--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:21:48 GMT 2020 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=500000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=1250 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=1250 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/8res/ML2331/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1041.42 -1046.90 2 -1041.42 -1046.61 -------------------------------------- TOTAL -1041.42 -1046.77 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 1502 samples from 2 runs. Each run produced 1001 samples of which 751 samples were included. Parameter summaries saved to file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.895202 0.089328 0.325676 1.456397 0.868260 729.96 740.48 1.000 r(A<->C){all} 0.168432 0.019310 0.000043 0.443438 0.136281 93.78 107.07 1.002 r(A<->G){all} 0.192433 0.024017 0.000022 0.503135 0.155764 41.84 79.21 1.001 r(A<->T){all} 0.169539 0.021820 0.000240 0.466215 0.128169 69.01 120.24 1.006 r(C<->G){all} 0.154293 0.016582 0.000276 0.406617 0.117219 54.48 98.75 1.002 r(C<->T){all} 0.145424 0.016265 0.000134 0.395582 0.110449 63.26 119.80 1.032 r(G<->T){all} 0.169880 0.020505 0.000020 0.457476 0.131016 95.05 134.20 1.008 pi(A){all} 0.196097 0.000199 0.168737 0.222238 0.195464 300.40 466.37 1.000 pi(C){all} 0.326833 0.000284 0.297580 0.360595 0.326626 660.63 705.82 1.000 pi(G){all} 0.297105 0.000277 0.266385 0.329805 0.297330 612.57 615.96 1.000 pi(T){all} 0.179965 0.000191 0.153129 0.204972 0.179892 650.52 652.47 1.000 alpha{1,2} 0.416760 0.222502 0.000250 1.381453 0.251733 457.58 501.57 1.001 alpha{3} 0.455643 0.229273 0.000172 1.445714 0.295882 445.76 480.74 0.999 pinvar{all} 0.997970 0.000006 0.993335 0.999996 0.998708 381.36 490.88 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -963.741326 Model 2: PositiveSelection -963.741329 Model 0: one-ratio -963.741338 Model 3: discrete -963.741298 Model 7: beta -963.741343 Model 8: beta&w>1 -963.741282 Model 0 vs 1 2.40000001667795E-5 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 1.2200000014672696E-4
>C1 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C2 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C3 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C4 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C5 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRARoooooo oooooo >C6 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRARoooooo oooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=268 C1 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH C2 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH C3 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH C4 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH C5 ------------MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH C6 ------------MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH ************************************** C1 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL C2 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL C3 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL C4 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL C5 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL C6 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL ************************************************** C1 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG C2 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG C3 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG C4 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG C5 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG C6 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG ************************************************** C1 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD C2 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD C3 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD C4 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD C5 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD C6 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD ************************************************** C1 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA C2 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA C3 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA C4 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA C5 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA C6 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA ************************************************** C1 TQSRAR------------ C2 TQSRAR------------ C3 TQSRAR------------ C4 TQSRAR------------ C5 TQSRARoooooooooooo C6 TQSRARoooooooooooo ****** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 256 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 256 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8056] Library Relaxation: Multi_proc [96] Relaxation Summary: [8056]--->[7756] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.498 Mb, Max= 30.818 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV C2 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV C3 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV C4 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV C5 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV C6 MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGHNGSNDASISRQV ************************************************** C1 PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG C2 PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG C3 PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG C4 PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG C5 PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG C6 PTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAALDGLGVRTALSRG ************************************************** C1 DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP C2 DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP C3 DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP C4 DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP C5 DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP