -- 0:00:18 719500 -- [-1802.115] (-1803.823) (-1803.710) (-1803.593) * (-1804.642) [-1805.876] (-1802.243) (-1803.076) -- 0:00:18 720000 -- (-1803.306) [-1804.661] (-1801.765) (-1804.153) * (-1802.245) [-1802.497] (-1803.198) (-1802.566) -- 0:00:18 Average standard deviation of split frequencies: 0.008585 720500 -- [-1804.210] (-1807.485) (-1802.432) (-1802.728) * (-1803.860) (-1805.247) [-1801.847] (-1803.644) -- 0:00:18 721000 -- (-1802.498) (-1805.271) [-1802.977] (-1801.657) * (-1803.490) (-1805.910) (-1802.263) [-1802.114] -- 0:00:18 721500 -- (-1802.543) (-1802.220) [-1802.119] (-1802.979) * (-1804.133) (-1804.545) [-1803.213] (-1804.114) -- 0:00:18 722000 -- (-1804.154) (-1805.003) (-1805.568) [-1803.214] * [-1803.317] (-1804.382) (-1807.122) (-1806.408) -- 0:00:18 722500 -- (-1804.140) [-1805.377] (-1804.861) (-1804.249) * (-1805.060) (-1804.104) (-1805.373) [-1803.243] -- 0:00:18 723000 -- (-1804.574) [-1804.067] (-1809.916) (-1802.395) * (-1803.150) (-1803.593) [-1801.925] (-1803.713) -- 0:00:18 723500 -- (-1803.260) (-1807.360) [-1808.067] (-1802.452) * (-1804.061) [-1802.611] (-1803.372) (-1807.833) -- 0:00:17 724000 -- [-1805.014] (-1811.237) (-1807.530) (-1804.788) * (-1804.839) [-1802.117] (-1802.461) (-1807.065) -- 0:00:17 724500 -- (-1803.177) [-1805.291] (-1802.712) (-1805.288) * (-1803.780) [-1803.757] (-1805.771) (-1802.514) -- 0:00:17 725000 -- [-1802.722] (-1804.505) (-1803.585) (-1807.300) * (-1801.982) (-1802.109) (-1805.875) [-1804.792] -- 0:00:17 Average standard deviation of split frequencies: 0.008479 725500 -- (-1803.036) (-1804.818) [-1804.114] (-1804.865) * [-1803.904] (-1804.009) (-1805.513) (-1806.491) -- 0:00:17 726000 -- (-1807.084) (-1804.114) (-1803.117) [-1804.606] * (-1812.470) [-1804.714] (-1805.634) (-1803.002) -- 0:00:17 726500 -- [-1801.915] (-1805.818) (-1802.947) (-1803.375) * (-1811.752) [-1802.561] (-1803.824) (-1805.816) -- 0:00:17 727000 -- (-1802.387) (-1802.663) (-1804.714) [-1802.324] * (-1814.472) (-1802.092) [-1804.874] (-1806.140) -- 0:00:18 727500 -- (-1803.202) (-1804.387) (-1804.734) [-1802.926] * (-1807.433) [-1805.073] (-1806.729) (-1804.456) -- 0:00:17 728000 -- (-1803.087) [-1805.160] (-1804.500) (-1804.176) * [-1809.909] (-1803.278) (-1805.571) (-1802.646) -- 0:00:17 728500 -- (-1804.679) (-1805.100) (-1806.424) [-1804.030] * [-1802.430] (-1803.652) (-1805.756) (-1802.078) -- 0:00:17 729000 -- (-1804.679) (-1803.323) (-1803.543) [-1803.389] * (-1802.463) [-1805.376] (-1803.528) (-1803.259) -- 0:00:17 729500 -- (-1805.311) [-1803.173] (-1803.195) (-1803.798) * (-1803.227) [-1805.604] (-1805.005) (-1802.258) -- 0:00:17 730000 -- (-1805.137) (-1806.204) [-1803.513] (-1802.819) * (-1804.588) [-1804.368] (-1805.908) (-1805.040) -- 0:00:17 Average standard deviation of split frequencies: 0.008508 730500 -- (-1802.830) (-1804.669) [-1803.321] (-1806.080) * (-1802.658) [-1804.097] (-1802.425) (-1802.458) -- 0:00:17 731000 -- (-1802.400) (-1802.969) [-1803.565] (-1805.448) * [-1801.659] (-1804.383) (-1802.988) (-1805.607) -- 0:00:17 731500 -- (-1803.389) (-1803.526) [-1803.417] (-1804.561) * (-1802.512) (-1806.100) (-1804.875) [-1803.336] -- 0:00:17 732000 -- (-1806.919) (-1801.969) (-1805.800) [-1803.177] * (-1802.289) (-1806.443) (-1802.481) [-1802.310] -- 0:00:17 732500 -- [-1802.795] (-1802.677) (-1803.191) (-1808.606) * [-1802.420] (-1805.100) (-1803.620) (-1802.591) -- 0:00:17 733000 -- (-1802.220) (-1806.003) [-1804.610] (-1802.954) * (-1802.567) [-1801.686] (-1806.983) (-1803.233) -- 0:00:17 733500 -- (-1804.947) [-1803.356] (-1805.539) (-1802.868) * (-1806.681) [-1802.880] (-1803.463) (-1805.800) -- 0:00:17 734000 -- (-1803.035) (-1803.501) [-1803.096] (-1802.836) * (-1803.158) (-1801.827) [-1802.504] (-1802.875) -- 0:00:17 734500 -- [-1802.815] (-1802.759) (-1806.946) (-1807.809) * [-1804.927] (-1805.364) (-1802.569) (-1804.931) -- 0:00:17 735000 -- (-1802.962) (-1802.501) (-1804.202) [-1802.740] * [-1805.233] (-1810.055) (-1806.964) (-1805.284) -- 0:00:17 Average standard deviation of split frequencies: 0.008086 735500 -- (-1802.933) (-1806.446) (-1803.535) [-1804.175] * (-1807.394) (-1804.181) (-1802.962) [-1803.205] -- 0:00:17 736000 -- (-1803.418) (-1804.546) [-1803.971] (-1804.410) * (-1806.013) (-1803.863) (-1803.442) [-1803.737] -- 0:00:17 736500 -- (-1807.480) [-1808.135] (-1804.169) (-1804.253) * (-1802.967) [-1808.638] (-1804.248) (-1804.527) -- 0:00:17 737000 -- (-1805.021) (-1805.251) [-1803.306] (-1802.549) * (-1806.469) (-1807.057) (-1802.841) [-1805.006] -- 0:00:17 737500 -- (-1804.155) (-1802.913) [-1803.767] (-1803.057) * (-1804.847) (-1809.850) (-1805.449) [-1801.973] -- 0:00:17 738000 -- [-1807.106] (-1803.548) (-1804.319) (-1803.986) * (-1803.404) (-1808.094) (-1805.761) [-1803.844] -- 0:00:17 738500 -- (-1802.570) [-1803.145] (-1806.901) (-1806.410) * (-1803.237) (-1803.163) (-1807.471) [-1802.627] -- 0:00:16 739000 -- (-1803.282) [-1804.487] (-1802.413) (-1803.213) * (-1802.135) [-1803.499] (-1802.763) (-1802.304) -- 0:00:16 739500 -- [-1802.905] (-1805.394) (-1802.452) (-1807.922) * [-1804.371] (-1803.166) (-1802.831) (-1803.017) -- 0:00:16 740000 -- [-1802.124] (-1804.417) (-1802.739) (-1809.200) * (-1805.734) (-1803.886) (-1802.743) [-1803.791] -- 0:00:16 Average standard deviation of split frequencies: 0.008354 740500 -- (-1808.078) (-1802.830) (-1802.581) [-1801.873] * (-1805.655) (-1804.363) [-1803.577] (-1802.380) -- 0:00:16 741000 -- (-1809.378) [-1802.519] (-1803.314) (-1802.563) * (-1804.482) (-1806.606) (-1803.212) [-1802.804] -- 0:00:16 741500 -- (-1804.011) (-1804.106) [-1806.555] (-1810.958) * (-1802.927) (-1805.170) [-1802.831] (-1806.071) -- 0:00:16 742000 -- (-1802.728) [-1804.643] (-1804.565) (-1804.165) * (-1803.149) (-1804.736) [-1802.391] (-1807.143) -- 0:00:16 742500 -- (-1806.856) [-1803.140] (-1803.323) (-1805.790) * (-1802.626) [-1804.146] (-1808.298) (-1803.652) -- 0:00:16 743000 -- [-1804.978] (-1805.785) (-1804.618) (-1808.552) * (-1808.098) (-1804.261) (-1805.128) [-1805.629] -- 0:00:16 743500 -- (-1802.324) (-1807.009) [-1802.924] (-1802.106) * (-1803.477) [-1804.881] (-1806.741) (-1808.275) -- 0:00:16 744000 -- (-1801.785) (-1808.603) [-1804.543] (-1805.652) * (-1803.955) (-1806.614) (-1804.780) [-1804.788] -- 0:00:16 744500 -- (-1802.482) (-1805.322) [-1806.781] (-1805.447) * (-1803.206) [-1806.505] (-1804.273) (-1804.752) -- 0:00:16 745000 -- [-1803.329] (-1803.849) (-1804.276) (-1805.708) * [-1803.887] (-1808.666) (-1806.564) (-1808.149) -- 0:00:16 Average standard deviation of split frequencies: 0.008215 745500 -- (-1805.570) (-1803.955) [-1804.255] (-1804.268) * [-1804.876] (-1805.277) (-1805.553) (-1803.903) -- 0:00:16 746000 -- (-1805.054) (-1803.850) [-1802.397] (-1805.659) * (-1807.629) (-1805.277) (-1804.607) [-1802.983] -- 0:00:16 746500 -- [-1802.384] (-1802.735) (-1803.585) (-1804.646) * (-1804.625) [-1803.567] (-1803.892) (-1803.428) -- 0:00:16 747000 -- (-1803.756) (-1802.523) (-1803.761) [-1805.606] * (-1804.671) [-1802.423] (-1803.294) (-1802.503) -- 0:00:16 747500 -- [-1803.200] (-1803.646) (-1803.666) (-1806.361) * (-1802.876) (-1801.902) (-1806.341) [-1805.928] -- 0:00:16 748000 -- (-1804.660) (-1803.368) [-1802.307] (-1806.299) * (-1805.150) (-1803.502) (-1807.240) [-1802.608] -- 0:00:16 748500 -- (-1805.197) (-1804.670) (-1802.057) [-1805.129] * (-1805.697) [-1804.039] (-1805.629) (-1804.677) -- 0:00:16 749000 -- (-1808.108) (-1805.025) [-1801.912] (-1804.539) * [-1805.336] (-1803.599) (-1802.372) (-1804.010) -- 0:00:16 749500 -- (-1804.880) (-1803.667) [-1801.908] (-1804.540) * (-1809.074) (-1802.195) [-1802.010] (-1803.523) -- 0:00:16 750000 -- (-1802.884) (-1803.071) [-1805.722] (-1802.021) * [-1801.814] (-1803.927) (-1804.827) (-1804.697) -- 0:00:16 Average standard deviation of split frequencies: 0.008517 750500 -- (-1802.384) (-1803.629) [-1805.242] (-1807.189) * (-1806.770) (-1804.530) (-1804.108) [-1804.168] -- 0:00:16 751000 -- (-1802.138) (-1803.156) (-1804.714) [-1804.779] * (-1804.019) (-1812.931) [-1804.698] (-1806.611) -- 0:00:16 751500 -- (-1810.672) [-1803.179] (-1803.217) (-1803.531) * (-1803.481) (-1808.128) [-1805.196] (-1802.764) -- 0:00:16 752000 -- (-1806.290) (-1803.149) [-1802.517] (-1803.666) * [-1804.090] (-1804.949) (-1806.633) (-1804.640) -- 0:00:16 752500 -- (-1804.322) (-1802.781) [-1801.953] (-1804.362) * [-1804.325] (-1808.232) (-1806.674) (-1807.298) -- 0:00:16 753000 -- (-1802.306) (-1802.433) [-1803.147] (-1803.875) * [-1802.812] (-1807.199) (-1806.229) (-1807.239) -- 0:00:16 753500 -- (-1802.132) [-1803.124] (-1807.433) (-1803.993) * (-1801.945) (-1803.883) (-1803.927) [-1803.663] -- 0:00:16 754000 -- [-1802.686] (-1803.330) (-1808.408) (-1803.840) * [-1802.912] (-1806.442) (-1802.027) (-1804.760) -- 0:00:15 754500 -- (-1803.562) (-1804.400) (-1804.598) [-1805.215] * (-1803.247) (-1805.643) (-1802.340) [-1803.519] -- 0:00:15 755000 -- [-1806.227] (-1804.303) (-1803.133) (-1802.497) * [-1802.695] (-1803.721) (-1803.823) (-1803.667) -- 0:00:15 Average standard deviation of split frequencies: 0.008730 755500 -- (-1803.306) (-1806.766) (-1802.929) [-1803.609] * (-1803.812) (-1803.657) (-1803.885) [-1801.650] -- 0:00:15 756000 -- (-1809.291) (-1803.180) [-1802.289] (-1804.132) * (-1803.091) [-1805.854] (-1802.966) (-1801.654) -- 0:00:15 756500 -- [-1803.762] (-1804.127) (-1803.310) (-1803.481) * (-1803.188) [-1804.445] (-1802.312) (-1802.697) -- 0:00:15 757000 -- (-1803.070) (-1803.184) [-1802.786] (-1805.053) * [-1806.917] (-1803.696) (-1802.840) (-1804.498) -- 0:00:15 757500 -- (-1803.136) (-1802.335) [-1804.434] (-1802.983) * (-1803.104) [-1803.267] (-1805.506) (-1805.364) -- 0:00:15 758000 -- (-1803.598) (-1802.866) [-1804.081] (-1802.938) * (-1803.180) (-1803.604) [-1806.258] (-1803.298) -- 0:00:15 758500 -- (-1804.193) (-1803.760) [-1802.058] (-1804.109) * [-1803.838] (-1803.598) (-1802.142) (-1804.624) -- 0:00:15 759000 -- (-1803.323) (-1803.079) [-1802.418] (-1804.932) * (-1804.995) [-1803.971] (-1803.495) (-1806.541) -- 0:00:15 759500 -- (-1802.285) [-1803.796] (-1803.351) (-1804.864) * (-1804.829) [-1802.979] (-1804.389) (-1806.184) -- 0:00:15 760000 -- (-1802.468) (-1801.809) (-1803.176) [-1801.721] * [-1802.932] (-1802.797) (-1802.466) (-1804.330) -- 0:00:15 Average standard deviation of split frequencies: 0.009141 760500 -- (-1806.416) (-1802.317) [-1803.615] (-1802.028) * (-1806.272) (-1803.025) [-1803.097] (-1806.298) -- 0:00:15 761000 -- (-1804.534) [-1802.821] (-1803.151) (-1803.022) * [-1802.288] (-1802.977) (-1804.371) (-1803.496) -- 0:00:15 761500 -- [-1803.015] (-1803.091) (-1803.794) (-1803.545) * [-1804.381] (-1803.553) (-1803.267) (-1802.306) -- 0:00:15 762000 -- (-1806.354) [-1805.529] (-1806.873) (-1802.565) * [-1802.772] (-1803.212) (-1802.780) (-1803.493) -- 0:00:15 762500 -- (-1804.757) [-1803.864] (-1803.785) (-1802.624) * (-1804.907) (-1803.431) (-1804.905) [-1802.864] -- 0:00:15 763000 -- (-1803.309) (-1804.457) (-1804.087) [-1802.459] * (-1804.021) [-1802.101] (-1804.236) (-1802.579) -- 0:00:15 763500 -- [-1804.726] (-1803.617) (-1805.480) (-1802.187) * (-1802.591) [-1804.937] (-1802.518) (-1805.012) -- 0:00:15 764000 -- (-1805.872) (-1803.500) [-1803.816] (-1802.772) * [-1801.655] (-1802.554) (-1802.973) (-1801.903) -- 0:00:15 764500 -- (-1804.462) (-1806.638) [-1802.327] (-1803.207) * [-1801.654] (-1802.916) (-1805.542) (-1804.414) -- 0:00:15 765000 -- (-1801.956) [-1805.772] (-1805.258) (-1807.000) * (-1802.023) (-1804.097) (-1805.002) [-1804.601] -- 0:00:15 Average standard deviation of split frequencies: 0.008962 765500 -- (-1804.354) (-1803.810) [-1802.328] (-1804.615) * (-1804.376) (-1802.417) [-1803.363] (-1802.312) -- 0:00:15 766000 -- [-1802.750] (-1807.081) (-1803.175) (-1803.569) * (-1805.471) [-1802.837] (-1803.673) (-1804.691) -- 0:00:15 766500 -- (-1803.691) (-1804.223) [-1801.877] (-1801.720) * [-1802.322] (-1802.375) (-1803.398) (-1802.325) -- 0:00:15 767000 -- (-1805.821) (-1803.664) [-1804.682] (-1804.770) * (-1801.910) (-1803.754) [-1804.552] (-1804.194) -- 0:00:15 767500 -- [-1810.927] (-1802.378) (-1802.369) (-1803.207) * [-1802.146] (-1803.735) (-1802.690) (-1802.087) -- 0:00:15 768000 -- (-1803.276) [-1804.932] (-1803.740) (-1804.728) * (-1804.898) [-1804.519] (-1803.537) (-1807.750) -- 0:00:15 768500 -- [-1804.385] (-1802.318) (-1805.404) (-1806.021) * [-1802.542] (-1802.394) (-1802.809) (-1803.852) -- 