C6 DDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRGFHVIYSAPPLNP ************************************************** C1 VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI C2 VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI C3 VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI C4 VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI C5 VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI C6 VQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSDLAGLNLAQYSSI ************************************************** C1 LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRAR C2 LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRAR C3 LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRAR C4 LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRAR C5 LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRAR C6 LIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLATQSRAR ******************************************** FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:97 BS:97 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT C2 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT C3 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT C4 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT C5 ------------------------------------ATGGTCGTAGGCCT C6 ------------------------------------ATGGTCGTAGGCCT ************** C1 ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT C2 ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT C3 ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT C4 ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT C5 ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT C6 ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT ************************************************** C1 CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC C2 CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC C3 CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC C4 CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC C5 CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC C6 CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC ************************************************** C1 AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG C2 AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG C3 AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG C4 AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG C5 AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG C6 AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG ************************************************** C1 CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC C2 CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC C3 CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC C4 CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC C5 CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC C6 CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC ************************************************** C1 CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG C2 CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG C3 CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG C4 CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG C5 CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG C6 CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG ************************************************** C1 GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT C2 GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT C3 GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT C4 GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT C5 GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT C6 GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT ************************************************** C1 GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA C2 GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA C3 GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA C4 GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA C5 GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA C6 GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ************************************************** C1 ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC C2 ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC C3 ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC C4 ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC C5 ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC C6 ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC ************************************************** C1 TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC C2 TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC C3 TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC C4 TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC C5 TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC C6 TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ************************************************** C1 ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA C2 ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA C3 ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA C4 ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA C5 ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA C6 ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA ************************************************** C1 TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT C2 TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT C3 TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT C4 TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT C5 TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT C6 TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT ************************************************** C1 TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG C2 TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG C3 TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG C4 TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG C5 TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG C6 TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG ************************************************** C1 CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA C2 CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA C3 CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA C4 CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA C5 CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA C6 CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA ************************************************** C1 GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC C2 GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC C3 GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC C4 GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC C5 GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC C6 GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ************************************************** C1 ACCCAGAGCCGAGCGCGC-------------------------------- C2 ACCCAGAGCCGAGCGCGC-------------------------------- C3 ACCCAGAGCCGAGCGCGC-------------------------------- C4 ACCCAGAGCCGAGCGCGC-------------------------------- C5 ACCCAGAGCCGAGCGCGC-------------------------------- C6 ACCCAGAGCCGAGCGCGC-------------------------------- ****************** C1 ---- C2 ---- C3 ---- C4 ---- C5 ---- C6 ---- >C1 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >C2 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >C3 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >C4 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >C5 ------------------------------------ATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >C6 ------------------------------------ATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >C1 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C2 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C3 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C4 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C5 ooooooooooooMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >C6 ooooooooooooMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 804 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579857643 Setting output file names to "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1120727022 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 500000 Running Markov chain MCMC stamp = 5933904565 Seed = 1239129787 Swapseed = 1579857643 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 9 unique site patterns Division 2 has 9 unique site patterns Division 3 has 9 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1711.938893 -- -24.965149 Chain 2 -- -1708.707616 -- -24.965149 Chain 3 -- -1711.795445 -- -24.965149 Chain 4 -- -1708.712947 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1711.805618 -- -24.965149 Chain 2 -- -1711.928583 -- -24.965149 Chain 3 -- -1711.933081 -- -24.965149 Chain 4 -- -1711.938893 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (500000 generations requested): 0 -- [-1711.939] (-1708.708) (-1711.795) (-1708.713) * [-1711.806] (-1711.929) (-1711.933) (-1711.939) 500 -- [-1051.168] (-1072.135) (-1054.315) (-1055.015) * (-1074.773) (-1066.024) [-1067.801] (-1065.634) -- 0:00:00 1000 -- (-1059.533) (-1054.361) [-1050.284] (-1062.100) * (-1052.638) [-1052.674] (-1057.353) (-1050.339) -- 0:00:00 1500 -- [-1048.750] (-1047.825) (-1054.827) (-1053.106) * (-1052.471) (-1058.000) (-1049.712) [-1047.171] -- 0:00:00 2000 -- (-1056.176) (-1053.328) (-1045.571) [-1054.201] * (-1053.083) (-1052.954) (-1054.025) [-1055.468] -- 0:00:00 2500 -- (-1047.364) (-1055.911) (-1049.964) [-1047.954] * (-1053.676) [-1049.312] (-1050.871) (-1050.214) -- 0:00:00 3000 -- (-1050.152) (-1055.019) (-1050.327) [-1060.616] * [-1064.471] (-1052.908) (-1049.298) (-1049.771) -- 0:00:00 3500 -- (-1056.698) (-1056.579) [-1048.545] (-1052.836) * (-1054.026) [-1054.906] (-1047.278) (-1049.144) -- 0:00:00 4000 -- [-1058.765] (-1053.113) (-1051.493) (-1047.113) * (-1056.506) [-1056.992] (-1049.717) (-1048.970) -- 0:00:00 4500 -- (-1049.338) [-1050.689] (-1051.545) (-1046.211) * (-1056.567) [-1053.294] (-1050.107) (-1049.715) -- 0:00:00 5000 -- (-1067.128) (-1054.390) (-1056.487) [-1048.331] * (-1054.750) (-1056.688) [-1050.929] (-1046.023) -- 0:00:00 Average standard deviation of split frequencies: 0.075151 5500 -- (-1056.563) [-1048.892] (-1049.125) (-1048.717) * (-1050.659) (-1063.600) (-1047.651) [-1041.141] -- 0:00:00 6000 -- [-1051.481] (-1045.241) (-1049.447) (-1052.566) * [-1046.262] (-1049.234) (-1058.491) (-1041.756) -- 0:00:00 6500 -- (-1047.943) (-1059.104) (-1050.761) [-1044.985] * (-1052.608) [-1054.417] (-1058.879) (-1044.351) -- 0:00:00 7000 -- (-1056.673) [-1052.733] (-1054.544) (-1048.798) * (-1050.925) (-1052.795) [-1049.170] (-1043.558) -- 0:00:00 7500 -- (-1050.281) (-1051.753) [-1047.949] (-1052.224) * [-1055.837] (-1062.721) (-1049.217) (-1041.963) -- 0:00:00 8000 -- (-1043.316) (-1054.097) [-1053.790] (-1049.256) * (-1051.656) (-1051.505) [-1046.151] (-1041.740) -- 0:00:00 8500 -- (-1041.791) (-1052.429) (-1049.868) [-1046.682] * (-1050.854) (-1053.798) (-1048.650) [-1042.711] -- 0:00:00 9000 -- [-1041.704] (-1051.931) (-1048.848) (-1056.651) * [-1054.020] (-1048.724) (-1048.056) (-1043.049) -- 0:00:00 9500 -- [-1042.625] (-1056.399) (-1052.079) (-1054.395) * (-1051.239) (-1051.419) (-1054.964) [-1043.317] -- 0:00:51 10000 -- (-1041.833) (-1048.512) (-1054.486) [-1048.620] * [-1049.885] (-1052.387) (-1047.407) (-1042.540) -- 0:00:49 Average standard deviation of split frequencies: 0.070711 10500 -- [-1042.546] (-1052.025) (-1059.618) (-1055.714) * (-1054.710) [-1049.486] (-1048.687) (-1042.337) -- 0:00:46 11000 -- (-1040.573) (-1058.017) [-1047.208] (-1054.133) * (-1050.267) (-1052.158) [-1049.411] (-1041.945) -- 0:00:44 11500 -- (-1043.708) [-1055.310] (-1050.222) (-1052.600) * (-1047.510) (-1048.333) (-1052.167) [-1042.521] -- 0:00:42 12000 -- [-1040.098] (-1053.233) (-1052.401) (-1048.511) * (-1045.077) [-1046.024] (-1062.714) (-1041.210) -- 0:00:40 12500 -- (-1046.375) (-1050.131) (-1049.513) [-1051.301] * (-1045.622) (-1050.133) (-1057.192) [-1040.964] -- 0:00:39 13000 -- (-1045.709) (-1048.050) (-1052.141) [-1045.563] * (-1056.009) [-1048.692] (-1052.417) (-1041.711) -- 0:00:37 13500 -- (-1041.704) (-1050.696) [-1053.076] (-1045.052) * (-1050.456) (-1054.678) (-1058.824) [-1042.980] -- 0:00:36 14000 -- [-1040.995] (-1049.480) (-1052.125) (-1050.282) * [-1057.974] (-1055.949) (-1053.627) (-1042.393) -- 0:00:34 14500 -- (-1045.710) (-1050.684) [-1048.952] (-1056.513) * (-1052.916) (-1047.398) (-1050.120) [-1043.441] -- 0:00:33 15000 -- (-1046.951) (-1050.687) (-1057.807) [-1050.622] * [-1051.567] (-1046.866) (-1058.399) (-1042.882) -- 0:00:32 Average standard deviation of split frequencies: 0.048614 15500 -- (-1046.799) (-1058.147) [-1046.138] (-1050.344) * [-1047.717] (-1054.153) (-1052.179) (-1050.138) -- 0:00:31 16000 -- (-1042.454) (-1054.518) (-1050.465) [-1048.911] * (-1056.437) (-1062.436) (-1047.310) [-1045.240] -- 0:00:30 16500 -- (-1043.345) (-1048.976) (-1055.244) [-1050.570] * (-1050.408) (-1047.262) (-1046.073) [-1042.025] -- 0:00:29 17000 -- (-1042.609) (-1051.410) [-1048.266] (-1051.201) * (-1047.093) (-1050.133) (-1046.270) [-1040.496] -- 0:00:28 17500 -- (-1046.510) (-1051.259) (-1057.323) [-1058.509] * (-1053.037) (-1064.379) (-1048.938) [-1046.612] -- 0:00:27 18000 -- (-1040.416) (-1056.253) (-1051.632) [-1056.300] * (-1052.187) (-1053.819) (-1048.633) [-1045.273] -- 0:00:26 18500 -- [-1042.847] (-1048.895) (-1046.276) (-1046.340) * (-1058.448) (-1049.739) (-1046.644) [-1047.150] -- 0:00:26 19000 -- (-1043.944) (-1041.618) (-1061.022) [-1041.398] * (-1054.073) (-1054.519) [-1047.308] (-1041.394) -- 0:00:25 19500 -- (-1042.830) [-1040.849] (-1050.567) (-1043.566) * (-1052.201) (-1052.473) (-1047.997) [-1042.278] -- 0:00:24 20000 -- [-1043.706] (-1041.747) (-1049.439) (-1043.934) * (-1050.118) [-1051.080] (-1046.400) (-1042.890) -- 0:00:24 Average standard deviation of split frequencies: 0.049221 20500 -- (-1041.713) [-1041.436] (-1049.545) (-1042.115) * [-1052.470] (-1052.295) (-1054.877) (-1041.373) -- 0:00:46 21000 -- [-1041.009] (-1040.103) (-1054.297) (-1042.194) * (-1052.022) [-1058.714] (-1057.106) (-1040.753) -- 0:00:45 21500 -- (-1041.113) (-1040.844) (-1047.134) [-1044.748] * (-1054.564) (-1054.906) (-1048.781) [-1041.615] -- 0:00:44 22000 -- (-1042.217) (-1041.354) (-1049.702) [-1042.497] * (-1055.321) (-1055.596) [-1048.036] (-1041.992) -- 0:00:43 22500 -- (-1041.224) (-1041.914) (-1046.013) [-1044.037] * (-1049.427) (-1056.667) [-1050.163] (-1041.836) -- 0:00:42 23000 -- [-1040.564] (-1045.574) (-1052.081) (-1043.054) * [-1046.556] (-1050.834) (-1049.877) (-1040.998) -- 0:00:41 23500 -- (-1042.901) [-1044.474] (-1051.195) (-1045.070) * (-1053.880) (-1054.647) [-1048.633] (-1040.373) -- 0:00:40 24000 -- (-1040.796) [-1042.689] (-1052.729) (-1043.243) * [-1049.164] (-1049.888) (-1052.418) (-1040.002) -- 0:00:39 24500 -- (-1040.596) (-1043.964) [-1055.818] (-1041.861) * (-1057.157) [-1050.563] (-1054.860) (-1040.385) -- 0:00:38 25000 -- (-1040.764) (-1042.175) [-1047.201] (-1041.301) * [-1051.198] (-1047.990) (-1048.660) (-1040.824) -- 0:00:38 Average standard deviation of split frequencies: 0.046622 25500 -- (-1042.447) (-1043.308) [-1050.801] (-1040.641) * (-1062.901) [-1049.665] (-1059.645) (-1041.420) -- 0:00:37 26000 -- (-1040.474) [-1044.118] (-1048.774) (-1043.414) * (-1047.959) (-1050.998) (-1054.077) [-1040.746] -- 0:00:36 26500 -- (-1042.148) (-1044.004) (-1050.002) [-1042.034] * (-1060.023) (-1059.833) [-1050.006] (-1040.260) -- 0:00:35 27000 -- (-1042.918) [-1042.688] (-1050.515) (-1040.516) * (-1050.979) (-1046.341) [-1049.764] (-1039.948) -- 0:00:35 27500 -- (-1046.531) [-1041.098] (-1052.318) (-1041.406) * (-1051.535) (-1041.106) [-1051.114] (-1040.024) -- 0:00:34 28000 -- [-1045.033] (-1040.277) (-1047.842) (-1043.360) * (-1041.450) [-1040.688] (-1053.406) (-1045.781) -- 0:00:33 28500 -- (-1044.372) (-1040.659) (-1050.561) [-1042.641] * (-1043.616) (-1041.796) (-1053.198) [-1048.055] -- 0:00:33 29000 -- [-1041.717] (-1040.190) (-1057.359) (-1042.372) * (-1042.395) [-1040.817] (-1054.643) (-1041.923) -- 0:00:32 29500 -- [-1042.938] (-1043.186) (-1049.003) (-1040.939) * (-1041.563) [-1041.133] (-1050.276) (-1045.587) -- 0:00:31 30000 -- (-1045.720) [-1041.425] (-1063.306) (-1042.356) * (-1041.073) [-1040.411] (-1054.431) (-1042.665) -- 0:00:31 Average standard deviation of split frequencies: 0.049044 30500 -- (-1040.830) (-1041.779) (-1053.444) [-1041.497] * [-1041.162] (-1042.050) (-1052.958) (-1041.058) -- 0:00:30 31000 -- [-1042.871] (-1041.577) (-1043.716) (-1042.035) * (-1044.542) (-1042.813) [-1043.165] (-1041.395) -- 0:00:30 31500 -- [-1040.407] (-1041.859) (-1049.962) (-1041.697) * (-1046.348) (-1042.716) [-1056.344] (-1041.111) -- 0:00:44 32000 -- (-1040.377) [-1041.299] (-1058.343) (-1040.519) * (-1042.525) (-1041.737) (-1060.528) [-1041.497] -- 0:00:43 32500 -- (-1039.978) (-1041.912) (-1049.444) [-1043.388] * (-1040.155) (-1040.903) (-1054.961) [-1042.963] -- 0:00:43 33000 -- (-1040.596) (-1042.780) (-1058.598) [-1044.929] * (-1043.064) [-1040.435] (-1058.069) (-1043.153) -- 0:00:42 33500 -- (-1041.845) (-1043.386) [-1051.475] (-1042.124) * [-1043.308] (-1043.623) (-1048.717) (-1043.359) -- 0:00:41 34000 -- (-1042.554) (-1040.778) [-1044.290] (-1044.794) * (-1044.202) (-1041.090) [-1046.795] (-1043.923) -- 0:00:41 34500 -- (-1041.392) (-1041.709) [-1059.009] (-1043.098) * (-1044.122) [-1040.116] (-1050.104) (-1043.361) -- 0:00:40 35000 -- [-1044.644] (-1043.788) (-1046.700) (-1043.451) * (-1043.898) (-1043.603) [-1049.714] (-1044.189) -- 0:00:39 Average standard deviation of split frequencies: 0.046558 35500 -- (-1041.706) (-1044.124) (-1057.425) [-1042.263] * (-1043.820) (-1044.608) [-1047.995] (-1040.877) -- 0:00:39 36000 -- (-1046.687) (-1044.795) (-1051.604) [-1042.946] * (-1042.422) [-1045.615] (-1053.485) (-1040.207) -- 0:00:38 36500 -- (-1048.215) (-1043.668) (-1057.249) [-1041.882] * (-1042.272) [-1047.337] (-1060.107) (-1044.965) -- 0:00:38 37000 -- (-1044.531) [-1042.902] (-1062.331) (-1041.850) * (-1043.419) (-1044.567) [-1056.995] (-1048.231) -- 0:00:37 37500 -- [-1043.731] (-1042.286) (-1050.319) (-1041.277) * [-1042.723] (-1044.368) (-1050.373) (-1050.416) -- 0:00:37 38000 -- (-1042.646) (-1042.389) (-1054.270) [-1040.291] * [-1040.559] (-1045.814) (-1045.183) (-1043.831) -- 0:00:36 38500 -- (-1042.812) [-1040.699] (-1047.894) (-1040.570) * (-1040.270) (-1043.353) [-1049.921] (-1039.924) -- 0:00:35 39000 -- (-1041.678) [-1040.746] (-1050.562) (-1044.262) * (-1041.383) (-1043.293) (-1055.832) [-1041.924] -- 0:00:35 39500 -- [-1042.682] (-1041.248) (-1049.571) (-1041.637) * (-1043.725) [-1039.945] (-1049.988) (-1041.315) -- 0:00:34 40000 -- (-1041.256) (-1042.127) [-1047.232] (-1048.019) * (-1043.705) (-1039.972) [-1046.747] (-1039.830) -- 0:00:34 Average standard deviation of split frequencies: 0.038833 40500 -- (-1041.519) (-1044.497) (-1050.391) [-1042.950] * [-1043.256] (-1041.137) (-1052.755) (-1041.518) -- 0:00:34 41000 -- [-1044.629] (-1045.704) (-1055.731) (-1042.908) * [-1042.700] (-1042.880) (-1053.642) (-1040.934) -- 0:00:33 41500 -- (-1044.465) (-1040.891) (-1047.379) [-1045.747] * (-1040.788) (-1042.080) [-1046.690] (-1040.991) -- 0:00:33 42000 -- (-1042.972) [-1040.855] (-1050.825) (-1044.363) * (-1044.636) [-1041.339] (-1047.117) (-1040.517) -- 0:00:32 42500 -- [-1043.038] (-1040.901) (-1061.409) (-1046.210) * (-1041.495) (-1044.112) (-1059.713) [-1042.537] -- 0:00:43 43000 -- (-1044.957) [-1041.108] (-1055.672) (-1048.627) * (-1041.223) (-1040.993) (-1051.438) [-1041.414] -- 0:00:42 43500 -- (-1042.837) (-1042.736) (-1055.531) [-1044.425] * (-1044.445) (-1041.098) [-1051.072] (-1042.185) -- 0:00:41 44000 -- [-1043.148] (-1041.637) (-1054.366) (-1044.685) * (-1041.989) [-1041.826] (-1050.675) (-1040.962) -- 0:00:41 44500 -- (-1042.147) [-1041.167] (-1056.765) (-1042.018) * (-1040.988) (-1041.951) [-1052.581] (-1041.642) -- 0:00:40 45000 -- (-1042.084) [-1041.474] (-1047.443) (-1043.529) * [-1041.249] (-1040.552) (-1051.326) (-1039.785) -- 0:00:40 Average standard deviation of split frequencies: 0.031210 45500 -- (-1041.987) [-1044.441] (-1056.276) (-1043.863) * (-1042.747) [-1042.295] (-1050.360) (-1041.614) -- 0:00:39 46000 -- (-1042.911) (-1042.840) (-1054.651) [-1040.326] * (-1041.666) [-1041.644] (-1065.230) (-1042.758) -- 0:00:39 46500 -- (-1042.760) (-1042.880) [-1046.075] (-1041.546) * (-1042.893) (-1040.702) (-1042.416) [-1041.043] -- 0:00:39 47000 -- (-1042.268) (-1041.203) [-1046.501] (-1041.335) * [-1041.118] (-1043.354) (-1040.387) (-1040.116) -- 0:00:38 47500 -- (-1041.816) (-1042.224) (-1061.051) [-1043.870] * [-1040.782] (-1042.394) (-1045.261) (-1042.960) -- 0:00:38 48000 -- (-1046.810) (-1043.808) [-1058.429] (-1040.940) * (-1042.253) (-1042.366) (-1042.126) [-1041.524] -- 0:00:37 48500 -- (-1047.322) [-1042.436] (-1047.519) (-1042.775) * (-1043.170) [-1040.244] (-1044.083) (-1043.375) -- 0:00:37 49000 -- [-1040.217] (-1041.953) (-1061.245) (-1040.386) * [-1040.712] (-1042.220) (-1048.625) (-1044.115) -- 0:00:36 49500 -- (-1041.102) (-1040.722) [-1049.598] (-1040.543) * [-1041.520] (-1041.228) (-1042.721) (-1040.736) -- 0:00:36 50000 -- (-1043.318) [-1041.082] (-1048.870) (-1040.552) * (-1041.960) (-1040.442) (-1042.100) [-1040.650] -- 0:00:36 Average standard deviation of split frequencies: 0.032362 50500 -- [-1041.165] (-1041.252) (-1047.889) (-1043.416) * (-1045.426) (-1049.315) (-1041.963) [-1041.210] -- 0:00:35 51000 -- (-1041.187) (-1041.872) [-1046.645] (-1042.018) * (-1042.375) [-1041.475] (-1043.073) (-1044.183) -- 0:00:35 51500 -- (-1049.652) [-1041.896] (-1046.651) (-1040.056) * [-1041.295] (-1043.218) (-1044.457) (-1042.702) -- 0:00:34 52000 -- (-1046.691) (-1041.467) (-1047.703) [-1040.509] * (-1042.024) [-1043.288] (-1040.856) (-1040.331) -- 0:00:34 52500 -- (-1047.146) (-1041.820) [-1044.469] (-1040.290) * [-1040.976] (-1043.481) (-1040.973) (-1042.670) -- 0:00:34 53000 -- (-1045.535) (-1041.171) (-1044.060) [-1040.127] * (-1043.044) (-1041.673) [-1042.124] (-1041.501) -- 0:00:33 53500 -- (-1043.480) (-1040.625) [-1050.483] (-1041.908) * (-1043.217) (-1041.922) (-1040.719) [-1041.600] -- 0:00:41 54000 -- (-1041.472) (-1042.276) [-1047.403] (-1043.893) * (-1042.263) (-1041.982) (-1045.040) [-1040.688] -- 0:00:41 54500 -- (-1044.033) (-1041.019) (-1050.529) [-1042.107] * (-1041.921) [-1046.391] (-1043.114) (-1041.365) -- 0:00:40 55000 -- (-1042.997) (-1044.555) [-1050.327] (-1042.350) * (-1045.429) [-1044.783] (-1041.783) (-1041.439) -- 0:00:40 Average standard deviation of split frequencies: 0.028914 55500 -- (-1045.115) (-1042.296) (-1057.382) [-1040.917] * [-1041.234] (-1041.936) (-1042.687) (-1044.174) -- 0:00:40 56000 -- (-1046.311) (-1040.160) [-1045.729] (-1041.279) * (-1045.251) [-1042.406] (-1041.541) (-1042.196) -- 0:00:39 56500 -- [-1042.396] (-1040.206) (-1046.286) (-1041.177) * (-1045.003) (-1043.216) (-1042.906) [-1042.001] -- 0:00:39 57000 -- (-1040.035) (-1040.037) [-1052.489] (-1041.614) * (-1044.689) (-1041.623) [-1041.728] (-1045.366) -- 0:00:38 57500 -- (-1042.351) (-1041.917) [-1050.714] (-1040.801) * (-1044.599) (-1040.918) (-1043.993) [-1040.958] -- 0:00:38 58000 -- (-1046.967) (-1041.967) [-1058.025] (-1040.889) * [-1043.108] (-1043.183) (-1042.922) (-1044.868) -- 0:00:38 58500 -- [-1043.874] (-1040.012) (-1048.462) (-1044.027) * (-1044.122) (-1042.463) (-1046.039) [-1041.918] -- 0:00:37 59000 -- (-1044.011) (-1040.072) (-1049.269) [-1043.719] * (-1041.006) (-1041.411) [-1044.171] (-1042.356) -- 0:00:37 59500 -- (-1042.758) (-1040.603) [-1050.662] (-1042.251) * (-1041.783) [-1040.462] (-1041.955) (-1044.297) -- 0:00:37 60000 -- (-1041.761) [-1045.984] (-1051.624) (-1043.873) * (-1042.881) [-1040.842] (-1040.407) (-1040.833) -- 0:00:36 Average standard deviation of split frequencies: 0.027585 60500 -- [-1040.055] (-1041.381) (-1046.529) (-1045.431) * (-1042.699) (-1043.556) (-1041.229) [-1040.632] -- 0:00:36 61000 -- (-1043.755) (-1041.301) [-1049.424] (-1043.483) * [-1043.057] (-1041.384) (-1040.900) (-1040.499) -- 0:00:35 61500 -- (-1040.981) (-1041.389) (-1051.815) [-1042.089] * (-1040.669) (-1042.285) (-1041.719) [-1044.010] -- 0:00:35 62000 -- (-1043.159) (-1043.563) [-1050.537] (-1044.911) * [-1042.041] (-1043.706) (-1041.882) (-1044.603) -- 0:00:35 62500 -- (-1042.261) (-1043.842) (-1065.756) [-1045.232] * [-1041.249] (-1041.223) (-1043.400) (-1043.516) -- 0:00:35 63000 -- (-1048.230) [-1041.338] (-1052.348) (-1045.779) * (-1044.126) (-1043.093) (-1042.775) [-1041.119] -- 0:00:34 63500 -- (-1042.842) (-1046.174) (-1051.386) [-1040.776] * (-1049.685) [-1041.991] (-1041.992) (-1042.644) -- 0:00:34 64000 -- (-1047.362) (-1043.412) [-1047.038] (-1043.038) * [-1041.749] (-1041.363) (-1041.031) (-1041.310) -- 0:00:34 64500 -- (-1041.920) (-1041.440) [-1047.492] (-1041.882) * (-1040.433) (-1039.997) [-1040.742] (-1039.901) -- 0:00:40 65000 -- [-1041.625] (-1040.917) (-1059.912) (-1041.376) * (-1047.679) (-1041.752) [-1043.424] (-1041.275) -- 0:00:40 Average standard deviation of split frequencies: 0.029219 65500 -- (-1045.111) [-1040.690] (-1055.892) (-1040.524) * (-1046.522) (-1041.146) (-1046.820) [-1040.894] -- 0:00:39 66000 -- [-1043.471] (-1041.835) (-1049.669) (-1040.699) * (-1042.216) [-1040.303] (-1044.489) (-1043.206) -- 0:00:39 66500 -- [-1041.003] (-1044.777) (-1052.005) (-1042.254) * (-1045.272) (-1041.166) [-1041.713] (-1043.915) -- 0:00:39 67000 -- [-1042.426] (-1044.827) (-1046.939) (-1044.819) * (-1042.304) (-1041.085) [-1042.492] (-1043.857) -- 0:00:38 67500 -- [-1043.137] (-1043.316) (-1059.098) (-1046.397) * (-1042.315) (-1043.430) (-1042.522) [-1044.597] -- 0:00:38 68000 -- (-1040.915) (-1042.769) (-1063.721) [-1043.631] * [-1041.874] (-1042.725) (-1042.252) (-1043.856) -- 0:00:38 68500 -- (-1042.877) (-1044.060) (-1050.306) [-1041.585] * (-1041.190) (-1041.205) [-1044.317] (-1047.122) -- 0:00:37 69000 -- [-1044.040] (-1047.161) (-1046.918) (-1042.056) * (-1040.470) [-1043.695] (-1044.970) (-1041.495) -- 0:00:37 69500 -- [-1043.455] (-1044.771) (-1046.307) (-1042.167) * (-1042.488) [-1041.583] (-1042.502) (-1041.286) -- 0:00:37 70000 -- (-1041.614) [-1043.176] (-1041.507) (-1043.095) * (-1041.741) (-1043.117) (-1041.399) [-1045.657] -- 0:00:36 Average standard deviation of split frequencies: 0.029874 70500 -- (-1044.068) (-1044.560) (-1041.394) [-1040.719] * [-1040.618] (-1040.671) (-1041.156) (-1043.355) -- 0:00:36 71000 -- (-1043.430) [-1044.391] (-1041.043) (-1040.902) * (-1039.945) (-1040.723) [-1044.192] (-1048.121) -- 0:00:36 71500 -- (-1043.701) (-1041.734) (-1045.854) [-1043.585] * (-1040.722) [-1040.528] (-1041.510) (-1046.597) -- 0:00:35 72000 -- (-1043.405) (-1044.718) [-1043.764] (-1041.896) * (-1041.777) (-1043.710) (-1043.280) [-1041.569] -- 0:00:35 72500 -- (-1046.958) (-1043.280) [-1042.035] (-1041.006) * (-1049.239) (-1043.050) (-1041.411) [-1040.493] -- 0:00:35 73000 -- (-1042.718) [-1043.479] (-1043.218) (-1042.333) * (-1042.891) (-1042.665) (-1041.587) [-1041.737] -- 0:00:35 73500 -- (-1042.539) [-1043.572] (-1043.134) (-1043.911) * (-1043.619) [-1041.235] (-1040.078) (-1041.976) -- 0:00:34 74000 -- [-1042.445] (-1042.392) (-1042.026) (-1042.896) * (-1041.055) (-1040.314) (-1042.331) [-1041.185] -- 0:00:34 74500 -- (-1041.920) (-1041.414) (-1042.047) [-1040.972] * (-1043.475) [-1042.346] (-1040.178) (-1043.810) -- 0:00:34 75000 -- [-1046.756] (-1042.359) (-1042.019) (-1040.967) * (-1044.919) (-1046.859) [-1041.305] (-1048.147) -- 0:00:34 Average standard deviation of split frequencies: 0.026583 75500 -- [-1042.689] (-1045.432) (-1043.172) (-1040.574) * (-1044.170) [-1043.141] (-1040.929) (-1047.401) -- 0:00:33 76000 -- (-1042.626) [-1040.638] (-1044.273) (-1040.289) * (-1043.997) (-1042.281) [-1048.636] (-1044.459) -- 0:00:39 76500 -- (-1041.853) (-1045.569) (-1042.461) [-1040.080] * (-1044.987) [-1040.518] (-1044.884) (-1041.173) -- 0:00:38 77000 -- (-1042.106) (-1058.878) (-1043.708) [-1043.821] * [-1040.641] (-1040.367) (-1042.267) (-1042.062) -- 0:00:38 77500 -- (-1040.968) (-1052.174) (-1044.385) [-1043.993] * (-1041.782) [-1044.873] (-1042.388) (-1041.033) -- 0:00:38 78000 -- (-1041.243) (-1044.175) [-1044.586] (-1041.355) * (-1042.926) (-1042.515) [-1043.116] (-1041.065) -- 0:00:37 78500 -- (-1042.149) (-1045.156) [-1042.700] (-1042.667) * (-1043.825) (-1043.255) (-1043.801) [-1041.485] -- 0:00:37 79000 -- (-1043.186) (-1043.473) (-1043.027) [-1042.184] * [-1042.262] (-1041.483) (-1040.685) (-1043.836) -- 0:00:37 79500 -- [-1041.634] (-1045.696) (-1048.845) (-1045.284) * (-1044.297) (-1043.634) [-1041.857] (-1042.045) -- 0:00:37 80000 -- (-1041.208) (-1048.466) (-1043.168) [-1043.037] * (-1040.945) (-1041.712) (-1040.688) [-1042.643] -- 0:00:36 Average standard deviation of split frequencies: 0.024913 80500 -- (-1040.920) (-1041.580) (-1040.983) [-1041.865] * (-1040.522) (-1041.009) (-1039.950) [-1041.518] -- 0:00:36 81000 -- (-1040.690) (-1040.600) [-1041.339] (-1040.041) * [-1041.322] (-1043.878) (-1039.884) (-1042.646) -- 0:00:36 81500 -- (-1044.695) (-1045.391) [-1043.289] (-1039.851) * (-1041.469) (-1042.533) [-1039.883] (-1042.002) -- 0:00:35 82000 -- (-1042.800) (-1045.711) (-1044.332) [-1040.226] * (-1044.631) (-1041.834) (-1043.475) [-1042.577] -- 0:00:35 82500 -- (-1043.389) (-1041.716) (-1042.035) [-1040.413] * (-1040.896) [-1040.449] (-1042.978) (-1040.749) -- 0:00:35 83000 -- (-1042.676) (-1041.456) [-1041.628] (-1041.149) * [-1041.126] (-1041.455) (-1042.198) (-1041.872) -- 0:00:35 83500 -- (-1047.636) [-1043.382] (-1040.811) (-1043.995) * (-1042.014) [-1042.411] (-1043.564) (-1044.941) -- 0:00:34 84000 -- (-1041.960) [-1042.392] (-1042.791) (-1043.026) * [-1041.233] (-1041.561) (-1042.929) (-1050.100) -- 0:00:34 84500 -- (-1045.873) (-1042.238) [-1042.222] (-1044.538) * [-1040.993] (-1044.479) (-1042.343) (-1042.663) -- 0:00:34 85000 -- (-1043.772) (-1044.072) [-1041.181] (-1042.193) * (-1040.539) (-1047.745) [-1040.517] (-1041.176) -- 0:00:34 Average standard deviation of split frequencies: 0.026660 85500 -- [-1042.678] (-1044.511) (-1044.018) (-1042.409) * (-1042.991) [-1042.964] (-1042.504) (-1042.685) -- 0:00:33 86000 -- [-1041.871] (-1041.229) (-1041.067) (-1043.028) * (-1046.710) (-1047.103) (-1044.067) [-1043.367] -- 0:00:38 86500 -- (-1044.598) (-1041.688) [-1040.750] (-1043.214) * (-1044.163) (-1045.216) (-1040.453) [-1041.218] -- 