0:00:15 769000 -- [-1808.079] (-1803.284) (-1805.518) (-1805.803) * (-1804.222) (-1802.950) (-1804.423) [-1805.020] -- 0:00:15 769500 -- (-1803.860) (-1803.276) (-1801.883) [-1804.072] * (-1804.227) (-1803.439) (-1806.363) [-1804.012] -- 0:00:14 770000 -- [-1802.308] (-1805.413) (-1803.357) (-1804.817) * (-1803.942) (-1802.798) [-1805.052] (-1804.485) -- 0:00:14 Average standard deviation of split frequencies: 0.009022 770500 -- (-1806.027) (-1803.389) (-1806.730) [-1804.613] * (-1803.408) (-1802.445) [-1805.841] (-1802.862) -- 0:00:14 771000 -- (-1803.495) (-1805.235) (-1803.856) [-1803.072] * (-1803.346) [-1806.791] (-1802.712) (-1802.581) -- 0:00:14 771500 -- (-1803.068) (-1804.225) [-1804.468] (-1805.717) * (-1805.660) (-1807.805) (-1804.757) [-1807.344] -- 0:00:14 772000 -- (-1802.988) (-1804.151) [-1804.198] (-1803.818) * (-1806.423) [-1805.044] (-1807.676) (-1802.911) -- 0:00:14 772500 -- (-1803.992) [-1808.121] (-1805.057) (-1804.096) * (-1803.037) [-1802.075] (-1808.453) (-1804.006) -- 0:00:14 773000 -- [-1805.280] (-1808.602) (-1804.733) (-1807.632) * (-1803.459) [-1803.192] (-1803.188) (-1803.632) -- 0:00:14 773500 -- (-1806.502) (-1808.684) [-1806.612] (-1802.025) * (-1803.281) [-1802.613] (-1801.829) (-1810.769) -- 0:00:14 774000 -- (-1803.313) [-1804.113] (-1805.055) (-1802.811) * [-1802.446] (-1805.316) (-1804.031) (-1814.130) -- 0:00:14 774500 -- [-1803.614] (-1801.753) (-1809.981) (-1803.946) * [-1803.457] (-1802.500) (-1805.928) (-1808.484) -- 0:00:14 775000 -- (-1802.657) (-1802.833) [-1804.797] (-1804.673) * (-1803.484) (-1805.367) [-1808.902] (-1804.585) -- 0:00:14 Average standard deviation of split frequencies: 0.008884 775500 -- (-1804.097) [-1806.552] (-1805.377) (-1809.414) * (-1806.484) [-1804.290] (-1806.111) (-1805.610) -- 0:00:14 776000 -- (-1806.983) (-1806.816) (-1804.200) [-1805.869] * (-1807.953) (-1804.703) [-1805.047] (-1806.610) -- 0:00:14 776500 -- (-1803.148) (-1803.238) [-1804.640] (-1802.218) * (-1805.924) [-1806.694] (-1804.005) (-1806.843) -- 0:00:14 777000 -- [-1804.757] (-1806.777) (-1802.909) (-1802.431) * (-1807.489) [-1806.195] (-1804.033) (-1806.153) -- 0:00:14 777500 -- (-1805.918) [-1803.726] (-1801.753) (-1801.956) * (-1804.120) (-1802.398) (-1802.470) [-1802.527] -- 0:00:14 778000 -- [-1804.839] (-1805.085) (-1803.679) (-1804.924) * (-1801.813) (-1804.818) [-1801.998] (-1802.859) -- 0:00:14 778500 -- (-1801.737) (-1804.434) [-1802.199] (-1803.209) * [-1803.585] (-1803.078) (-1803.041) (-1803.284) -- 0:00:14 779000 -- (-1806.956) [-1802.095] (-1802.469) (-1802.439) * [-1807.347] (-1805.334) (-1802.664) (-1802.036) -- 0:00:14 779500 -- (-1809.071) (-1802.176) [-1802.214] (-1802.439) * (-1805.233) [-1804.071] (-1802.631) (-1804.632) -- 0:00:14 780000 -- (-1805.625) (-1806.579) (-1806.247) [-1802.768] * (-1803.044) (-1806.407) [-1803.859] (-1804.252) -- 0:00:14 Average standard deviation of split frequencies: 0.009246 780500 -- (-1805.857) (-1803.080) [-1806.046] (-1808.302) * [-1803.477] (-1803.328) (-1804.027) (-1803.688) -- 0:00:14 781000 -- (-1807.634) (-1803.977) [-1808.623] (-1805.764) * (-1805.006) (-1804.597) [-1802.619] (-1804.631) -- 0:00:14 781500 -- (-1805.857) [-1801.953] (-1803.576) (-1807.739) * [-1803.871] (-1804.394) (-1802.898) (-1804.205) -- 0:00:14 782000 -- (-1803.208) [-1801.982] (-1803.879) (-1802.383) * [-1805.543] (-1806.262) (-1808.152) (-1805.619) -- 0:00:14 782500 -- (-1806.812) (-1802.826) [-1803.880] (-1807.203) * (-1803.350) (-1805.525) (-1811.690) [-1804.788] -- 0:00:14 783000 -- [-1803.045] (-1803.389) (-1804.132) (-1803.315) * [-1802.507] (-1805.115) (-1805.179) (-1804.254) -- 0:00:14 783500 -- (-1803.591) (-1801.989) [-1803.066] (-1804.010) * (-1802.675) (-1802.243) [-1802.201] (-1803.138) -- 0:00:14 784000 -- (-1803.375) [-1803.376] (-1803.251) (-1804.031) * (-1803.776) [-1804.048] (-1802.375) (-1804.355) -- 0:00:14 784500 -- (-1806.520) (-1803.107) [-1803.415] (-1804.661) * (-1805.033) (-1806.763) (-1804.594) [-1805.627] -- 0:00:14 785000 -- (-1805.759) [-1803.097] (-1804.550) (-1805.102) * [-1805.331] (-1803.893) (-1802.307) (-1805.219) -- 0:00:13 Average standard deviation of split frequencies: 0.008921 785500 -- [-1805.230] (-1805.954) (-1806.867) (-1802.530) * (-1805.156) (-1805.134) [-1805.379] (-1804.043) -- 0:00:13 786000 -- (-1810.451) (-1802.639) (-1802.993) [-1802.666] * (-1804.317) [-1803.823] (-1805.878) (-1805.101) -- 0:00:13 786500 -- (-1803.319) (-1805.562) [-1803.628] (-1802.601) * [-1804.242] (-1802.509) (-1803.534) (-1805.717) -- 0:00:13 787000 -- (-1803.344) (-1803.430) [-1802.049] (-1803.542) * (-1804.196) [-1804.559] (-1803.023) (-1802.874) -- 0:00:13 787500 -- (-1805.035) (-1802.495) (-1803.030) [-1804.043] * (-1803.088) [-1805.292] (-1802.284) (-1803.309) -- 0:00:13 788000 -- (-1803.998) [-1801.643] (-1802.793) (-1806.112) * (-1801.920) (-1804.844) [-1802.284] (-1803.283) -- 0:00:13 788500 -- (-1803.626) [-1803.125] (-1803.473) (-1801.932) * (-1801.920) (-1803.478) [-1803.766] (-1806.064) -- 0:00:13 789000 -- (-1803.447) (-1802.134) (-1808.703) [-1802.342] * [-1804.699] (-1801.819) (-1802.756) (-1806.504) -- 0:00:13 789500 -- (-1804.436) (-1801.929) (-1803.694) [-1802.908] * (-1801.974) [-1803.701] (-1804.625) (-1810.089) -- 0:00:13 790000 -- (-1804.317) (-1803.883) [-1805.624] (-1802.587) * (-1805.107) (-1803.572) [-1802.835] (-1802.833) -- 0:00:13 Average standard deviation of split frequencies: 0.008980 790500 -- (-1806.773) (-1802.895) (-1805.848) [-1802.454] * (-1802.927) (-1802.391) [-1802.952] (-1802.733) -- 0:00:13 791000 -- (-1802.017) (-1804.189) [-1802.433] (-1803.791) * (-1802.641) (-1801.816) [-1804.097] (-1803.118) -- 0:00:13 791500 -- (-1804.948) [-1803.822] (-1805.663) (-1805.484) * [-1803.078] (-1803.171) (-1801.970) (-1802.598) -- 0:00:13 792000 -- [-1804.336] (-1803.705) (-1805.738) (-1802.887) * (-1803.285) (-1803.415) [-1803.040] (-1803.559) -- 0:00:13 792500 -- [-1805.859] (-1802.214) (-1805.894) (-1803.685) * (-1804.777) (-1803.224) (-1802.929) [-1803.743] -- 0:00:13 793000 -- (-1803.445) (-1802.608) [-1803.699] (-1802.397) * [-1803.380] (-1803.837) (-1803.704) (-1802.193) -- 0:00:13 793500 -- (-1807.274) [-1803.304] (-1804.432) (-1802.257) * (-1804.659) (-1804.833) (-1803.610) [-1803.283] -- 0:00:13 794000 -- (-1802.035) [-1804.544] (-1803.756) (-1803.957) * [-1806.528] (-1808.545) (-1802.341) (-1803.297) -- 0:00:13 794500 -- (-1803.265) [-1804.567] (-1802.479) (-1802.868) * [-1802.921] (-1804.120) (-1807.455) (-1802.086) -- 0:00:13 795000 -- (-1803.651) (-1805.597) (-1802.125) [-1802.253] * [-1802.749] (-1804.019) (-1804.234) (-1806.767) -- 0:00:13 Average standard deviation of split frequencies: 0.009142 795500 -- (-1804.514) (-1803.201) [-1803.603] (-1802.668) * (-1803.650) [-1804.431] (-1804.229) (-1809.319) -- 0:00:13 796000 -- (-1803.943) (-1803.108) (-1805.278) [-1804.635] * (-1802.405) [-1804.916] (-1803.163) (-1802.996) -- 0:00:13 796500 -- (-1803.524) (-1803.520) [-1808.657] (-1802.149) * (-1804.210) (-1803.123) (-1804.422) [-1802.282] -- 0:00:13 797000 -- (-1804.406) (-1807.877) [-1803.202] (-1804.821) * [-1802.181] (-1810.376) (-1804.651) (-1804.493) -- 0:00:13 797500 -- [-1804.493] (-1801.987) (-1802.982) (-1804.246) * (-1803.000) (-1809.792) (-1803.609) [-1806.282] -- 0:00:13 798000 -- (-1804.325) (-1804.542) [-1803.200] (-1803.079) * (-1806.873) (-1805.574) [-1802.149] (-1806.965) -- 0:00:13 798500 -- (-1803.426) (-1805.024) (-1804.888) [-1802.035] * [-1805.257] (-1804.669) (-1803.379) (-1806.652) -- 0:00:13 799000 -- (-1805.933) (-1803.314) [-1808.837] (-1805.988) * [-1803.841] (-1804.741) (-1805.324) (-1803.547) -- 0:00:13 799500 -- (-1805.603) (-1802.594) (-1804.356) [-1802.398] * (-1802.986) [-1802.396] (-1805.830) (-1804.861) -- 0:00:13 800000 -- (-1804.484) (-1802.435) (-1805.412) [-1803.849] * (-1807.198) [-1802.742] (-1804.383) (-1811.761) -- 0:00:12 Average standard deviation of split frequencies: 0.009126 800500 -- [-1806.134] (-1802.420) (-1802.511) (-1803.522) * [-1801.922] (-1803.523) (-1803.710) (-1810.367) -- 0:00:12 801000 -- (-1806.222) (-1807.026) (-1803.086) [-1801.996] * (-1802.331) (-1804.554) (-1804.481) [-1803.388] -- 0:00:12 801500 -- [-1809.690] (-1806.700) (-1803.312) (-1803.442) * (-1803.616) (-1803.282) [-1804.271] (-1804.834) -- 0:00:12 802000 -- (-1811.121) (-1810.242) [-1802.373] (-1805.900) * (-1806.074) (-1803.112) (-1809.388) [-1806.126] -- 0:00:12 802500 -- [-1802.710] (-1807.794) (-1802.453) (-1805.091) * (-1803.280) (-1802.546) [-1804.023] (-1804.062) -- 0:00:12 803000 -- [-1803.032] (-1808.682) (-1803.039) (-1805.928) * (-1803.686) (-1811.293) (-1805.041) [-1802.765] -- 0:00:12 803500 -- [-1803.021] (-1808.040) (-1802.297) (-1807.239) * (-1803.329) (-1806.351) [-1801.765] (-1802.438) -- 0:00:12 804000 -- [-1805.411] (-1803.299) (-1804.156) (-1809.403) * (-1804.492) (-1803.149) [-1804.835] (-1803.350) -- 0:00:12 804500 -- (-1806.630) (-1805.527) (-1804.463) [-1802.443] * (-1805.306) [-1805.110] (-1803.888) (-1806.211) -- 0:00:12 805000 -- (-1806.804) (-1803.831) (-1804.175) [-1803.705] * (-1805.095) (-1805.476) [-1803.273] (-1806.267) -- 0:00:12 Average standard deviation of split frequencies: 0.008773 805500 -- (-1803.628) [-1801.790] (-1802.412) (-1804.433) * (-1807.577) (-1805.438) (-1802.832) [-1808.457] -- 0:00:12 806000 -- [-1803.467] (-1802.556) (-1807.341) (-1804.101) * (-1810.023) [-1802.446] (-1802.808) (-1805.687) -- 0:00:12 806500 -- (-1803.376) (-1802.902) (-1805.220) [-1802.928] * (-1805.716) [-1811.159] (-1803.505) (-1803.470) -- 0:00:12 807000 -- (-1804.116) [-1804.415] (-1803.798) (-1803.204) * (-1803.315) (-1805.546) [-1805.378] (-1804.627) -- 0:00:12 807500 -- [-1805.728] (-1803.631) (-1802.860) (-1805.083) * (-1804.217) (-1803.409) [-1804.962] (-1805.718) -- 0:00:12 808000 -- (-1802.375) (-1802.539) [-1805.627] (-1803.375) * (-1804.577) (-1806.586) (-1806.088) [-1803.869] -- 0:00:12 808500 -- (-1804.463) (-1806.576) (-1804.402) [-1806.101] * (-1804.447) [-1802.768] (-1807.199) (-1803.407) -- 0:00:12 809000 -- (-1803.129) (-1808.425) [-1804.555] (-1802.421) * [-1803.870] (-1802.069) (-1804.108) (-1803.898) -- 0:00:12 809500 -- (-1803.993) (-1802.481) (-1804.640) [-1805.911] * (-1805.248) [-1804.719] (-1804.679) (-1804.985) -- 0:00:12 810000 -- [-1803.199] (-1802.219) (-1804.118) (-1805.955) * (-1803.197) (-1809.137) [-1806.167] (-1807.131) -- 0:00:12 Average standard deviation of split frequencies: 0.008654 810500 -- (-1802.891) (-1802.621) [-1805.716] (-1804.551) * (-1801.984) [-1805.910] (-1803.176) (-1804.411) -- 0:00:12 811000 -- (-1804.278) (-1802.612) (-1805.569) [-1802.870] * [-1804.061] (-1806.182) (-1804.118) (-1803.228) -- 0:00:12 811500 -- [-1802.820] (-1801.876) (-1807.154) (-1803.682) * (-1802.986) (-1806.992) [-1803.052] (-1804.869) -- 0:00:12 812000 -- (-1802.698) [-1804.397] (-1802.639) (-1804.609) * [-1803.413] (-1809.765) (-1803.408) (-1803.647) -- 0:00:12 812500 -- [-1802.670] (-1804.146) (-1803.193) (-1803.979) * (-1803.564) (-1802.916) [-1804.028] (-1807.494) -- 0:00:12 813000 -- (-1804.860) (-1805.536) (-1806.300) [-1803.668] * (-1802.002) (-1806.832) (-1803.545) [-1803.384] -- 0:00:12 813500 -- (-1802.364) (-1807.695) (-1803.452) [-1806.251] * (-1804.192) [-1803.491] (-1803.281) (-1805.188) -- 0:00:12 814000 -- (-1802.396) (-1805.178) (-1801.951) [-1802.232] * [-1804.353] (-1804.081) (-1802.403) (-1805.467) -- 0:00:12 814500 -- (-1802.314) (-1803.530) (-1802.533) [-1801.695] * (-1805.417) [-1802.061] (-1803.566) (-1804.668) -- 0:00:12 815000 -- (-1804.333) (-1807.455) (-1802.869) [-1805.554] * (-1803.594) [-1805.236] (-1805.385) (-1804.103) -- 0:00:12 Average standard deviation of split frequencies: 0.008020 815500 -- (-1802.259) (-1804.171) (-1804.840) [-1802.100] * (-1802.758) [-1802.501] (-1806.562) (-1808.064) -- 0:00:11 816000 -- (-1801.810) [-1804.525] (-1804.741) (-1804.459) * (-1802.674) (-1807.388) [-1804.603] (-1802.850) -- 0:00:11 816500 -- (-1802.022) (-1801.679) [-1804.314] (-1806.537) * (-1803.325) (-1805.665) [-1802.978] (-1802.540) -- 0:00:11 817000 -- [-1803.686] (-1802.829) (-1802.338) (-1808.624) * (-1803.946) (-1804.956) [-1803.008] (-1806.100) -- 0:00:11 817500 -- (-1812.950) [-1801.904] (-1801.640) (-1803.538) * (-1806.835) [-1804.028] (-1806.319) (-1802.896) -- 0:00:11 818000 -- (-1805.517) (-1801.881) [-1801.641] (-1803.821) * (-1803.776) (-1804.031) [-1806.601] (-1802.619) -- 