0:00:38 87000 -- (-1041.457) (-1040.430) (-1041.451) [-1043.308] * (-1042.348) (-1045.271) [-1043.516] (-1042.381) -- 0:00:37 87500 -- (-1041.835) [-1040.476] (-1043.374) (-1048.524) * (-1041.953) (-1044.943) (-1040.400) [-1042.784] -- 0:00:37 88000 -- (-1043.087) (-1048.139) (-1042.272) [-1041.705] * (-1043.576) (-1041.846) [-1042.501] (-1044.277) -- 0:00:37 88500 -- [-1042.619] (-1041.730) (-1041.425) (-1042.354) * [-1045.981] (-1040.610) (-1043.671) (-1044.672) -- 0:00:37 89000 -- (-1044.114) (-1043.615) (-1046.979) [-1042.844] * (-1043.425) [-1042.122] (-1044.923) (-1048.552) -- 0:00:36 89500 -- [-1044.726] (-1040.826) (-1044.294) (-1041.804) * [-1044.310] (-1045.014) (-1045.252) (-1042.501) -- 0:00:36 90000 -- (-1044.800) (-1041.465) (-1041.767) [-1040.891] * (-1042.298) (-1043.547) [-1041.355] (-1041.386) -- 0:00:36 Average standard deviation of split frequencies: 0.030206 90500 -- (-1044.258) (-1045.610) [-1041.324] (-1041.783) * (-1043.405) [-1043.059] (-1041.084) (-1041.654) -- 0:00:36 91000 -- (-1046.704) [-1043.057] (-1044.302) (-1041.381) * (-1045.052) (-1042.531) (-1044.799) [-1043.254] -- 0:00:35 91500 -- (-1045.393) (-1045.592) (-1043.027) [-1041.527] * [-1042.656] (-1043.200) (-1043.615) (-1041.639) -- 0:00:35 92000 -- (-1044.034) [-1043.327] (-1045.981) (-1041.388) * [-1040.628] (-1045.168) (-1042.184) (-1042.883) -- 0:00:35 92500 -- [-1043.767] (-1042.168) (-1044.793) (-1042.912) * (-1042.304) (-1043.930) (-1044.113) [-1043.696] -- 0:00:35 93000 -- (-1041.657) [-1040.101] (-1042.625) (-1040.508) * (-1041.495) (-1042.218) [-1040.375] (-1040.112) -- 0:00:35 93500 -- (-1041.593) (-1040.342) [-1042.900] (-1043.177) * (-1041.787) (-1042.019) (-1040.309) [-1039.922] -- 0:00:34 94000 -- (-1040.308) (-1041.861) [-1040.681] (-1043.901) * (-1044.458) (-1041.980) [-1042.325] (-1041.058) -- 0:00:34 94500 -- (-1040.308) (-1041.334) (-1042.165) [-1042.397] * (-1041.606) (-1041.457) [-1040.506] (-1044.467) -- 0:00:34 95000 -- (-1045.098) [-1041.142] (-1042.922) (-1042.189) * [-1040.527] (-1042.031) (-1044.083) (-1041.350) -- 0:00:34 Average standard deviation of split frequencies: 0.028294 95500 -- (-1042.277) (-1042.550) [-1039.883] (-1046.347) * [-1041.072] (-1044.084) (-1042.962) (-1043.472) -- 0:00:33 96000 -- (-1041.353) (-1041.768) (-1041.055) [-1044.644] * (-1043.281) [-1045.424] (-1046.008) (-1040.751) -- 0:00:33 96500 -- [-1044.304] (-1040.359) (-1040.822) (-1044.491) * [-1042.429] (-1040.741) (-1046.313) (-1041.056) -- 0:00:37 97000 -- (-1046.153) [-1045.008] (-1041.322) (-1045.491) * (-1041.208) (-1041.219) [-1044.373] (-1041.347) -- 0:00:37 97500 -- [-1044.909] (-1045.561) (-1039.963) (-1040.470) * (-1041.384) (-1042.670) [-1046.264] (-1043.522) -- 0:00:37 98000 -- [-1041.717] (-1044.566) (-1040.300) (-1041.727) * [-1042.892] (-1040.632) (-1045.798) (-1040.512) -- 0:00:36 98500 -- (-1042.667) [-1042.039] (-1041.460) (-1040.667) * (-1041.608) (-1043.695) (-1043.217) [-1040.381] -- 0:00:36 99000 -- (-1045.179) (-1043.001) [-1042.668] (-1040.734) * (-1041.608) (-1042.865) [-1041.886] (-1040.594) -- 0:00:36 99500 -- (-1044.161) (-1040.819) (-1042.966) [-1040.598] * (-1041.718) (-1042.418) (-1042.969) [-1043.437] -- 0:00:36 100000 -- [-1044.068] (-1041.066) (-1040.601) (-1040.159) * (-1042.676) (-1041.018) (-1041.118) [-1043.160] -- 0:00:36 Average standard deviation of split frequencies: 0.025644 100500 -- (-1042.549) (-1042.098) [-1046.216] (-1042.965) * [-1040.350] (-1041.348) (-1044.131) (-1044.313) -- 0:00:35 101000 -- (-1043.235) (-1041.717) [-1042.531] (-1043.585) * (-1040.803) (-1042.202) (-1044.107) [-1042.214] -- 0:00:35 101500 -- (-1044.113) (-1040.800) (-1046.078) [-1041.435] * (-1041.214) (-1042.774) (-1041.776) [-1041.446] -- 0:00:35 102000 -- (-1043.003) (-1041.400) [-1042.402] (-1041.312) * (-1043.952) (-1041.173) [-1040.586] (-1045.787) -- 0:00:35 102500 -- (-1045.399) (-1048.331) (-1040.505) [-1040.876] * (-1041.837) (-1041.625) [-1040.499] (-1047.198) -- 0:00:34 103000 -- (-1039.846) (-1043.025) (-1041.583) [-1044.995] * (-1042.669) (-1041.213) [-1040.150] (-1042.612) -- 0:00:34 103500 -- (-1043.998) (-1044.742) [-1041.107] (-1047.768) * (-1042.674) [-1040.169] (-1046.004) (-1044.793) -- 0:00:34 104000 -- (-1049.308) [-1042.321] (-1043.328) (-1041.751) * (-1042.837) (-1041.569) (-1049.000) [-1041.842] -- 0:00:34 104500 -- [-1047.064] (-1044.670) (-1040.771) (-1042.205) * (-1043.112) (-1042.554) (-1049.856) [-1040.909] -- 0:00:34 105000 -- (-1042.406) (-1047.521) [-1043.037] (-1040.161) * [-1042.996] (-1046.086) (-1046.165) (-1042.855) -- 0:00:33 Average standard deviation of split frequencies: 0.026260 105500 -- (-1043.676) (-1046.171) (-1040.612) [-1040.261] * [-1041.515] (-1043.970) (-1041.664) (-1042.230) -- 0:00:33 106000 -- (-1045.325) (-1044.604) [-1042.055] (-1044.140) * (-1042.214) (-1040.497) (-1041.643) [-1042.943] -- 0:00:33 106500 -- (-1043.233) (-1045.089) (-1041.590) [-1044.783] * [-1040.324] (-1041.079) (-1041.384) (-1044.459) -- 0:00:33 107000 -- (-1046.574) (-1046.262) (-1042.496) [-1045.484] * (-1041.286) (-1041.483) (-1040.949) [-1044.138] -- 0:00:33 107500 -- (-1049.343) (-1045.040) [-1040.935] (-1046.337) * (-1041.082) [-1040.758] (-1045.063) (-1041.960) -- 0:00:36 108000 -- (-1041.522) (-1041.728) [-1041.389] (-1043.374) * (-1042.142) (-1041.069) (-1041.644) [-1041.474] -- 0:00:36 108500 -- (-1041.023) (-1042.855) [-1043.732] (-1040.371) * (-1041.985) (-1040.410) (-1042.040) [-1040.896] -- 0:00:36 109000 -- (-1042.042) (-1041.157) [-1041.474] (-1040.373) * (-1043.975) (-1043.893) [-1041.303] (-1041.651) -- 0:00:35 109500 -- [-1041.222] (-1043.211) (-1041.061) (-1042.284) * (-1042.319) (-1042.170) (-1044.652) [-1041.364] -- 0:00:35 110000 -- (-1044.703) (-1041.257) (-1040.805) [-1042.677] * (-1041.855) (-1041.982) [-1042.709] (-1039.986) -- 0:00:35 Average standard deviation of split frequencies: 0.025132 110500 -- [-1043.292] (-1042.466) (-1041.445) (-1044.763) * (-1042.240) [-1040.993] (-1044.402) (-1042.598) -- 0:00:35 111000 -- (-1044.797) [-1041.006] (-1041.005) (-1043.626) * (-1041.138) (-1044.241) [-1041.188] (-1045.531) -- 