0:00:11 818500 -- (-1804.224) (-1801.906) (-1801.537) [-1802.461] * (-1805.344) [-1807.341] (-1811.943) (-1803.602) -- 0:00:11 819000 -- (-1806.478) (-1807.096) [-1802.517] (-1802.756) * [-1803.050] (-1802.951) (-1808.209) (-1810.454) -- 0:00:11 819500 -- (-1803.809) (-1802.373) (-1802.512) [-1802.886] * (-1807.019) (-1802.794) (-1806.821) [-1803.976] -- 0:00:11 820000 -- (-1805.576) [-1806.402] (-1806.383) (-1804.557) * [-1804.034] (-1809.636) (-1806.844) (-1804.237) -- 0:00:11 Average standard deviation of split frequencies: 0.007704 820500 -- [-1807.292] (-1804.946) (-1808.363) (-1803.660) * [-1802.319] (-1804.938) (-1807.411) (-1804.197) -- 0:00:11 821000 -- (-1807.079) [-1806.283] (-1806.331) (-1805.895) * (-1808.867) (-1803.415) (-1802.736) [-1804.427] -- 0:00:11 821500 -- (-1802.166) (-1806.233) [-1803.021] (-1805.757) * (-1806.598) (-1806.025) (-1802.427) [-1802.355] -- 0:00:11 822000 -- (-1802.725) (-1803.330) [-1803.399] (-1803.873) * (-1805.294) (-1803.547) (-1802.647) [-1803.186] -- 0:00:11 822500 -- (-1803.269) (-1807.302) (-1804.771) [-1803.694] * (-1802.829) (-1803.541) (-1803.189) [-1803.184] -- 0:00:11 823000 -- (-1806.054) [-1803.137] (-1804.472) (-1806.253) * (-1803.221) (-1805.216) [-1803.798] (-1805.127) -- 0:00:11 823500 -- (-1803.254) (-1803.998) [-1804.243] (-1807.440) * (-1803.905) [-1805.340] (-1803.307) (-1803.501) -- 0:00:11 824000 -- (-1803.258) (-1804.050) (-1805.974) [-1804.329] * (-1807.660) [-1804.532] (-1802.857) (-1804.425) -- 0:00:11 824500 -- [-1804.299] (-1802.307) (-1803.597) (-1805.730) * (-1805.151) [-1803.304] (-1802.848) (-1803.438) -- 0:00:11 825000 -- (-1802.307) (-1802.166) (-1804.950) [-1805.541] * [-1802.100] (-1801.775) (-1807.444) (-1805.772) -- 0:00:11 Average standard deviation of split frequencies: 0.007755 825500 -- [-1803.845] (-1802.977) (-1803.650) (-1804.654) * [-1808.211] (-1802.866) (-1807.154) (-1804.697) -- 0:00:11 826000 -- (-1801.784) (-1806.158) (-1803.828) [-1805.326] * [-1804.052] (-1803.305) (-1802.938) (-1804.919) -- 0:00:11 826500 -- [-1808.102] (-1807.040) (-1804.215) (-1804.318) * (-1811.697) [-1804.263] (-1804.467) (-1805.463) -- 0:00:11 827000 -- (-1803.224) [-1804.503] (-1802.755) (-1804.302) * (-1804.344) (-1802.010) [-1811.006] (-1804.850) -- 0:00:11 827500 -- (-1802.955) [-1802.782] (-1802.407) (-1801.917) * (-1805.030) (-1804.409) (-1804.874) [-1802.027] -- 0:00:11 828000 -- (-1803.790) (-1808.346) [-1802.407] (-1809.090) * (-1802.171) (-1803.493) (-1804.695) [-1802.361] -- 0:00:11 828500 -- (-1805.893) [-1804.075] (-1804.501) (-1803.499) * (-1803.275) [-1804.173] (-1804.409) (-1802.322) -- 0:00:11 829000 -- (-1806.214) (-1805.296) [-1803.295] (-1803.447) * (-1803.211) (-1804.654) [-1801.782] (-1803.578) -- 0:00:11 829500 -- (-1806.408) [-1803.619] (-1803.405) (-1804.826) * (-1804.927) (-1803.539) (-1805.623) [-1802.196] -- 0:00:11 830000 -- (-1806.907) (-1805.646) [-1802.695] (-1801.802) * (-1805.291) (-1804.274) [-1802.835] (-1804.271) -- 0:00:11 Average standard deviation of split frequencies: 0.007478 830500 -- (-1804.280) [-1805.034] (-1804.303) (-1804.601) * (-1808.153) (-1805.530) (-1802.161) [-1804.215] -- 0:00:11 831000 -- (-1802.928) (-1805.898) [-1802.165] (-1808.015) * (-1806.193) [-1805.075] (-1802.673) (-1802.458) -- 0:00:10 831500 -- (-1805.924) (-1804.097) (-1802.194) [-1804.129] * (-1803.323) (-1806.997) [-1802.504] (-1802.250) -- 0:00:10 832000 -- (-1805.499) (-1804.204) [-1805.103] (-1811.991) * (-1807.547) (-1804.412) (-1803.037) [-1802.529] -- 0:00:10 832500 -- (-1802.249) (-1804.313) [-1804.644] (-1811.184) * (-1808.890) [-1806.261] (-1803.749) (-1803.449) -- 0:00:10 833000 -- (-1802.322) [-1807.395] (-1802.412) (-1807.537) * (-1803.536) (-1802.985) (-1803.009) [-1804.329] -- 0:00:10 833500 -- [-1802.761] (-1802.818) (-1806.096) (-1806.135) * (-1803.567) [-1802.452] (-1804.049) (-1801.742) -- 0:00:10 834000 -- (-1803.097) [-1802.417] (-1805.086) (-1807.666) * (-1805.441) (-1804.225) [-1802.291] (-1806.968) -- 0:00:10 834500 -- (-1804.418) (-1801.850) [-1803.619] (-1806.956) * [-1807.077] (-1804.757) (-1803.304) (-1808.465) -- 0:00:10 835000 -- [-1802.770] (-1802.910) (-1803.277) (-1802.559) * (-1803.309) (-1804.493) (-1804.196) [-1803.321] -- 0:00:10 Average standard deviation of split frequencies: 0.007795 835500 -- [-1801.969] (-1807.248) (-1802.963) (-1801.987) * [-1802.665] (-1802.456) (-1805.823) (-1802.955) -- 0:00:10 836000 -- [-1801.988] (-1805.677) (-1803.087) (-1803.774) * (-1804.573) (-1806.526) (-1802.374) [-1802.425] -- 0:00:10 836500 -- (-1804.131) (-1804.971) (-1801.796) [-1802.584] * [-1806.508] (-1802.476) (-1803.548) (-1802.217) -- 0:00:10 837000 -- [-1804.772] (-1805.072) (-1801.771) (-1809.989) * (-1802.698) (-1802.032) (-1807.687) [-1802.189] -- 0:00:10 837500 -- (-1802.516) (-1803.459) [-1802.056] (-1804.409) * (-1802.651) (-1804.342) (-1803.554) [-1803.919] -- 0:00:10 838000 -- (-1804.042) (-1805.382) (-1803.374) [-1805.139] * (-1803.009) [-1804.768] (-1804.880) (-1806.171) -- 0:00:10 838500 -- (-1802.908) [-1804.992] (-1804.055) (-1804.012) * [-1804.466] (-1803.119) (-1806.018) (-1811.161) -- 0:00:10 839000 -- (-1806.534) (-1806.639) [-1803.331] (-1802.717) * (-1805.608) [-1804.444] (-1805.116) (-1810.466) -- 0:00:10 839500 -- (-1804.323) (-1803.577) (-1803.382) [-1802.173] * (-1805.324) [-1802.570] (-1802.403) (-1802.696) -- 0:00:10 840000 -- (-1806.774) (-1805.262) [-1805.435] (-1804.341) * [-1802.035] (-1802.722) (-1802.408) (-1804.401) -- 0:00:10 Average standard deviation of split frequencies: 0.007653 840500 -- (-1804.365) (-1805.072) [-1805.834] (-1806.808) * (-1803.075) (-1805.970) [-1802.975] (-1804.058) -- 0:00:10 841000 -- (-1804.540) (-1804.733) (-1808.919) [-1802.693] * [-1803.235] (-1802.973) (-1803.367) (-1805.318) -- 0:00:10 841500 -- (-1803.315) [-1803.196] (-1806.383) (-1802.890) * [-1801.859] (-1801.719) (-1803.219) (-1806.524) -- 0:00:10 842000 -- (-1805.520) (-1802.874) [-1803.437] (-1804.406) * (-1802.682) [-1802.766] (-1807.512) (-1805.626) -- 0:00:10 842500 -- (-1803.733) [-1805.236] (-1806.249) (-1803.935) * [-1802.652] (-1802.057) (-1807.306) (-1805.630) -- 0:00:10 843000 -- (-1803.471) [-1802.333] (-1803.692) (-1802.296) * (-1803.242) (-1803.606) [-1803.063] (-1804.342) -- 0:00:10 843500 -- [-1802.353] (-1803.876) (-1803.251) (-1802.501) * (-1805.872) [-1805.517] (-1804.963) (-1803.676) -- 0:00:10 844000 -- (-1803.519) (-1808.848) (-1806.281) [-1802.836] * (-1803.548) (-1804.448) [-1803.895] (-1806.306) -- 0:00:10 844500 -- [-1801.895] (-1803.781) (-1802.448) (-1809.244) * (-1804.343) (-1804.248) (-1801.902) [-1802.675] -- 0:00:10 845000 -- (-1803.405) [-1804.172] (-1802.570) (-1806.563) * [-1802.805] (-1803.004) (-1803.759) (-1803.124) -- 0:00:10 Average standard deviation of split frequencies: 0.007768 845500 -- [-1803.273] (-1808.554) (-1802.414) (-1806.416) * [-1803.291] (-1803.857) (-1803.229) (-1803.722) -- 0:00:10 846000 -- (-1804.528) (-1804.301) [-1806.374] (-1805.798) * (-1807.919) (-1804.623) (-1803.812) [-1804.324] -- 0:00:10 846500 -- (-1802.022) (-1803.016) [-1807.012] (-1802.870) * (-1806.756) (-1807.201) [-1802.746] (-1804.962) -- 0:00:09 847000 -- (-1802.202) [-1802.761] (-1805.312) (-1805.752) * [-1805.838] (-1804.737) (-1804.100) (-1804.919) -- 0:00:09 847500 -- (-1802.666) [-1802.301] (-1804.321) (-1802.775) * (-1803.858) (-1803.112) [-1801.959] (-1803.240) -- 0:00:09 848000 -- (-1805.275) [-1807.790] (-1803.308) (-1803.600) * (-1803.884) [-1801.871] (-1802.225) (-1802.193) -- 0:00:09 848500 -- [-1806.232] (-1805.631) (-1804.768) (-1803.501) * [-1802.817] (-1804.483) (-1801.559) (-1801.978) -- 0:00:09 849000 -- (-1804.324) (-1806.478) [-1805.056] (-1803.277) * (-1805.776) [-1805.773] (-1804.426) (-1802.199) -- 0:00:09 849500 -- (-1808.603) (-1805.628) (-1804.446) [-1803.277] * [-1802.789] (-1805.559) (-1804.511) (-1804.234) -- 0:00:09 850000 -- (-1808.808) (-1806.742) [-1803.193] (-1803.277) * (-1802.551) (-1812.843) [-1803.917] (-1803.140) -- 0:00:09 Average standard deviation of split frequencies: 0.007889 850500 -- (-1803.019) (-1805.471) (-1805.492) [-1803.297] * (-1802.128) [-1804.945] (-1805.391) (-1803.243) -- 0:00:09 851000 -- (-1802.345) (-1803.852) (-1803.108) [-1808.118] * (-1802.426) (-1803.899) [-1802.780] (-1801.939) -- 0:00:09 851500 -- (-1802.636) (-1806.852) [-1803.510] (-1802.518) * (-1806.456) (-1801.736) (-1803.245) [-1802.233] -- 0:00:09 852000 -- (-1805.199) (-1806.813) (-1806.444) [-1803.773] * (-1807.887) (-1804.038) [-1803.011] (-1802.837) -- 0:00:09 852500 -- [-1803.238] (-1807.041) (-1803.508) (-1802.558) * (-1808.528) [-1806.427] (-1806.403) (-1803.651) -- 0:00:09 853000 -- (-1802.327) [-1802.543] (-1808.746) (-1804.128) * (-1803.835) (-1806.615) (-1804.106) [-1804.494] -- 0:00:09 853500 -- (-1802.564) (-1804.510) [-1802.820] (-1802.904) * (-1802.957) [-1804.786] (-1806.826) (-1804.212) -- 0:00:09 854000 -- (-1803.322) (-1805.593) (-1804.329) [-1802.773] * (-1803.138) (-1803.886) (-1805.692) [-1804.111] -- 0:00:09 854500 -- (-1802.622) [-1805.354] (-1805.167) (-1802.513) * (-1803.871) [-1803.727] (-1804.177) (-1805.219) -- 0:00:09 855000 -- (-1804.126) (-1814.668) (-1803.297) [-1805.710] * (-1804.853) (-1804.007) [-1804.482] (-1803.753) -- 0:00:09 Average standard deviation of split frequencies: 0.008325 855500 -- [-1802.475] (-1806.360) (-1804.955) (-1808.260) * (-1802.337) [-1802.775] (-1804.657) (-1808.852) -- 0:00:09 856000 -- (-1801.923) [-1805.487] (-1803.166) (-1806.452) * [-1801.810] (-1803.304) (-1806.452) (-1804.322) -- 0:00:09 856500 -- (-1803.026) (-1802.281) (-1803.044) [-1804.007] * [-1803.848] (-1804.846) (-1802.265) (-1803.829) -- 0:00:09 857000 -- (-1807.336) [-1802.264] (-1802.128) (-1804.145) * (-1804.385) [-1804.869] (-1803.283) (-1803.385) -- 0:00:09 857500 -- (-1806.735) (-1802.681) (-1803.483) [-1803.816] * [-1803.260] (-1802.750) (-1802.878) (-1804.108) -- 0:00:09 858000 -- [-1802.465] (-1802.803) (-1804.030) (-1802.505) * (-1803.444) [-1802.905] (-1802.931) (-1801.823) -- 0:00:09 858500 -- (-1802.081) (-1802.455) (-1803.797) [-1801.951] * (-1805.774) (-1801.847) (-1804.611) [-1805.945] -- 0:00:09 859000 -- (-1804.009) [-1805.937] (-1802.023) (-1804.633) * (-1806.184) (-1802.990) (-1804.745) [-1803.772] -- 0:00:09 859500 -- (-1802.917) (-1802.545) [-1804.677] (-1805.158) * (-1805.715) (-1805.007) [-1803.145] (-1804.091) -- 0:00:09 860000 -- (-1806.966) (-1810.673) [-1803.105] (-1803.505) * (-1803.269) [-1804.329] (-1803.480) (-1805.841) -- 0:00:09 Average standard deviation of split frequencies: 0.008377 860500 -- (-1806.319) (-1803.759) (-1804.168) [-1802.938] * (-1806.002) (-1804.292) (-1807.162) [-1805.809] -- 0:00:09 861000 -- (-1804.760) [-1803.206] (-1803.346) (-1802.985) * (-1803.159) (-1803.055) [-1807.542] (-1809.953) -- 0:00:09 861500 -- (-1802.993) [-1804.025] (-1803.705) (-1804.674) * (-1801.848) (-1804.447) [-1803.774] (-1804.050) -- 0:00:09 862000 -- [-1803.530] (-1803.530) (-1806.896) (-1805.241) * (-1803.708) (-1809.939) (-1802.877) [-1803.497] -- 0:00:08 862500 -- [-1802.180] (-1808.667) (-1807.644) (-1803.624) * [-1803.331] (-1806.528) (-1803.746) (-1803.967) -- 0:00:08 863000 -- (-1802.671) (-1805.665) [-1802.755] (-1802.147) * (-1802.881) (-1809.361) [-1804.050] (-1803.129) -- 0:00:08 863500 -- (-1804.518) [-1805.379] (-1802.131) (-1802.727) * (-1804.944) (-1808.540) (-1804.789) [-1807.266] -- 0:00:08 864000 -- (-1804.845) (-1807.152) (-1802.202) [-1805.393] * (-1802.557) (-1806.058) [-1804.692] (-1804.890) -- 0:00:08 864500 -- (-1805.286) (-1804.870) [-1802.268] (-1803.089) * [-1803.235] (-1807.780) (-1804.627) (-1804.296) -- 0:00:08 865000 -- (-1804.400) (-1804.177) [-1804.938] (-1802.789) * (-1805.007) (-1806.727) (-1802.934) [-1802.249] -- 0:00:08 Average standard deviation of split frequencies: 0.008197 865500 -- (-1804.940) (-1803.726) (-1802.877) [-1804.266] * (-1806.536) [-1805.543] (-1802.261) (-1806.430) -- 0:00:08 866000 -- (-1803.294) [-1802.373] (-1804.798) (-1802.734) * (-1804.367) (-1806.479) (-1807.888) [-1808.275] -- 0:00:08 866500 -- (-1805.290) (-1803.179) [-1804.564] (-1802.745) * (-1803.905) [-1802.889] (-1806.600) (-1804.709) -- 0:00:08 867000 -- (-1804.246) (-1805.268) (-1803.667) [-1802.187] * (-1804.713) (-1806.033) [-1802.833] (-1802.927) -- 0:00:08 867500 -- (-1804.303) [-1802.635] (-1802.381) (-1807.704) * (-1803.795) (-1802.966) (-1802.566) [-1805.017] -- 0:00:08 868000 -- (-1804.894) [-1802.649] (-1803.160) (-1802.588) * (-1802.870) [-1805.315] (-1803.501) (-1803.233) -- 0:00:08 868500 -- (-1809.809) [-1804.218] (-1803.182) (-1802.936) * (-1802.407) (-1806.242) [-1803.402] (-1810.411) -- 0:00:08 869000 -- (-1803.135) [-1803.589] (-1802.730) (-1803.235) * (-1808.473) (-1807.793) [-1804.516] (-1803.536) -- 0:00:08 869500 -- (-1802.898) [-1802.493] (-1802.188) (-1802.773) * (-1804.337) (-1802.596) [-1803.640] (-1804.115) -- 0:00:08 870000 -- (-1802.933) [-1801.883] (-1804.515) (-1805.104) * (-1803.360) (-1802.798) [-1803.916] (-1802.691) -- 0:00:08 Average standard deviation of split frequencies: 0.008440 870500 -- [-1805.669] (-1801.976) (-1804.139) (-1804.732) * [-1804.681] (-1808.567) (-1802.171) (-1801.891) -- 0:00:08 871000 -- (-1804.071) (-1807.478) (-1804.875) [-1803.571] * (-1804.964) (-1805.249) [-1802.462] (-1802.009) -- 0:00:08 871500 -- [-1805.393] (-1802.473) (-1802.622) (-1802.155) * (-1803.659) (-1805.425) [-1803.198] (-1801.983) -- 0:00:08 872000 -- (-1803.066) (-1802.608) (-1805.012) [-1803.388] * (-1803.781) (-1805.692) (-1803.467) [-1804.461] -- 0:00:08 872500 -- [-1803.157] (-1809.038) (-1810.669) (-1804.607) * (-1804.767) (-1804.267) (-1804.356) [-1803.214] -- 0:00:08 873000 -- (-1802.301) (-1804.082) [-1806.492] (-1805.233) * (-1806.227) (-1805.926) (-1806.294) [-1803.142] -- 0:00:08 873500 -- (-1804.042) (-1807.932) (-1807.247) [-1804.753] * [-1802.741] (-1803.208) (-1802.114) (-1804.905) -- 0:00:08 874000 -- (-1807.356) (-1804.609) [-1807.363] (-1804.216) * (-1805.815) [-1807.711] (-1801.725) (-1801.744) -- 0:00:08 874500 -- (-1803.036) (-1806.303) (-1804.486) [-1802.453] * (-1805.120) (-1807.261) [-1801.730] (-1801.926) -- 0:00:08 875000 -- (-1802.273) (-1804.101) (-1803.870) [-1803.680] * [-1804.973] (-1805.644) (-1801.627) (-1811.378) -- 0:00:08 Average standard deviation of split frequencies: 0.008199 875500 -- (-1806.477) (-1802.792) (-1804.695) [-1804.311] * (-1803.582) (-1806.589) (-1801.588) [-1802.162] -- 0:00:08 876000 -- (-1803.251) [-1803.936] (-1804.041) (-1807.128) * (-1802.442) (-1804.379) [-1803.158] (-1802.805) -- 0:00:08 876500 -- (-1809.223) (-1803.435) [-1807.615] (-1802.991) * (-1802.424) [-1803.766] (-1802.973) (-1803.757) -- 0:00:08 877000 -- (-1811.429) (-1802.182) (-1803.164) [-1805.214] * (-1802.769) [-1802.775] (-1804.076) (-1806.984) -- 0:00:07 877500 -- (-1802.899) (-1804.754) [-1802.637] (-1805.554) * [-1803.851] (-1804.137) (-1804.351) (-1807.234) -- 0:00:07 878000 -- [-1802.458] (-1802.173) (-1801.999) (-1804.677) * (-1803.834) (-1804.238) (-1806.516) [-1806.791] -- 0:00:07 878500 -- (-1805.076) (-1805.748) [-1802.946] (-1803.081) * (-1806.115) [-1804.385] (-1806.315) (-1806.336) -- 0:00:07 879000 -- (-1807.346) (-1803.234) [-1801.862] (-1803.046) * (-1804.585) (-1805.580) (-1802.997) [-1803.383] -- 0:00:07 879500 -- (-1804.738) (-1807.216) [-1802.745] (-1803.540) * (-1805.486) [-1804.576] (-1805.007) (-1804.831) -- 0:00:07 880000 -- (-1805.486) (-1805.136) (-1801.501) [-1803.455] * (-1804.249) [-1804.542] (-1804.146) (-1807.399) -- 0:00:07 Average standard deviation of split frequencies: 0.007935 880500 -- (-1806.541) (-1806.588) (-1801.501) [-1802.459] * (-1805.063) (-1803.990) [-1804.133] (-1806.457) -- 0:00:07 881000 -- (-1806.947) [-1802.664] (-1801.561) (-1804.468) * (-1803.207) (-1802.628) [-1804.840] (-1802.874) -- 0:00:07 881500 -- (-1806.567) (-1804.006) [-1804.253] (-1810.009) * [-1803.998] (-1803.702) (-1804.535) (-1805.108) -- 0:00:07 882000 -- (-1803.967) [-1802.193] (-1801.981) (-1807.608) * [-1804.518] (-1803.081) (-1802.157) (-1803.434) -- 0:00:07 882500 -- (-1802.575) [-1803.146] (-1802.784) (-1806.030) * (-1803.787) [-1807.853] (-1803.234) (-1805.642) -- 0:00:07 883000 -- (-1804.295) [-1803.113] (-1803.729) (-1803.203) * (-1805.246) (-1804.774) [-1806.439] (-1810.490) -- 0:00:07 883500 -- (-1807.449) (-1804.493) [-1803.836] (-1804.056) * (-1803.435) (-1803.934) [-1804.942] (-1803.658) -- 0:00:07 884000 -- (-1804.289) (-1805.470) [-1803.579] (-1805.484) * (-1803.559) (-1803.262) [-1802.715] (-1801.928) -- 0:00:07 884500 -- (-1807.830) (-1804.220) (-1803.374) [-1806.278] * (-1803.314) [-1803.565] (-1803.821) (-1805.722) -- 0:00:07 885000 -- (-1802.539) (-1802.201) [-1803.174] (-1808.501) * (-1803.054) (-1805.631) (-1805.808) [-1804.030] -- 0:00:07 Average standard deviation of split frequencies: 0.008043 885500 -- (-1804.107) [-1803.865] (-1803.596) (-1802.103) * [-1802.476] (-1804.875) (-1803.940) (-1802.783) -- 0:00:07 886000 -- (-1802.862) (-1803.802) [-1801.805] (-1802.699) * [-1804.819] (-1802.002) (-1805.288) (-1804.976) -- 0:00:07 886500 -- [-1802.348] (-1803.200) (-1801.761) (-1802.316) * (-1805.513) (-1803.416) (-1804.133) [-1803.644] -- 0:00:07 887000 -- (-1802.809) (-1806.359) [-1802.298] (-1802.477) * (-1805.190) [-1808.591] (-1804.996) (-1802.386) -- 0:00:07 887500 -- (-1803.182) [-1805.811] (-1805.224) (-1803.057) * [-1804.122] (-1801.886) (-1806.035) (-1810.126) -- 0:00:07 888000 -- (-1802.547) [-1804.776] (-1805.187) (-1804.758) * (-1802.691) (-1804.419) (-1804.916) [-1806.700] -- 0:00:07 888500 -- (-1804.061) [-1802.935] (-1806.222) (-1805.066) * (-1802.476) (-1805.044) (-1803.800) [-1803.736] -- 0:00:07 889000 -- [-1802.822] (-1804.274) (-1806.573) (-1801.870) * (-1808.716) (-1806.908) [-1804.925] (-1807.831) -- 0:00:07 889500 -- [-1802.587] (-1805.796) (-1813.277) (-1802.177) * [-1802.048] (-1803.935) (-1805.673) (-1803.647) -- 0:00:07 890000 -- (-1802.850) [-1803.468] (-1805.395) (-1802.048) * [-1801.656] (-1806.234) (-1805.398) (-1804.409) -- 0:00:07 Average standard deviation of split frequencies: 0.007970 890500 -- (-1802.382) (-1802.368) (-1805.039) [-1805.056] * (-1802.480) (-1807.616) [-1805.797] (-1804.425) -- 0:00:07 891000 -- (-1802.591) (-1810.263) (-1806.328) [-1803.684] * (-1804.350) (-1806.184) (-1804.279) [-1806.078] -- 0:00:07 891500 -- (-1803.567) (-1808.524) [-1803.159] (-1803.077) * (-1804.229) (-1802.225) (-1804.854) [-1802.152] -- 0:00:07 892000 -- (-1804.022) (-1803.787) [-1802.854] (-1802.469) * (-1805.578) (-1802.377) (-1810.901) [-1804.075] -- 0:00:07 892500 -- [-1803.957] (-1803.024) (-1801.989) (-1802.502) * (-1811.839) (-1802.235) [-1805.216] (-1806.029) -- 0:00:06 893000 -- (-1805.081) [-1803.717] (-1802.444) (-1802.460) * (-1811.629) (-1805.302) [-1805.908] (-1804.649) -- 0:00:06 893500 -- [-1804.484] (-1806.425) (-1802.022) (-1804.095) * [-1802.554] (-1803.592) (-1803.160) (-1804.740) -- 0:00:06 894000 -- [-1804.427] (-1803.904) (-1804.259) (-1804.340) * (-1805.133) (-1803.626) (-1802.645) [-1805.953] -- 0:00:06 894500 -- [-1806.085] (-1804.883) (-1802.667) (-1806.088) * (-1802.662) (-1803.804) [-1803.379] (-1806.829) -- 0:00:06 895000 -- (-1807.222) (-1802.380) [-1804.908] (-1807.574) * (-1804.072) [-1808.452] (-1804.559) (-1808.532) -- 0:00:06 Average standard deviation of split frequencies: 0.007861 895500 -- (-1803.673) [-1802.799] (-1804.330) (-1806.139) * (-1808.156) (-1808.437) [-1804.909] (-1805.669) -- 0:00:06 896000 -- [-1804.286] (-1803.122) (-1805.474) (-1805.028) * (-1806.035) (-1807.738) (-1804.208) [-1805.866] -- 0:00:06 896500 -- (-1804.383) [-1805.064] (-1805.497) (-1806.919) * (-1803.460) [-1802.492] (-1805.169) (-1806.274) -- 0:00:06 897000 -- [-1804.066] (-1803.707) (-1803.725) (-1804.145) * (-1804.355) [-1803.274] (-1805.982) (-1802.568) -- 0:00:06 897500 -- [-1804.436] (-1804.960) (-1804.054) (-1805.064) * (-1805.126) (-1807.124) (-1804.029) [-1804.353] -- 0:00:06 898000 -- (-1804.157) (-1807.958) [-1804.145] (-1805.770) * (-1805.558) (-1807.040) [-1803.870] (-1803.910) -- 0:00:06 898500 -- (-1803.460) (-1803.109) (-1803.744) [-1803.530] * [-1806.770] (-1804.262) (-1806.543) (-1803.780) -- 0:00:06 899000 -- (-1807.285) (-1802.013) (-1802.322) [-1803.035] * (-1806.423) (-1803.127) (-1806.172) [-1806.663] -- 0:00:06 899500 -- (-1803.324) (-1807.843) (-1802.719) [-1802.363] * [-1803.149] (-1804.319) (-1806.006) (-1804.590) -- 0:00:06 900000 -- (-1802.225) (-1803.541) (-1801.848) [-1803.040] * [-1803.731] (-1805.257) (-1802.231) (-1807.801) -- 0:00:06 Average standard deviation of split frequencies: 0.007589 900500 -- (-1801.810) (-1804.959) [-1804.350] (-1802.550) * [-1804.847] (-1802.771) (-1806.318) (-1805.396) -- 0:00:06 901000 -- (-1801.570) (-1806.050) (-1804.225) [-1804.745] * (-1804.123) (-1803.497) [-1803.187] (-1804.556) -- 0:00:06 901500 -- (-1801.706) (-1803.257) (-1805.044) [-1802.478] * (-1805.382) [-1802.547] (-1802.881) (-1804.527) -- 0:00:06 902000 -- (-1801.671) [-1802.322] (-1804.322) (-1807.846) * (-1805.910) [-1805.891] (-1803.213) (-1802.989) -- 0:00:06 902500 -- [-1801.709] (-1806.341) (-1802.206) (-1804.463) * (-1804.202) (-1802.116) (-1803.990) [-1805.192] -- 0:00:06 903000 -- (-1810.571) (-1803.763) [-1801.829] (-1805.701) * (-1802.680) [-1804.524] (-1802.767) (-1806.211) -- 0:00:06 903500 -- [-1803.370] (-1806.136) (-1802.312) (-1807.717) * (-1802.566) (-1808.713) [-1805.486] (-1804.443) -- 0:00:06 904000 -- (-1805.450) (-1806.398) [-1804.592] (-1808.630) * (-1802.833) (-1808.788) (-1803.213) [-1803.920] -- 0:00:06 904500 -- [-1803.794] (-1807.010) (-1802.968) (-1802.941) * (-1807.338) [-1802.827] (-1803.314) (-1802.949) -- 0:00:06 905000 -- (-1803.933) [-1803.314] (-1805.318) (-1802.515) * (-1804.315) (-1802.948) (-1803.745) [-1802.581] -- 0:00:06 Average standard deviation of split frequencies: 0.007902 905500 -- [-1803.773] (-1801.901) (-1811.385) (-1803.738) * (-1803.173) (-1803.783) [-1803.760] (-1803.408) -- 0:00:06 906000 -- (-1804.277) (-1803.788) [-1805.533] (-1802.237) * (-1804.474) [-1803.009] (-1803.824) (-1803.194) -- 0:00:06 906500 -- (-1804.439) (-1807.246) (-1802.737) [-1802.558] * (-1803.523) (-1804.119) (-1806.482) [-1802.252] -- 0:00:06 907000 -- (-1804.452) (-1804.138) (-1803.338) [-1801.938] * (-1803.544) (-1804.034) (-1802.514) [-1804.382] -- 0:00:06 907500 -- (-1805.376) (-1804.109) [-1803.309] (-1804.564) * (-1803.132) (-1802.423) (-1802.466) [-1803.141] -- 0:00:06 908000 -- (-1805.481) (-1804.750) (-1805.304) [-1807.778] * [-1803.512] (-1805.051) (-1802.968) (-1805.274) -- 0:00:05 908500 -- (-1804.528) (-1804.536) (-1802.842) [-1803.789] * (-1803.555) (-1806.721) [-1804.711] (-1803.567) -- 0:00:05 909000 -- (-1805.627) (-1804.087) [-1804.017] (-1803.055) * (-1802.204) (-1804.497) [-1811.550] (-1803.163) -- 0:00:05 909500 -- [-1802.781] (-1805.757) (-1805.842) (-1801.992) * (-1802.205) [-1803.545] (-1812.398) (-1803.450) -- 0:00:05 910000 -- (-1804.302) (-1803.254) (-1805.659) [-1801.833] * (-1803.478) [-1802.819] (-1809.863) (-1803.568) -- 0:00:05 Average standard deviation of split frequencies: 0.007441 910500 -- (-1803.822) [-1803.781] (-1803.623) (-1801.999) * (-1801.939) (-1802.777) (-1804.604) [-1803.713] -- 0:00:05 911000 -- (-1807.054) (-1803.286) (-1802.470) [-1802.650] * (-1804.792) [-1802.194] (-1803.958) (-1803.618) -- 0:00:05 911500 -- [-1804.654] (-1802.850) (-1801.776) (-1803.388) * (-1801.653) (-1806.499) [-1803.039] (-1802.025) -- 0:00:05 912000 -- (-1806.346) (-1804.255) (-1803.364) [-1805.664] * (-1804.250) (-1805.315) [-1803.203] (-1804.810) -- 0:00:05 912500 -- [-1804.612] (-1804.845) (-1802.434) (-1806.372) * (-1803.882) (-1806.371) (-1803.548) [-1803.103] -- 0:00:05 913000 -- (-1802.748) [-1805.335] (-1803.944) (-1810.827) * (-1804.531) (-1806.536) (-1805.877) [-1801.798] -- 0:00:05 913500 -- [-1802.739] (-1806.006) (-1802.669) (-1810.402) * (-1810.434) [-1806.452] (-1810.032) (-1802.791) -- 0:00:05 914000 -- (-1802.902) [-1806.366] (-1805.197) (-1807.430) * (-1803.048) (-1807.017) (-1804.303) [-1804.391] -- 0:00:05 914500 -- (-1804.589) (-1806.401) [-1802.237] (-1805.409) * (-1802.720) [-1807.200] (-1806.852) (-1802.545) -- 0:00:05 915000 -- (-1804.114) (-1805.909) (-1802.248) [-1806.613] * (-1808.845) [-1802.435] (-1804.744) (-1804.417) -- 0:00:05 Average standard deviation of split frequencies: 0.007398 915500 -- (-1802.351) (-1804.280) (-1805.445) [-1802.792] * (-1806.974) (-1807.844) [-1804.483] (-1805.137) -- 0:00:05 916000 -- (-1802.124) [-1803.738] (-1809.051) (-1805.652) * (-1804.961) (-1803.441) (-1806.010) [-1802.516] -- 0:00:05 916500 -- (-1801.746) [-1803.700] (-1806.314) (-1805.116) * (-1801.871) (-1807.431) [-1804.135] (-1803.771) -- 0:00:05 917000 -- [-1803.090] (-1802.444) (-1806.723) (-1802.498) * [-1806.283] (-1803.244) (-1804.436) (-1802.975) -- 0:00:05 917500 -- (-1802.488) (-1803.448) [-1805.256] (-1803.210) * (-1806.831) (-1804.487) [-1803.730] (-1804.662) -- 0:00:05 918000 -- (-1808.192) [-1802.221] (-1802.962) (-1803.816) * (-1805.047) [-1804.837] (-1806.242) (-1806.033) -- 0:00:05 918500 -- (-1807.262) (-1802.604) (-1802.644) [-1803.048] * [-1811.096] (-1806.800) (-1808.091) (-1802.892) -- 0:00:05 919000 -- (-1808.525) (-1803.906) [-1804.071] (-1804.906) * (-1805.063) (-1805.246) [-1805.384] (-1803.839) -- 0:00:05 919500 -- (-1806.219) [-1803.749] (-1803.426) (-1806.431) * (-1805.696) (-1803.519) (-1803.816) [-1804.176] -- 0:00:05 920000 -- (-1808.823) [-1803.777] (-1802.984) (-1805.804) * (-1802.257) (-1806.428) (-1804.122) [-1807.241] -- 0:00:05 Average standard deviation of split frequencies: 0.007712 920500 -- (-1807.833) [-1804.256] (-1805.632) (-1804.368) * [-1801.924] (-1803.549) (-1802.915) (-1804.967) -- 0:00:05 921000 -- (-1802.404) (-1802.165) (-1802.432) [-1804.219] * [-1803.671] (-1813.872) (-1804.382) (-1804.917) -- 0:00:05 921500 -- (-1802.881) [-1802.957] (-1803.148) (-1803.737) * [-1802.957] (-1805.165) (-1804.634) (-1804.984) -- 0:00:05 922000 -- (-1801.809) [-1804.669] (-1804.761) (-1803.341) * (-1803.601) [-1803.678] (-1804.162) (-1805.897) -- 0:00:05 922500 -- (-1801.571) (-1804.486) (-1806.088) [-1805.454] * (-1804.510) (-1803.244) [-1804.460] (-1803.846) -- 0:00:05 923000 -- (-1805.494) [-1804.974] (-1805.934) (-1805.699) * (-1803.944) [-1801.790] (-1809.005) (-1803.618) -- 0:00:05 923500 -- (-1810.075) (-1804.058) [-1805.890] (-1805.768) * [-1802.456] (-1805.991) (-1806.143) (-1802.395) -- 0:00:04 924000 -- [-1803.006] (-1802.808) (-1804.650) (-1804.280) * (-1802.349) (-1802.556) (-1803.141) [-1802.745] -- 0:00:04 924500 -- (-1803.391) [-1803.579] (-1805.831) (-1807.099) * (-1806.365) (-1803.010) (-1804.591) [-1802.482] -- 0:00:04 925000 -- [-1803.591] (-1802.924) (-1802.336) (-1803.936) * (-1804.197) (-1807.691) [-1804.173] (-1805.827) -- 0:00:04 Average standard deviation of split frequencies: 0.007604 925500 -- (-1802.535) (-1802.786) [-1804.811] (-1804.358) * (-1802.824) (-1802.396) [-1802.893] (-1806.669) -- 0:00:04 926000 -- (-1802.684) (-1805.692) [-1802.497] (-1805.430) * (-1803.526) (-1804.196) (-1804.894) [-1803.489] -- 0:00:04 926500 -- (-1804.437) [-1806.718] (-1805.761) (-1802.699) * [-1803.625] (-1803.356) (-1806.438) (-1803.609) -- 0:00:04 927000 -- (-1805.886) (-1808.028) (-1805.869) [-1801.854] * (-1803.296) (-1804.879) (-1805.554) [-1803.689] -- 0:00:04 927500 -- (-1807.907) (-1803.660) (-1805.935) [-1802.447] * [-1803.892] (-1806.377) (-1804.896) (-1807.622) -- 0:00:04 928000 -- (-1804.150) [-1803.788] (-1805.025) (-1802.728) * [-1803.776] (-1804.731) (-1809.658) (-1804.493) -- 0:00:04 928500 -- [-1804.267] (-1803.502) (-1802.895) (-1805.638) * (-1804.152) [-1802.840] (-1804.408) (-1802.261) -- 0:00:04 929000 -- (-1809.506) (-1803.505) [-1804.945] (-1802.778) * (-1803.775) [-1803.390] (-1808.386) (-1802.324) -- 0:00:04 929500 -- (-1804.876) (-1803.294) (-1806.631) [-1802.556] * (-1801.954) (-1803.952) [-1803.485] (-1805.999) -- 0:00:04 930000 -- [-1804.702] (-1803.822) (-1803.500) (-1805.527) * (-1805.768) (-1803.101) [-1803.613] (-1805.597) -- 0:00:04 Average standard deviation of split frequencies: 0.007598 930500 -- (-1804.569) [-1801.936] (-1802.690) (-1806.420) * (-1802.396) (-1804.638) [-1802.122] (-1804.937) -- 0:00:04 931000 -- (-1804.617) (-1802.650) (-1803.067) [-1804.095] * (-1803.818) (-1806.008) (-1802.459) [-1802.294] -- 0:00:04 931500 -- (-1803.023) (-1803.443) (-1804.177) [-1805.310] * (-1804.272) (-1804.141) [-1802.146] (-1802.798) -- 0:00:04 932000 -- (-1802.977) (-1803.175) (-1802.746) [-1803.186] * (-1802.302) (-1804.040) [-1804.154] (-1806.088) -- 0:00:04 932500 -- (-1805.445) [-1802.124] (-1804.047) (-1802.794) * [-1805.342] (-1804.829) (-1802.029) (-1802.015) -- 0:00:04 933000 -- (-1803.599) [-1806.010] (-1803.310) (-1802.915) * (-1804.899) (-1805.577) [-1802.247] (-1802.462) -- 0:00:04 933500 -- (-1806.610) [-1803.353] (-1806.177) (-1805.053) * (-1802.594) (-1803.225) [-1803.799] (-1804.834) -- 0:00:04 934000 -- (-1803.962) (-1803.229) [-1805.866] (-1806.854) * (-1801.723) (-1801.844) (-1802.167) [-1804.790] -- 0:00:04 934500 -- [-1802.624] (-1803.682) (-1804.317) (-1807.721) * (-1805.716) (-1801.897) [-1802.618] (-1803.215) -- 0:00:04 935000 -- (-1803.750) (-1802.363) [-1803.336] (-1806.994) * (-1804.093) [-1803.099] (-1801.633) (-1805.928) -- 0:00:04 Average standard deviation of split frequencies: 0.007649 935500 -- (-1803.995) [-1803.808] (-1804.281) (-1805.108) * (-1805.220) (-1808.704) [-1802.543] (-1803.502) -- 0:00:04 936000 -- (-1803.346) (-1804.332) [-1804.058] (-1803.307) * [-1806.308] (-1802.936) (-1806.410) (-1803.968) -- 0:00:04 936500 -- (-1801.638) (-1803.523) (-1803.584) [-1802.653] * (-1803.221) [-1805.918] (-1806.522) (-1802.428) -- 0:00:04 937000 -- (-1810.207) [-1804.561] (-1804.443) (-1804.402) * (-1803.497) [-1803.785] (-1803.136) (-1804.228) -- 0:00:04 937500 -- (-1809.425) (-1803.325) [-1807.270] (-1802.194) * (-1803.503) (-1802.184) [-1802.161] (-1808.228) -- 0:00:04 938000 -- (-1804.016) (-1803.897) [-1804.701] (-1804.582) * (-1805.542) [-1802.146] (-1801.991) (-1802.719) -- 0:00:04 938500 -- (-1803.610) (-1805.462) [-1803.111] (-1804.765) * (-1803.500) [-1804.220] (-1802.067) (-1802.527) -- 0:00:03 939000 -- (-1805.832) [-1803.450] (-1805.702) (-1804.928) * [-1803.519] (-1803.179) (-1802.377) (-1804.117) -- 0:00:03 939500 -- (-1804.384) (-1803.644) (-1802.615) [-1802.514] * (-1805.406) (-1803.306) [-1802.115] (-1803.856) -- 0:00:03 940000 -- (-1804.472) [-1806.613] (-1803.053) (-1802.079) * (-1804.567) (-1802.624) [-1802.166] (-1801.870) -- 0:00:03 Average standard deviation of split frequencies: 0.007799 940500 -- (-1805.379) (-1806.172) (-1803.606) [-1806.937] * (-1803.662) (-1804.709) (-1802.150) [-1803.209] -- 0:00:03 941000 -- (-1802.199) (-1804.286) [-1804.957] (-1806.443) * (-1805.402) (-1805.727) (-1804.744) [-1806.094] -- 0:00:03 941500 -- (-1802.388) [-1807.664] (-1805.198) (-1804.198) * [-1804.764] (-1804.460) (-1804.066) (-1805.295) -- 0:00:03 942000 -- (-1806.762) (-1802.470) [-1803.628] (-1803.025) * [-1805.103] (-1804.661) (-1804.281) (-1809.707) -- 0:00:03 942500 -- (-1807.205) [-1802.302] (-1803.452) (-1802.077) * (-1804.354) (-1803.132) [-1802.734] (-1803.310) -- 0:00:03 943000 -- (-1807.747) (-1803.543) (-1803.260) [-1803.966] * (-1804.953) (-1805.022) [-1802.508] (-1803.882) -- 0:00:03 943500 -- (-1803.181) [-1803.581] (-1802.682) (-1806.880) * (-1804.297) (-1803.112) [-1805.415] (-1804.926) -- 0:00:03 944000 -- (-1803.482) (-1807.443) [-1802.268] (-1805.682) * (-1805.508) (-1803.689) [-1810.822] (-1803.710) -- 0:00:03 944500 -- (-1802.360) (-1803.652) [-1805.915] (-1805.832) * (-1803.535) (-1802.634) [-1804.233] (-1804.514) -- 0:00:03 945000 -- (-1802.829) [-1804.564] (-1803.280) (-1803.715) * (-1804.885) [-1803.229] (-1804.337) (-1803.097) -- 0:00:03 Average standard deviation of split frequencies: 0.007475 945500 -- (-1807.213) (-1803.697) [-1801.761] (-1805.459) * [-1805.389] (-1804.367) (-1802.667) (-1801.820) -- 0:00:03 946000 -- [-1804.494] (-1802.182) (-1803.314) (-1804.776) * (-1806.294) (-1802.962) [-1803.374] (-1801.820) -- 0:00:03 946500 -- (-1802.686) (-1802.250) [-1805.970] (-1806.587) * (-1808.620) (-1802.313) [-1801.697] (-1806.864) -- 0:00:03 947000 -- (-1802.457) (-1802.426) [-1803.107] (-1806.394) * [-1802.584] (-1805.333) (-1801.747) (-1804.681) -- 0:00:03 947500 -- (-1802.589) (-1803.241) [-1802.623] (-1805.680) * (-1803.348) (-1803.837) (-1810.048) [-1802.458] -- 0:00:03 948000 -- (-1807.500) (-1805.686) [-1801.875] (-1802.798) * [-1803.913] (-1803.692) (-1807.311) (-1804.013) -- 0:00:03 948500 -- [-1802.592] (-1803.723) (-1804.077) (-1802.486) * (-1806.722) (-1806.619) (-1810.409) [-1804.607] -- 0:00:03 949000 -- (-1805.016) (-1803.036) [-1802.647] (-1802.186) * [-1802.466] (-1808.744) (-1804.767) (-1803.686) -- 0:00:03 949500 -- (-1803.946) (-1804.674) (-1804.801) [-1802.441] * [-1804.000] (-1811.909) (-1804.376) (-1805.599) -- 0:00:03 950000 -- (-1804.032) (-1804.422) [-1804.357] (-1804.490) * (-1803.372) [-1804.478] (-1803.909) (-1804.238) -- 0:00:03 Average standard deviation of split frequencies: 0.007593 950500 -- (-1802.409) (-1805.154) (-1806.213) [-1803.291] * [-1803.773] (-1804.278) (-1808.805) (-1802.923) -- 0:00:03 951000 -- (-1802.200) [-1805.437] (-1804.531) (-1805.286) * (-1801.832) (-1806.562) [-1804.653] (-1802.592) -- 0:00:03 951500 -- (-1803.370) (-1806.270) (-1805.259) [-1805.971] * (-1804.858) (-1806.973) [-1805.815] (-1802.182) -- 0:00:03 952000 -- (-1807.935) (-1804.369) (-1804.087) [-1803.771] * (-1806.123) (-1806.133) (-1803.040) [-1803.659] -- 0:00:03 952500 -- (-1802.405) (-1803.966) [-1805.773] (-1803.392) * (-1808.430) (-1802.773) (-1806.000) [-1802.260] -- 0:00:03 953000 -- (-1803.169) [-1802.362] (-1802.879) (-1802.944) * (-1805.305) (-1808.582) [-1806.241] (-1804.169) -- 0:00:03 953500 -- [-1802.378] (-1802.690) (-1802.992) (-1802.944) * [-1804.800] (-1803.644) (-1805.819) (-1806.036) -- 0:00:03 954000 -- (-1802.068) (-1803.135) (-1806.579) [-1803.712] * (-1804.506) [-1805.082] (-1806.577) (-1803.482) -- 0:00:02 954500 -- (-1804.153) [-1803.740] (-1803.806) (-1802.144) * (-1804.072) (-1807.452) (-1805.075) [-1804.346] -- 0:00:02 955000 -- (-1804.515) (-1804.936) (-1803.092) [-1804.314] * (-1806.594) [-1809.317] (-1804.787) (-1807.926) -- 0:00:02 Average standard deviation of split frequencies: 0.007489 955500 -- (-1803.656) (-1813.983) [-1802.021] (-1803.374) * (-1804.833) [-1803.848] (-1803.223) (-1802.305) -- 0:00:02 956000 -- [-1803.357] (-1805.634) (-1802.239) (-1804.654) * (-1804.795) (-1803.560) [-1802.885] (-1804.170) -- 0:00:02 956500 -- (-1803.444) (-1805.455) (-1802.444) [-1802.225] * (-1804.710) (-1803.945) (-1806.548) [-1804.445] -- 0:00:02 957000 -- (-1805.920) [-1803.780] (-1802.938) (-1804.012) * (-1804.191) (-1804.904) (-1804.200) [-1807.151] -- 0:00:02 957500 -- [-1803.332] (-1803.698) (-1802.736) (-1803.973) * (-1804.366) (-1807.697) (-1802.122) [-1806.292] -- 0:00:02 958000 -- (-1802.859) (-1804.130) (-1802.694) [-1805.307] * (-1802.376) (-1803.143) [-1804.076] (-1805.817) -- 0:00:02 958500 -- (-1804.369) (-1804.091) (-1802.348) [-1802.793] * [-1802.810] (-1802.757) (-1804.520) (-1805.232) -- 0:00:02 959000 -- (-1805.388) (-1802.859) [-1805.917] (-1804.793) * (-1809.920) [-1803.218] (-1803.464) (-1806.151) -- 0:00:02 959500 -- (-1804.302) [-1806.770] (-1805.656) (-1804.533) * (-1806.687) (-1803.004) [-1801.948] (-1806.703) -- 0:00:02 960000 -- (-1803.817) (-1803.848) (-1804.695) [-1804.624] * (-1805.351) (-1804.483) [-1804.672] (-1804.480) -- 0:00:02 Average standard deviation of split frequencies: 0.007943 960500 -- (-1803.732) (-1804.471) (-1807.464) [-1802.458] * [-1804.072] (-1808.233) (-1805.423) (-1803.171) -- 0:00:02 961000 -- [-1803.618] (-1803.048) (-1803.140) (-1802.645) * (-1803.424) [-1802.517] (-1803.425) (-1803.642) -- 0:00:02 961500 -- (-1803.151) [-1803.002] (-1803.463) (-1802.394) * (-1803.924) (-1802.769) [-1805.081] (-1802.000) -- 0:00:02 962000 -- (-1802.041) [-1804.031] (-1802.284) (-1803.653) * (-1803.978) (-1803.559) (-1808.259) [-1802.231] -- 0:00:02 962500 -- (-1802.120) [-1806.572] (-1804.200) (-1803.810) * (-1804.434) (-1804.832) (-1804.454) [-1803.111] -- 0:00:02 963000 -- (-1803.414) [-1806.230] (-1802.119) (-1803.154) * [-1804.337] (-1804.759) (-1804.552) (-1803.256) -- 0:00:02 963500 -- (-1804.579) (-1802.951) (-1801.907) [-1805.997] * (-1806.682) (-1804.157) [-1805.132] (-1803.189) -- 0:00:02 964000 -- [-1802.850] (-1805.059) (-1804.426) (-1803.177) * (-1803.774) [-1804.300] (-1803.948) (-1805.391) -- 0:00:02 964500 -- (-1810.342) (-1805.405) [-1802.948] (-1806.881) * (-1803.408) (-1802.128) [-1804.052] (-1805.308) -- 0:00:02 965000 -- (-1802.736) [-1802.143] (-1804.159) (-1806.199) * [-1802.957] (-1802.309) (-1810.010) (-1805.676) -- 0:00:02 Average standard deviation of split frequencies: 0.007777 965500 -- (-1802.759) (-1802.172) [-1802.910] (-1803.936) * [-1802.251] (-1809.126) (-1808.176) (-1802.615) -- 0:00:02 966000 -- (-1804.314) (-1805.388) [-1802.181] (-1803.729) * [-1805.192] (-1801.925) (-1802.520) (-1804.658) -- 0:00:02 966500 -- (-1805.938) [-1808.501] (-1803.959) (-1806.625) * [-1802.359] (-1804.854) (-1802.796) (-1805.168) -- 0:00:02 967000 -- (-1805.837) (-1802.962) [-1801.688] (-1803.706) * (-1802.325) [-1809.575] (-1803.683) (-1806.803) -- 0:00:02 967500 -- (-1802.405) (-1804.227) (-1802.488) [-1806.156] * (-1803.889) [-1806.159] (-1803.836) (-1812.180) -- 0:00:02 968000 -- (-1803.118) (-1802.825) (-1803.174) [-1805.596] * (-1806.286) (-1806.855) [-1805.273] (-1805.269) -- 0:00:02 968500 -- (-1805.329) [-1802.416] (-1802.248) (-1804.706) * (-1804.592) (-1804.123) (-1803.932) [-1805.603] -- 0:00:02 969000 -- (-1803.747) (-1806.361) [-1802.354] (-1805.380) * [-1802.001] (-1806.150) (-1805.077) (-1803.641) -- 0:00:02 969500 -- (-1802.036) [-1802.628] (-1803.167) (-1805.748) * (-1803.799) (-1803.783) [-1803.288] (-1803.078) -- 0:00:01 970000 -- (-1801.930) (-1802.696) (-1801.978) [-1802.859] * (-1806.406) [-1807.169] (-1804.912) (-1805.637) -- 0:00:01 Average standard deviation of split frequencies: 0.008013 970500 -- (-1807.950) (-1804.504) [-1802.556] (-1803.163) * (-1805.895) (-1806.873) [-1804.270] (-1801.950) -- 0:00:01 971000 -- (-1804.618) (-1802.361) [-1803.273] (-1806.475) * [-1807.930] (-1805.287) (-1805.637) (-1801.856) -- 0:00:01 971500 -- (-1804.140) (-1802.061) [-1806.965] (-1804.546) * (-1803.500) (-1802.229) (-1803.694) [-1804.757] -- 0:00:01 972000 -- (-1807.153) [-1804.296] (-1802.640) (-1803.993) * (-1807.000) (-1804.193) (-1804.672) [-1804.388] -- 0:00:01 972500 -- (-1805.963) (-1803.547) (-1803.597) [-1805.190] * (-1808.107) (-1804.193) [-1808.985] (-1802.463) -- 0:00:01 973000 -- (-1802.175) [-1802.799] (-1803.590) (-1802.611) * (-1807.621) (-1802.866) (-1804.082) [-1802.566] -- 0:00:01 973500 -- (-1803.239) [-1801.754] (-1810.777) (-1805.644) * (-1802.260) (-1803.379) (-1803.026) [-1802.645] -- 0:00:01 974000 -- (-1804.561) [-1804.838] (-1802.482) (-1801.438) * [-1803.679] (-1803.628) (-1808.352) (-1802.753) -- 0:00:01 974500 -- [-1803.352] (-1802.533) (-1801.900) (-1807.822) * (-1806.952) (-1804.600) (-1803.242) [-1802.517] -- 0:00:01 975000 -- (-1803.463) (-1803.188) (-1802.537) [-1801.644] * (-1802.507) (-1803.402) [-1803.196] (-1803.163) -- 0:00:01 Average standard deviation of split frequencies: 0.008000 975500 -- (-1804.803) (-1808.095) (-1804.857) [-1804.225] * (-1802.507) (-1803.877) [-1803.398] (-1802.723) -- 0:00:01 976000 -- (-1804.733) (-1803.021) [-1805.934] (-1803.061) * (-1803.313) [-1802.106] (-1803.173) (-1803.653) -- 0:00:01 976500 -- (-1804.485) (-1802.814) (-1805.295) [-1808.254] * (-1803.784) [-1803.203] (-1802.172) (-1802.861) -- 0:00:01 977000 -- (-1804.708) (-1803.790) (-1803.784) [-1804.619] * (-1802.842) (-1803.705) (-1804.348) [-1803.738] -- 0:00:01 977500 -- (-1803.572) (-1804.772) (-1806.791) [-1803.855] * (-1804.017) (-1804.632) (-1805.493) [-1803.175] -- 0:00:01 978000 -- [-1801.901] (-1803.810) (-1805.849) (-1804.093) * [-1804.088] (-1802.303) (-1806.467) (-1803.891) -- 0:00:01 978500 -- (-1802.758) [-1807.011] (-1805.931) (-1807.673) * [-1804.285] (-1804.624) (-1803.659) (-1802.809) -- 0:00:01 979000 -- (-1804.175) (-1803.590) (-1806.237) [-1805.509] * [-1806.020] (-1806.483) (-1802.506) (-1806.890) -- 0:00:01 979500 -- (-1803.294) (-1805.758) [-1805.191] (-1805.470) * [-1806.972] (-1809.837) (-1804.920) (-1803.921) -- 0:00:01 980000 -- (-1804.596) (-1807.077) [-1806.173] (-1803.684) * [-1806.563] (-1806.490) (-1806.690) (-1804.188) -- 0:00:01 Average standard deviation of split frequencies: 0.007932 980500 -- [-1807.934] (-1804.638) (-1807.048) (-1802.971) * [-1802.153] (-1804.919) (-1803.092) (-1802.063) -- 0:00:01 981000 -- [-1803.485] (-1806.836) (-1802.614) (-1809.929) * (-1803.569) (-1803.743) (-1808.772) [-1802.125] -- 0:00:01 981500 -- [-1803.144] (-1805.434) (-1803.762) (-1804.326) * (-1802.792) (-1803.966) [-1806.390] (-1803.968) -- 0:00:01 982000 -- (-1802.445) (-1804.820) [-1801.810] (-1803.231) * (-1803.713) (-1806.334) [-1805.891] (-1804.398) -- 0:00:01 982500 -- (-1805.340) (-1803.479) (-1801.542) [-1802.373] * [-1804.369] (-1804.881) (-1808.757) (-1804.013) -- 0:00:01 983000 -- [-1803.834] (-1807.362) (-1801.542) (-1802.121) * (-1803.885) (-1804.611) (-1804.461) [-1805.110] -- 0:00:01 983500 -- (-1804.865) [-1804.214] (-1802.171) (-1803.348) * [-1810.106] (-1804.863) (-1804.331) (-1803.875) -- 0:00:01 984000 -- (-1803.970) (-1804.336) [-1804.931] (-1806.422) * (-1803.665) (-1803.416) [-1803.342] (-1804.307) -- 0:00:01 984500 -- (-1803.871) (-1806.436) (-1803.324) [-1803.650] * (-1804.560) (-1804.387) (-1801.910) [-1803.040] -- 0:00:01 985000 -- (-1802.723) [-1806.763] (-1802.960) (-1803.119) * (-1803.682) (-1806.052) (-1803.579) [-1808.435] -- 0:00:00 Average standard deviation of split frequencies: 0.007978 985500 -- (-1802.460) (-1802.678) (-1803.485) [-1805.426] * (-1803.717) (-1805.978) [-1802.064] (-1808.620) -- 0:00:00 986000 -- (-1802.995) (-1806.916) [-1803.747] (-1809.079) * (-1803.918) (-1805.685) [-1802.446] (-1803.638) -- 0:00:00 986500 -- (-1805.563) (-1805.340) [-1804.676] (-1807.377) * (-1808.041) (-1809.598) [-1802.486] (-1806.428) -- 0:00:00 987000 -- (-1807.895) [-1803.339] (-1804.998) (-1804.258) * (-1805.500) [-1805.706] (-1807.663) (-1802.859) -- 0:00:00 987500 -- (-1807.551) [-1806.459] (-1804.515) (-1805.647) * (-1803.265) [-1803.781] (-1807.320) (-1804.719) -- 0:00:00 988000 -- (-1803.636) [-1803.447] (-1807.560) (-1803.472) * [-1807.160] (-1803.575) (-1804.335) (-1803.959) -- 0:00:00 988500 -- (-1805.273) (-1806.227) [-1805.029] (-1804.782) * [-1805.604] (-1802.753) (-1806.346) (-1802.552) -- 0:00:00 989000 -- [-1803.354] (-1803.579) (-1804.710) (-1810.595) * [-1805.078] (-1801.412) (-1807.198) (-1802.359) -- 0:00:00 989500 -- (-1804.812) (-1802.597) (-1802.484) [-1801.887] * (-1803.975) (-1805.760) (-1804.469) [-1806.460] -- 0:00:00 990000 -- [-1803.600] (-1805.137) (-1805.227) (-1801.936) * (-1803.691) (-1807.191) (-1807.062) [-1805.288] -- 0:00:00 Average standard deviation of split frequencies: 0.008000 990500 -- (-1804.497) (-1802.810) (-1805.695) [-1801.774] * (-1811.306) (-1803.275) (-1808.810) [-1802.065] -- 0:00:00 991000 -- (-1804.149) [-1802.909] (-1802.634) (-1802.063) * [-1803.151] (-1803.395) (-1803.893) (-1801.885) -- 0:00:00 991500 -- (-1803.025) [-1801.667] (-1801.903) (-1802.006) * (-1808.517) (-1807.400) [-1803.670] (-1805.686) -- 0:00:00 992000 -- (-1805.268) [-1802.255] (-1802.842) (-1802.078) * (-1804.075) (-1803.295) [-1803.581] (-1806.652) -- 0:00:00 992500 -- (-1803.513) (-1802.890) [-1802.848] (-1802.879) * (-1802.963) (-1802.501) (-1805.225) [-1806.870] -- 0:00:00 993000 -- (-1803.517) (-1807.746) [-1803.789] (-1803.649) * (-1802.716) (-1802.906) (-1803.750) [-1805.173] -- 0:00:00 993500 -- (-1803.211) [-1807.692] (-1804.741) (-1806.769) * [-1802.713] (-1801.939) (-1808.901) (-1803.767) -- 0:00:00 994000 -- (-1807.279) (-1803.722) (-1803.242) [-1802.461] * [-1803.643] (-1803.779) (-1805.082) (-1802.223) -- 0:00:00 994500 -- (-1804.884) (-1803.581) [-1803.844] (-1803.263) * [-1805.532] (-1804.258) (-1803.383) (-1803.452) -- 0:00:00 995000 -- (-1804.054) [-1804.404] (-1803.269) (-1803.486) * (-1803.520) (-1805.044) [-1803.653] (-1802.820) -- 0:00:00 Average standard deviation of split frequencies: 0.007987 995500 -- [-1802.701] (-1805.042) (-1804.377) (-1806.741) * (-1804.872) (-1806.519) (-1804.328) [-1801.898] -- 0:00:00 996000 -- (-1802.599) (-1805.444) (-1803.378) [-1802.808] * [-1804.340] (-1806.565) (-1802.954) (-1804.045) -- 0:00:00 996500 -- (-1806.125) [-1802.300] (-1802.896) (-1805.838) * (-1807.012) (-1804.484) (-1803.722) [-1803.912] -- 0:00:00 997000 -- [-1805.789] (-1802.350) (-1803.377) (-1808.417) * (-1808.481) (-1803.957) [-1805.294] (-1803.927) -- 0:00:00 997500 -- (-1806.694) [-1803.295] (-1804.139) (-1803.260) * (-1805.243) (-1802.477) [-1803.539] (-1803.403) -- 0:00:00 998000 -- (-1802.376) (-1802.729) (-1809.617) [-1803.576] * (-1804.807) (-1804.553) [-1802.911] (-1802.719) -- 0:00:00 998500 -- (-1803.592) (-1802.070) [-1809.539] (-1804.977) * (-1803.799) (-1807.297) [-1804.347] (-1803.506) -- 0:00:00 999000 -- (-1802.709) (-1804.166) (-1804.624) [-1803.669] * (-1804.089) [-1802.017] (-1803.568) (-1804.101) -- 0:00:00 999500 -- (-1804.658) (-1809.280) (-1808.374) [-1802.649] * (-1805.974) [-1804.971] (-1803.445) (-1802.338) -- 0:00:00 1000000 -- (-1804.851) [-1804.641] (-1806.685) (-1801.843) * (-1804.844) (-1804.665) (-1802.818) [-1805.371] -- 0:00:00 Average standard deviation of split frequencies: 0.007861 Analysis completed in 1 mins 5 seconds Analysis used 63.70 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1801.40 Likelihood of best state for "cold" chain of run 2 was -1801.40 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.2 % ( 69 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 24.5 % ( 34 %) Dirichlet(Pi{all}) 26.8 % ( 27 %) Slider(Pi{all}) 79.1 % ( 48 %) Multiplier(Alpha{1,2}) 77.5 % ( 55 %) Multiplier(Alpha{3}) 15.1 % ( 22 %) Slider(Pinvar{all}) 98.6 % ( 96 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 29 %) Multiplier(V{all}) 97.4 % ( 95 %) Nodeslider(V{all}) 30.7 % ( 33 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.7 % ( 77 %) Dirichlet(Revmat{all}) 100.0 % ( 99 %) Slider(Revmat{all}) 24.4 % ( 21 %) Dirichlet(Pi{all}) 27.0 % ( 33 %) Slider(Pi{all}) 78.8 % ( 43 %) Multiplier(Alpha{1,2}) 77.4 % ( 47 %) Multiplier(Alpha{3}) 16.5 % ( 27 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 70 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 93 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 25 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.7 % ( 30 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166135 0.82 0.67 3 | 166819 165971 0.84 4 | 167101 167171 166803 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166436 0.82 0.67 3 | 166811 167021 0.84 4 | 167050 166439 166243 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1803.05 | 1 1 | | 2 2 | | 1 2 | | 1 2 1 22 1 | | 22 2 11 1 2 1 2 | | 12 2 1 1 1 * 1 1 *22 1 1 12 1| | 2 1 2 22 1 222 2 21 11 11 21 1 1 1 | |1 11 11 1 2 1 2 21 21 2 1 1 | | 2 *2 21 1 12 2 1 22 1 | | 1 21 2 21 12 1 2 2 2| | 1 1 1 2 2 2 2 2 | | 2 2 12 2 21 | | 2 | | | |2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1804.97 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1803.14 -1806.69 2 -1803.17 -1807.40 -------------------------------------- TOTAL -1803.16 -1807.11 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899728 0.089985 0.380307 1.488092 0.859996 1385.10 1407.42 1.000 r(A<->C){all} 0.166821 0.017628 0.000096 0.422422 0.138128 127.69 184.34 1.003 r(A<->G){all} 0.161828 0.019231 0.000081 0.450881 0.124797 135.00 160.07 1.010 r(A<->T){all} 0.167782 0.020531 0.000034 0.450589 0.128824 104.46 138.65 1.000 r(C<->G){all} 0.159060 0.018234 0.000043 0.427855 0.122378 249.47 265.69 1.000 r(C<->T){all} 0.169945 0.019186 0.000014 0.448325 0.134431 195.66 201.27 1.010 r(G<->T){all} 0.174564 0.020877 0.000033 0.446645 0.139569 240.99 252.74 1.001 pi(A){all} 0.192691 0.000113 0.171881 0.213033 0.192663 992.62 1202.87 1.000 pi(C){all} 0.272581 0.000147 0.249100 0.296842 0.272610 845.94 1118.06 1.000 pi(G){all} 0.331396 0.000175 0.304848 0.355895 0.331303 1239.77 1310.10 1.000 pi(T){all} 0.203332 0.000128 0.182778 0.226500 0.203238 1206.25 1306.05 1.000 alpha{1,2} 0.412906 0.210173 0.000162 1.370993 0.254511 1049.19 1157.39 1.000 alpha{3} 0.455855 0.243377 0.000211 1.414357 0.287267 1263.47 1348.92 1.000 pinvar{all} 0.998801 0.000002 0.996160 0.999999 0.999271 1015.72 1115.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ..*..* 8 -- ..**.. 9 -- .***.* 10 -- .*..*. 11 -- .****. 12 -- .*...* 13 -- .**.** 14 -- ...**. 15 -- ..*.*. 16 -- ..**** 17 -- .*.*.. 18 -- .**... 19 -- ...*.* 20 -- .*.*** 21 -- ....** 22 -- .**..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 458 0.152565 0.010364 0.145237 0.159893 2 8 455 0.151566 0.011777 0.143238 0.159893 2 9 444 0.147901 0.006595 0.143238 0.152565 2 10 443 0.147568 0.002355 0.145903 0.149234 2 11 437 0.145570 0.012719 0.136576 0.154564 2 12 436 0.145237 0.005653 0.141239 0.149234 2 13 432 0.143904 0.012248 0.135243 0.152565 2 14 426 0.141905 0.009422 0.135243 0.148568 2 15 426 0.141905 0.013191 0.132578 0.151233 2 16 420 0.139907 0.006595 0.135243 0.144570 2 17 415 0.138241 0.002355 0.136576 0.139907 2 18 410 0.136576 0.000942 0.135909 0.137242 2 19 410 0.136576 0.006595 0.131912 0.141239 2 20 409 0.136243 0.005182 0.132578 0.139907 2 21 402 0.133911 0.002827 0.131912 0.135909 2 22 280 0.093271 0.016959 0.081279 0.105263 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099321 0.010113 0.000017 0.295422 0.068595 1.000 2 length{all}[2] 0.097711 0.009279 0.000016 0.286365 0.068462 1.000 2 length{all}[3] 0.100515 0.010225 0.000040 0.302406 0.067934 1.000 2 length{all}[4] 0.095444 0.009442 0.000000 0.291891 0.065564 1.000 2 length{all}[5] 0.098458 0.009620 0.000019 0.304395 0.067693 1.000 2 length{all}[6] 0.099339 0.009065 0.000065 0.290535 0.070524 1.000 2 length{all}[7] 0.106971 0.011820 0.000153 0.302628 0.075519 0.998 2 length{all}[8] 0.109945 0.010364 0.000039 0.331822 0.073701 0.999 2 length{all}[9] 0.102463 0.010443 0.000044 0.317120 0.065465 0.998 2 length{all}[10] 0.099377 0.008363 0.000040 0.275298 0.071886 1.002 2 length{all}[11] 0.096615 0.010208 0.000105 0.296948 0.067023 0.998 2 length{all}[12] 0.104338 0.011033 0.000056 0.307348 0.071892 0.999 2 length{all}[13] 0.100869 0.008654 0.000239 0.275274 0.074130 1.002 2 length{all}[14] 0.096060 0.010205 0.000386 0.296809 0.067888 1.002 2 length{all}[15] 0.107626 0.010619 0.000048 0.330927 0.074318 0.998 2 length{all}[16] 0.099285 0.009306 0.000018 0.301488 0.068492 0.998 2 length{all}[17] 0.100707 0.012042 0.000257 0.303131 0.064981 0.998 2 length{all}[18] 0.102124 0.010216 0.000028 0.289601 0.071433 1.003 2 length{all}[19] 0.102765 0.010329 0.000095 0.297640 0.076376 0.998 2 length{all}[20] 0.112004 0.012069 0.000128 0.325999 0.080945 1.002 2 length{all}[21] 0.101735 0.009565 0.000011 0.292500 0.071646 1.003 2 length{all}[22] 0.106215 0.009943 0.000485 0.295936 0.079374 1.012 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007861 Maximum standard deviation of split frequencies = 0.016959 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.012 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /---------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | |--------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------- C4 (4) | |--------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1323 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 59 patterns at 441 / 441 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 59 patterns at 441 / 441 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 57584 bytes for conP 5192 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.075563 0.014286 0.051918 0.069791 0.084373 0.107933 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1922.624109 Iterating by ming2 Initial: fx= 1922.624109 x= 0.07556 0.01429 0.05192 0.06979 0.08437 0.10793 0.30000 1.30000 1 h-m-p 0.0000 0.0000 1056.8421 ++ 1885.946559 m 0.0000 13 | 1/8 2 h-m-p 0.0003 0.0036 120.3515 ++ 1877.636893 m 0.0036 24 | 2/8 3 h-m-p 0.0006 0.0028 96.8243 ++ 1876.038756 m 0.0028 35 | 3/8 4 h-m-p 0.0000 0.0002 362.7425 ++ 1845.915731 m 0.0002 46 | 4/8 5 h-m-p 0.0004 0.0018 119.4846 ++ 1822.752981 m 0.0018 57 | 5/8 6 h-m-p 0.0000 0.0002 287.8614 ++ 1811.836746 m 0.0002 68 | 6/8 7 h-m-p 0.0160 8.0000 8.6729 -------------.. | 6/8 8 h-m-p 0.0000 0.0004 417.9623 +++ 1747.548447 m 0.0004 102 | 7/8 9 h-m-p 1.6000 8.0000 0.0000 ++ 1747.548447 m 8.0000 113 | 7/8 10 h-m-p 0.0160 8.0000 0.0006 +++++ 1747.548446 m 8.0000 128 | 7/8 11 h-m-p 0.0160 8.0000 0.4838 ----------Y 1747.548446 0 0.0000 150 | 7/8 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1747.548446 m 8.0000 165 | 7/8 13 h-m-p 0.0160 8.0000 0.4313 ---------C 1747.548446 0 0.0000 186 | 7/8 14 h-m-p 0.0160 8.0000 0.0002 ------------Y 1747.548446 0 0.0000 210 | 7/8 15 h-m-p 0.0160 8.0000 0.0000 --------C 1747.548446 0 0.0000 230 Out.. lnL = -1747.548446 231 lfun, 231 eigenQcodon, 1386 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.020752 0.030111 0.060692 0.081524 0.082968 0.057208 0.000100 0.549243 0.580142 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 10.482922 np = 9 lnL0 = -1889.907535 Iterating by ming2 Initial: fx= 1889.907535 x= 0.02075 0.03011 0.06069 0.08152 0.08297 0.05721 0.00011 0.54924 0.58014 1 h-m-p 0.0000 0.0000 1033.6041 ++ 1887.431508 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 595.1776 +++ 1836.352625 m 0.0002 27 | 2/9 3 h-m-p 0.0000 0.0001 345.2108 ++ 1819.271692 m 0.0001 39 | 3/9 4 h-m-p 0.0001 0.0015 175.7210 ++ 1751.130921 m 0.0015 51 | 4/9 5 h-m-p 0.0000 0.0000 43244.8565 ++ 1750.908160 m 0.0000 63 | 5/9 6 h-m-p 0.0000 0.0000 58096.1885 ++ 1748.062312 m 0.0000 75 | 6/9 7 h-m-p 0.0000 0.0000 2905.1096 ++ 1747.548378 m 0.0000 87 | 7/9 8 h-m-p 1.6000 8.0000 0.0001 ++ 1747.548378 m 8.0000 99 | 7/9 9 h-m-p 0.0042 2.1109 0.4836 ---------Y 1747.548378 0 0.0000 122 | 7/9 10 h-m-p 0.0160 8.0000 0.0004 +++++ 1747.548377 m 8.0000 139 | 7/9 11 h-m-p 0.0087 1.9302 0.4045 ---------C 1747.548377 0 0.0000 162 | 7/9 12 h-m-p 0.0160 8.0000 0.0008 +++++ 1747.548374 m 8.0000 179 | 7/9 13 h-m-p 0.0175 2.0543 0.3850 -----------C 1747.548374 0 0.0000 204 | 7/9 14 h-m-p 0.0160 8.0000 0.0001 ---Y 1747.548374 0 0.0001 221 | 7/9 15 h-m-p 0.0160 8.0000 0.0000 +++++ 1747.548374 m 8.0000 238 | 7/9 16 h-m-p 0.0015 0.7455 0.9645 -----------.. | 7/9 17 h-m-p 0.0160 8.0000 0.0005 +++++ 1747.548373 m 8.0000 278 | 7/9 18 h-m-p 0.0139 3.7191 0.2633 ----------Y 1747.548373 0 0.0000 302 | 7/9 19 h-m-p 0.0160 8.0000 0.0188 +++++ 1747.548277 m 8.0000 319 | 7/9 20 h-m-p 0.4814 3.6655 0.3132 --------------C 1747.548277 0 0.0000 347 | 7/9 21 h-m-p 0.0160 8.0000 0.0001 -------Y 1747.548277 0 0.0000 368 | 7/9 22 h-m-p 0.0160 8.0000 0.0000 +++++ 1747.548277 m 8.0000 385 | 7/9 23 h-m-p 0.0010 0.5037 1.2462 ---------C 1747.548277 0 0.0000 408 | 7/9 24 h-m-p 0.0160 8.0000 0.0000 ----N 1747.548277 0 0.0000 424 | 7/9 25 h-m-p 0.0160 8.0000 0.0001 ------------Y 1747.548277 0 0.0000 450 Out.. lnL = -1747.548277 451 lfun, 1353 eigenQcodon, 5412 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M2:NSpselection reset. 0.095431 0.054426 0.044979 0.100551 0.050940 0.060557 0.000100 0.901908 0.430366 0.161657 2.829423 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 8.946022 np = 11 lnL0 = -1899.812756 Iterating by ming2 Initial: fx= 1899.812756 x= 0.09543 0.05443 0.04498 0.10055 0.05094 0.06056 0.00011 0.90191 0.43037 0.16166 2.82942 1 h-m-p 0.0000 0.0000 797.5713 ++ 1899.239086 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 346.0872 +++ 1846.631738 m 0.0005 31 | 2/11 3 h-m-p 0.0002 0.0009 362.0251 ++ 1767.641359 m 0.0009 45 | 3/11 4 h-m-p 0.0002 0.0010 229.4610 ++ 1757.395281 m 0.0010 59 | 4/11 5 h-m-p 0.0000 0.0002 682.6544 ++ 1754.027950 m 0.0002 73 | 5/11 6 h-m-p 0.0000 0.0001 4967.3896 ++ 1750.519125 m 0.0001 87 | 6/11 7 h-m-p 0.0000 0.0000 523757.2881 ++ 1749.805092 m 0.0000 101 | 7/11 8 h-m-p 0.0000 0.0000 27064.9125 ++ 1747.548452 m 0.0000 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0013 ++ 1747.548451 m 8.0000 129 | 8/11 10 h-m-p 0.0076 3.2841 1.4017 ----------C 1747.548451 0 0.0000 156 | 8/11 11 h-m-p 0.0160 8.0000 0.0002 +++++ 1747.548451 m 8.0000 173 | 8/11 12 h-m-p 0.0160 8.0000 2.2796 ------------Y 1747.548451 0 0.0000 202 | 8/11 13 h-m-p 0.0160 8.0000 0.0011 +++++ 1747.548450 m 8.0000 219 | 8/11 14 h-m-p 0.0160 8.0000 2.0861 -----------C 1747.548450 0 0.0000 247 | 8/11 15 h-m-p 0.0160 8.0000 0.0005 -------N 1747.548450 0 0.0000 268 | 8/11 16 h-m-p 0.0160 8.0000 0.0002 ------Y 1747.548450 0 0.0000 291 Out.. lnL = -1747.548450 292 lfun, 1168 eigenQcodon, 5256 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1747.568321 S = -1747.541638 -0.010250 Calculating f(w|X), posterior probabilities of site classes. did 10 / 59 patterns 0:03 did 20 / 59 patterns 0:03 did 30 / 59 patterns 0:03 did 40 / 59 patterns 0:03 did 50 / 59 patterns 0:03 did 59 / 59 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.050198 0.054284 0.047564 0.046666 0.106319 0.092756 0.000100 0.905304 1.675156 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 17.287516 np = 9 lnL0 = -1910.070698 Iterating by ming2 Initial: fx= 1910.070698 x= 0.05020 0.05428 0.04756 0.04667 0.10632 0.09276 0.00011 0.90530 1.67516 1 h-m-p 0.0000 0.0000 959.1059 ++ 1909.415390 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0071 127.3152 +++++ 1809.016341 m 0.0071 29 | 2/9 3 h-m-p 0.0000 0.0001 991.0967 ++ 1764.351652 m 0.0001 41 | 3/9 4 h-m-p 0.0005 0.0025 84.6461 ++ 1750.067001 m 0.0025 53 | 4/9 5 h-m-p 0.0000 0.0000 358.2515 ++ 1750.002813 m 0.0000 65 | 5/9 6 h-m-p 0.0000 0.0000 7434.0025 ++ 1749.783674 m 0.0000 77 | 6/9 7 h-m-p 0.0016 0.8117 119.5724 QuantileBeta(0.15, 0.00500, 2.15176) = 1.227994e-160 2000 rounds -----------.. | 6/9 8 h-m-p 0.0000 0.0000 578.2079 ++ 1749.190812 m 0.0000 110 | 7/9 9 h-m-p 0.0160 8.0000 1.0302 -------------.. | 7/9 10 h-m-p 0.0000 0.0000 408.3455 ++ 1747.547906 m 0.0000 145 | 8/9 11 h-m-p 1.6000 8.0000 0.0000 +N 1747.547906 0 6.4000 158 | 8/9 12 h-m-p 1.6000 8.0000 0.0000 N 1747.547906 0 1.6000 171 Out.. lnL = -1747.547906 172 lfun, 1892 eigenQcodon, 10320 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M8:NSbetaw>1 reset. 0.045668 0.089665 0.067788 0.075193 0.055667 0.079578 0.000100 0.900000 1.031052 1.925116 2.830266 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 12.523447 np = 11 lnL0 = -1900.887051 Iterating by ming2 Initial: fx= 1900.887051 x= 0.04567 0.08966 0.06779 0.07519 0.05567 0.07958 0.00011 0.90000 1.03105 1.92512 2.83027 1 h-m-p 0.0000 0.0000 807.5764 ++ 1900.445400 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 2051.5153 ++ 1804.128671 m 0.0001 30 | 2/11 3 h-m-p 0.0000 0.0001 570.1229 ++ 1783.845781 m 0.0001 44 | 3/11 4 h-m-p 0.0012 0.0186 35.5555 ++ 1765.026857 m 0.0186 58 | 3/11 5 h-m-p 0.0000 0.0000 191.6304 h-m-p: 0.00000000e+00 0.00000000e+00 1.91630445e+02 1765.026857 .. | 3/11 6 h-m-p 0.0000 0.0000 835.4770 ++ 1760.931904 m 0.0000 83 | 4/11 7 h-m-p 0.0000 0.0000 3649.4838 ++ 1753.671103 m 0.0000 97 | 5/11 8 h-m-p 0.0000 0.0000 334440.1804 ++ 1750.837525 m 0.0000 111 | 6/11 9 h-m-p 0.0001 0.0005 67.2946 ++ 1747.548302 m 0.0005 125 | 7/11 10 h-m-p 1.6000 8.0000 0.0004 -----------C 1747.548302 0 0.0000 150 Out.. lnL = -1747.548302 151 lfun, 1812 eigenQcodon, 9966 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1747.599683 S = -1747.543835 -0.024791 Calculating f(w|X), posterior probabilities of site classes. did 10 / 59 patterns 0:09 did 20 / 59 patterns 0:09 did 30 / 59 patterns 0:09 did 40 / 59 patterns 0:09 did 50 / 59 patterns 0:09 did 59 / 59 patterns 0:10 Time used: 0:10 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=441 NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML NC_002677_1_NP_302581_1_1453_ML2440 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL NC_002677_1_NP_302581_1_1453_ML2440 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV NC_002677_1_NP_302581_1_1453_ML2440 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI NC_002677_1_NP_302581_1_1453_ML2440 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA NC_002677_1_NP_302581_1_1453_ML2440 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG NC_002677_1_NP_302581_1_1453_ML2440 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV NC_002677_1_NP_302581_1_1453_ML2440 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR NC_002677_1_NP_302581_1_1453_ML2440 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR ************************************************** NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG NC_002677_1_NP_302581_1_1453_ML2440 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG *****************************************
>NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >NC_002677_1_NP_302581_1_1453_ML2440 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC >NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 GTGTTCTCGGCTCTGTTGTTGGCCGGGGTATTGTCCGGGTTGGCGTTTGT TGTTGGTATTGTGGCAGGAATCCGGCTGTCGCCGCGACTAATCGAACGCC GGCAAAGACTGGCTAACGAATGGGCGGGCATCACTGTTTTGCAGATGCTG CAACGCATCATCGCGTTGATGCCGCTAGGTGCTGCGGTGGTTGATACCTA TCGTGATGTAGTTTACCTCAACGAACAGGCCAAGGAGCTAGGACTCGTGC GCGACCGGCAGCTCGATGACCAGGCCTGGCGGGCAGCACAGCAGGCGCTG GGCGGTGACGATGTCGAATTTGACCTGTTGCCCGGAAAACGCCCGGCTGC GGGCCGGTCTGGGTTATCGGTGCACGGCCACGCTCGACTGCTAAGTGAGA AAGACCGCCGGTTCGCCGTGGTCTTCGTCCACGACCAGTCCGACTATGTG CGCATGGAGGCGGCTAGGCGTGACTTCGTAGCCAATGTTAGCCACGAGCT CAAGACCCCGGTCGGCGCCATGGCCTTGCTAGCTGAGGCTCTGCTGGCAT CGGCGGATGACGCCGAAACCGTGAGCCGGTTCGCCGAGAAGGTGCTCATC GAGGCCAATCGATTAGGATACATGGTTGCTGAGCTCATAGAGTTGTCCCG GCTGCAGGGCGCCGAGCGGCTGCCTAACGTAACGGACATTGACGTCGATA TCATCGTGTCCGAGGCGATTGCGCGCCATAAGGTGGCCGCCGACACCGCT GCTATCGAGGTTCGCACCGATCCGCCTAGCGGTTTGCGGGTATTGGGCGA CCAAACTCTACTGGTTACCGCGCTAGCCAATCTGGTGTCCAACGCGATTG CCTACTCGCCGGGTGGTTCGCTGGTGTCGATCAGCCGTCGCCGTCGTGGC GACAATATCGAGATCGCCGTCACCGACCGCGGCATTGGCATCGCTCTTGA AGATCAGGAGCGGGTCTTCGAACGCTTCTTCCGCGGAGACAAGGCGCGCT CGCGGGCTACCGGTGGCAGCGGGCTGGGGCTGGCCATCGTCAAACACGTT GCCGCCAACCACAATGGCAGTATCGGTGTGTGGAGCAAGCCGGGAACCGG ATCTACGTTCACCCTGTCTATTCCGGCGGCCATGCCGCTTTACCAGGACA ACGATGAGCAATCCGGGCAACCCCGGGGCTGCGATATGTGGCTCAATAGG CCGCAACGAGAGGAAGAAGAGTTTAAGTCGATGACACCCGCGCAGGCGAT GATGCAGAGCGAAGTGACGAGAGGGAATGTGAATGATAAGTGTCCTGATT GTGGAGGACGAGGAATCGCTGGC
>NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >NC_002677_1_NP_302581_1_1453_ML2440 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG >NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 VFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQML QRIIALMPLGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQAL GGDDVEFDLLPGKRPAAGRSGLSVHGHARLLSEKDRRFAVVFVHDQSDYV RMEAARRDFVANVSHELKTPVGAMALLAEALLASADDAETVSRFAEKVLI EANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSEAIARHKVAADTA AIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRRRG DNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHV AANHNGSIGVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNR PQREEEEFKSMTPAQAMMQSEVTRGNVNDKCPDCGGRGIAG
#NEXUS [ID: 5820271966] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 NC_002677_1_NP_302581_1_1453_ML2440 NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 ; end; begin trees; translate 1 NC_011896_1_WP_010908900_1_2609_MLBR_RS12415, 2 NC_002677_1_NP_302581_1_1453_ML2440, 3 NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190, 4 NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615, 5 NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425, 6 NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.068595,2:0.06846226,3:0.06793435,4:0.06556434,5:0.06769312,6:0.07052436); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.068595,2:0.06846226,3:0.06793435,4:0.06556434,5:0.06769312,6:0.07052436); end;
Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1803.14 -1806.69 2 -1803.17 -1807.40 -------------------------------------- TOTAL -1803.16 -1807.11 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2440/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899728 0.089985 0.380307 1.488092 0.859996 1385.10 1407.42 1.000 r(A<->C){all} 0.166821 0.017628 0.000096 0.422422 0.138128 127.69 184.34 1.003 r(A<->G){all} 0.161828 0.019231 0.000081 0.450881 0.124797 135.00 160.07 1.010 r(A<->T){all} 0.167782 0.020531 0.000034 0.450589 0.128824 104.46 138.65 1.000 r(C<->G){all} 0.159060 0.018234 0.000043 0.427855 0.122378 249.47 265.69 1.000 r(C<->T){all} 0.169945 0.019186 0.000014 0.448325 0.134431 195.66 201.27 1.010 r(G<->T){all} 0.174564 0.020877 0.000033 0.446645 0.139569 240.99 252.74 1.001 pi(A){all} 0.192691 0.000113 0.171881 0.213033 0.192663 992.62 1202.87 1.000 pi(C){all} 0.272581 0.000147 0.249100 0.296842 0.272610 845.94 1118.06 1.000 pi(G){all} 0.331396 0.000175 0.304848 0.355895 0.331303 1239.77 1310.10 1.000 pi(T){all} 0.203332 0.000128 0.182778 0.226500 0.203238 1206.25 1306.05 1.000 alpha{1,2} 0.412906 0.210173 0.000162 1.370993 0.254511 1049.19 1157.39 1.000 alpha{3} 0.455855 0.243377 0.000211 1.414357 0.287267 1263.47 1348.92 1.000 pinvar{all} 0.998801 0.000002 0.996160 0.999999 0.999271 1015.72 1115.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2440/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 441 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 3 3 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2 TTC 9 9 9 9 9 9 | TCC 6 6 6 6 6 6 | TAC 4 4 4 4 4 4 | TGC 1 1 1 1 1 1 Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 11 11 11 11 11 11 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5 CTC 7 7 7 7 7 7 | CCC 3 3 3 3 3 3 | CAC 6 6 6 6 6 6 | CGC 13 13 13 13 13 13 CTA 7 7 7 7 7 7 | CCA 0 0 0 0 0 0 | Gln CAA 6 6 6 6 6 6 | CGA 5 5 5 5 5 5 CTG 17 17 17 17 17 17 | CCG 10 10 10 10 10 10 | CAG 12 12 12 12 12 12 | CGG 13 13 13 13 13 13 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 6 6 6 6 6 6 | Thr ACT 2 2 2 2 2 2 | Asn AAT 8 8 8 8 8 8 | Ser AGT 2 2 2 2 2 2 ATC 16 16 16 16 16 16 | ACC 10 10 10 10 10 10 | AAC 6 6 6 6 6 6 | AGC 7 7 7 7 7 7 ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 2 2 2 2 2 2 Met ATG 10 10 10 10 10 10 | ACG 3 3 3 3 3 3 | AAG 8 8 8 8 8 8 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 10 10 10 10 10 10 | Ala GCT 14 14 14 14 14 14 | Asp GAT 12 12 12 12 12 12 | Gly GGT 8 8 8 8 8 8 GTC 8 8 8 8 8 8 | GCC 20 20 20 20 20 20 | GAC 17 17 17 17 17 17 | GGC 14 14 14 14 14 14 GTA 5 5 5 5 5 5 | GCA 4 4 4 4 4 4 | Glu GAA 10 10 10 10 10 10 | GGA 10 10 10 10 10 10 GTG 16 16 16 16 16 16 | GCG 16 16 16 16 16 16 | GAG 17 17 17 17 17 17 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908900_1_2609_MLBR_RS12415 position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 #2: NC_002677_1_NP_302581_1_1453_ML2440 position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 #3: NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190 position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 #4: NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615 position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 #5: NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425 position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 #6: NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755 position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 18 | Ser S TCT 18 | Tyr Y TAT 12 | Cys C TGT 12 TTC 54 | TCC 36 | TAC 24 | TGC 6 Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0 TTG 66 | TCG 54 | TAG 0 | Trp W TGG 24 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 18 | His H CAT 6 | Arg R CGT 30 CTC 42 | CCC 18 | CAC 36 | CGC 78 CTA 42 | CCA 0 | Gln Q CAA 36 | CGA 30 CTG 102 | CCG 60 | CAG 72 | CGG 78 ------------------------------------------------------------------------------ Ile I ATT 36 | Thr T ACT 12 | Asn N AAT 48 | Ser S AGT 12 ATC 96 | ACC 60 | AAC 36 | AGC 42 ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 12 Met M ATG 60 | ACG 18 | AAG 48 | AGG 12 ------------------------------------------------------------------------------ Val V GTT 60 | Ala A GCT 84 | Asp D GAT 72 | Gly G GGT 48 GTC 48 | GCC 120 | GAC 102 | GGC 84 GTA 30 | GCA 24 | Glu E GAA 60 | GGA 60 GTG 96 | GCG 96 | GAG 102 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.12698 C:0.24943 A:0.19728 G:0.42630 position 2: T:0.29478 C:0.23583 A:0.25397 G:0.21542 position 3: T:0.18821 C:0.33333 A:0.12698 G:0.35147 Average T:0.20333 C:0.27286 A:0.19274 G:0.33107 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1747.548446 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.652836 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908900_1_2609_MLBR_RS12415: 0.000004, NC_002677_1_NP_302581_1_1453_ML2440: 0.000004, NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190: 0.000004, NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615: 0.000004, NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425: 0.000004, NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 0.65284 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1019.5 303.5 0.6528 0.0000 0.0000 0.0 0.0 7..2 0.000 1019.5 303.5 0.6528 0.0000 0.0000 0.0 0.0 7..3 0.000 1019.5 303.5 0.6528 0.0000 0.0000 0.0 0.0 7..4 0.000 1019.5 303.5 0.6528 0.0000 0.0000 0.0 0.0 7..5 0.000 1019.5 303.5 0.6528 0.0000 0.0000 0.0 0.0 7..6 0.000 1019.5 303.5 0.6528 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1747.548277 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.902265 0.185864 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908900_1_2609_MLBR_RS12415: 0.000004, NC_002677_1_NP_302581_1_1453_ML2440: 0.000004, NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190: 0.000004, NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615: 0.000004, NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425: 0.000004, NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.90226 0.09774 w: 0.18586 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1019.5 303.5 0.2654 0.0000 0.0000 0.0 0.0 7..2 0.000 1019.5 303.5 0.2654 0.0000 0.0000 0.0 0.0 7..3 0.000 1019.5 303.5 0.2654 0.0000 0.0000 0.0 0.0 7..4 0.000 1019.5 303.5 0.2654 0.0000 0.0000 0.0 0.0 7..5 0.000 1019.5 303.5 0.2654 0.0000 0.0000 0.0 0.0 7..6 0.000 1019.5 303.5 0.2654 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1747.548450 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.778248 0.078743 0.000001 4.144569 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908900_1_2609_MLBR_RS12415: 0.000004, NC_002677_1_NP_302581_1_1453_ML2440: 0.000004, NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190: 0.000004, NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615: 0.000004, NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425: 0.000004, NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.77825 0.07874 0.14301 w: 0.00000 1.00000 4.14457 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1019.5 303.5 0.6715 0.0000 0.0000 0.0 0.0 7..2 0.000 1019.5 303.5 0.6715 0.0000 0.0000 0.0 0.0 7..3 0.000 1019.5 303.5 0.6715 0.0000 0.0000 0.0 0.0 7..4 0.000 1019.5 303.5 0.6715 0.0000 0.0000 0.0 0.0 7..5 0.000 1019.5 303.5 0.6715 0.0000 0.0000 0.0 0.0 7..6 0.000 1019.5 303.5 0.6715 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908900_1_2609_MLBR_RS12415) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908900_1_2609_MLBR_RS12415) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1747.547906 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.957676 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908900_1_2609_MLBR_RS12415: 0.000004, NC_002677_1_NP_302581_1_1453_ML2440: 0.000004, NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190: 0.000004, NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615: 0.000004, NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425: 0.000004, NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.95768 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1019.5 303.5 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 1019.5 303.5 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 1019.5 303.5 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 1019.5 303.5 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 1019.5 303.5 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 1019.5 303.5 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1747.548302 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.963249 0.526432 2.164861 3.177795 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908900_1_2609_MLBR_RS12415: 0.000004, NC_002677_1_NP_302581_1_1453_ML2440: 0.000004, NZ_LVXE01000039_1_WP_010908900_1_1676_A3216_RS10190: 0.000004, NZ_LYPH01000045_1_WP_010908900_1_1806_A8144_RS08615: 0.000004, NZ_CP029543_1_WP_010908900_1_2636_DIJ64_RS13425: 0.000004, NZ_AP014567_1_WP_010908900_1_2702_JK2ML_RS13755: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.96325 p = 0.52643 q = 2.16486 (p1 = 0.03675) w = 3.17780 MLEs of dN/dS (w) for site classes (K=11) p: 0.09632 0.09632 0.09632 0.09632 0.09632 0.09632 0.09632 0.09632 0.09632 0.09632 0.03675 w: 0.00139 0.01126 0.03015 0.05839 0.09700 0.14785 0.21424 0.30241 0.42647 0.63644 3.17780 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 1019.5 303.5 0.3023 0.0000 0.0000 0.0 0.0 7..2 0.000 1019.5 303.5 0.3023 0.0000 0.0000 0.0 0.0 7..3 0.000 1019.5 303.5 0.3023 0.0000 0.0000 0.0 0.0 7..4 0.000 1019.5 303.5 0.3023 0.0000 0.0000 0.0 0.0 7..5 0.000 1019.5 303.5 0.3023 0.0000 0.0000 0.0 0.0 7..6 0.000 1019.5 303.5 0.3023 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908900_1_2609_MLBR_RS12415) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908900_1_2609_MLBR_RS12415) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.096 0.097 0.098 0.099 0.099 0.100 0.101 0.102 0.103 0.104 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096 Time used: 0:10
Model 1: NearlyNeutral -1747.548277 Model 2: PositiveSelection -1747.54845 Model 0: one-ratio -1747.548446 Model 7: beta -1747.547906 Model 8: beta&w>1 -1747.548302 Model 0 vs 1 3.3799999982875306E-4 Model 2 vs 1 3.45999999808555E-4 Model 8 vs 7 7.919999998193816E-4