0:00:35 111500 -- (-1044.016) (-1041.185) [-1040.473] (-1042.369) * (-1043.651) (-1041.702) [-1043.060] (-1043.226) -- 0:00:34 112000 -- (-1041.964) (-1040.466) (-1040.201) [-1042.617] * (-1042.548) (-1048.494) [-1041.215] (-1041.221) -- 0:00:34 112500 -- (-1042.741) (-1040.698) [-1040.677] (-1040.884) * [-1041.992] (-1044.008) (-1042.390) (-1043.172) -- 0:00:34 113000 -- (-1043.019) [-1040.736] (-1040.676) (-1044.912) * (-1042.585) (-1043.331) [-1043.326] (-1041.851) -- 0:00:34 113500 -- (-1043.169) (-1043.844) (-1040.877) [-1046.215] * (-1040.929) (-1043.621) (-1043.540) [-1041.158] -- 0:00:34 114000 -- (-1041.684) [-1040.740] (-1041.636) (-1042.448) * [-1043.201] (-1040.755) (-1042.748) (-1047.730) -- 0:00:33 114500 -- (-1042.551) (-1042.039) [-1043.097] (-1043.965) * [-1041.927] (-1040.760) (-1041.463) (-1042.295) -- 0:00:33 115000 -- (-1043.065) (-1043.629) (-1044.500) [-1040.008] * [-1041.897] (-1041.547) (-1043.497) (-1041.880) -- 0:00:33 Average standard deviation of split frequencies: 0.023570 115500 -- (-1044.310) [-1041.397] (-1043.865) (-1041.644) * (-1042.170) [-1044.741] (-1040.689) (-1040.350) -- 0:00:33 116000 -- (-1044.608) (-1044.587) [-1046.366] (-1041.361) * (-1043.714) (-1041.160) [-1040.401] (-1040.656) -- 0:00:33 116500 -- (-1040.918) (-1040.452) (-1045.564) [-1042.697] * [-1044.345] (-1041.639) (-1042.509) (-1042.285) -- 0:00:32 117000 -- (-1040.966) (-1045.151) [-1042.874] (-1042.637) * (-1041.663) (-1040.855) (-1043.394) [-1043.293] -- 0:00:32 117500 -- (-1044.520) (-1044.720) [-1042.553] (-1040.948) * (-1046.279) (-1040.448) [-1040.484] (-1043.429) -- 0:00:32 118000 -- (-1042.237) (-1043.911) [-1042.134] (-1042.730) * (-1049.098) (-1042.756) (-1041.158) [-1043.366] -- 0:00:35 118500 -- (-1040.623) (-1042.183) (-1049.256) [-1040.780] * (-1046.593) [-1041.750] (-1040.870) (-1042.236) -- 0:00:35 119000 -- (-1043.447) [-1043.864] (-1044.792) (-1041.265) * (-1046.992) (-1043.424) [-1041.664] (-1041.831) -- 0:00:35 119500 -- (-1044.170) (-1042.960) [-1042.502] (-1040.892) * [-1042.625] (-1042.965) (-1040.462) (-1042.057) -- 0:00:35 120000 -- [-1041.623] (-1043.146) (-1042.772) (-1039.837) * (-1041.775) [-1041.055] (-1040.553) (-1043.190) -- 0:00:34 Average standard deviation of split frequencies: 0.022412 120500 -- (-1041.624) [-1044.668] (-1045.930) (-1039.790) * (-1040.318) [-1041.150] (-1042.583) (-1043.050) -- 0:00:34 121000 -- (-1040.910) (-1043.770) [-1041.931] (-1039.790) * (-1043.417) (-1043.480) (-1042.980) [-1041.120] -- 0:00:34 121500 -- (-1041.576) (-1040.270) [-1042.931] (-1040.851) * [-1041.576] (-1045.718) (-1047.070) (-1040.925) -- 0:00:34 122000 -- (-1040.080) (-1041.757) [-1044.447] (-1040.522) * (-1043.016) (-1040.230) [-1043.559] (-1040.553) -- 0:00:34 122500 -- (-1040.246) [-1041.295] (-1040.805) (-1041.740) * (-1043.512) (-1040.418) [-1041.379] (-1040.661) -- 0:00:33 123000 -- (-1040.304) [-1043.260] (-1040.988) (-1042.064) * (-1043.917) (-1040.303) (-1040.938) [-1040.686] -- 0:00:33 123500 -- (-1043.528) (-1041.285) [-1040.397] (-1040.682) * (-1039.742) (-1041.361) (-1041.056) [-1041.801] -- 0:00:33 124000 -- (-1048.201) (-1043.474) [-1041.572] (-1043.270) * (-1040.510) (-1042.019) [-1040.933] (-1042.095) -- 0:00:33 124500 -- [-1043.243] (-1047.904) (-1043.081) (-1040.881) * [-1044.436] (-1040.361) (-1040.338) (-1042.402) -- 0:00:33 125000 -- (-1042.923) [-1041.589] (-1042.493) (-1040.760) * (-1040.667) (-1040.982) [-1040.445] (-1040.180) -- 0:00:33 Average standard deviation of split frequencies: 0.021138 125500 -- (-1040.813) [-1042.061] (-1042.630) (-1042.338) * [-1040.725] (-1040.794) (-1040.197) (-1039.864) -- 0:00:32 126000 -- [-1041.136] (-1041.341) (-1043.463) (-1042.028) * (-1042.205) (-1041.896) (-1040.025) [-1041.915] -- 0:00:32 126500 -- [-1042.318] (-1040.911) (-1041.856) (-1041.560) * (-1043.216) [-1040.842] (-1041.734) (-1045.188) -- 0:00:32 127000 -- (-1042.620) [-1043.110] (-1041.401) (-1046.252) * (-1045.890) [-1041.137] (-1044.046) (-1044.691) -- 0:00:32 127500 -- (-1041.496) (-1046.857) [-1041.455] (-1043.324) * (-1043.445) (-1043.623) (-1042.794) [-1040.996] -- 0:00:32 128000 -- (-1041.741) (-1042.016) (-1043.819) [-1040.822] * (-1042.824) (-1040.990) [-1041.407] (-1041.255) -- 0:00:34 128500 -- (-1041.121) (-1041.107) [-1040.381] (-1040.544) * (-1044.727) (-1042.752) [-1040.807] (-1041.303) -- 0:00:34 129000 -- [-1040.877] (-1040.495) (-1043.517) (-1044.448) * (-1045.432) (-1044.244) (-1041.290) [-1044.575] -- 0:00:34 129500 -- (-1042.651) [-1040.867] (-1042.247) (-1043.624) * (-1044.826) (-1044.068) [-1041.461] (-1042.207) -- 0:00:34 130000 -- (-1040.400) (-1040.137) [-1041.058] (-1041.717) * (-1044.148) (-1044.125) [-1041.758] (-1041.671) -- 0:00:34 Average standard deviation of split frequencies: 0.020023 130500 -- (-1042.057) (-1040.796) (-1043.810) [-1043.874] * (-1043.015) (-1043.417) (-1041.399) [-1041.250] -- 0:00:33 131000 -- (-1041.902) (-1040.592) (-1043.650) [-1041.911] * (-1044.052) (-1043.479) [-1041.503] (-1042.071) -- 0:00:33 131500 -- (-1041.533) (-1042.471) [-1045.212] (-1041.056) * (-1042.098) (-1042.678) [-1042.111] (-1042.476) -- 0:00:33 132000 -- (-1040.711) (-1041.897) [-1042.485] (-1043.507) * (-1043.700) (-1043.214) [-1046.644] (-1045.830) -- 0:00:33 132500 -- (-1041.122) (-1041.979) [-1042.218] (-1040.256) * [-1043.240] (-1041.029) (-1040.535) (-1043.347) -- 0:00:33 133000 -- (-1043.988) [-1041.230] (-1039.921) (-1040.241) * (-1042.940) (-1041.025) [-1042.293] (-1042.224) -- 0:00:33 133500 -- (-1041.581) (-1041.596) (-1040.926) [-1040.156] * [-1042.683] (-1040.147) (-1041.347) (-1042.089) -- 0:00:32 134000 -- (-1041.057) (-1042.535) (-1043.671) [-1039.983] * [-1043.139] (-1040.172) (-1042.821) (-1043.349) -- 0:00:32 134500 -- [-1041.132] (-1041.193) (-1042.751) (-1042.916) * (-1042.160) [-1041.000] (-1042.810) (-1045.964) -- 0:00:32 135000 -- [-1041.872] (-1041.998) (-1044.791) (-1040.433) * [-1041.975] (-1041.229) (-1041.345) (-1042.793) -- 0:00:32 Average standard deviation of split frequencies: 0.021144 135500 -- (-1041.916) (-1041.104) (-1043.931) [-1040.773] * [-1041.542] (-1041.665) (-1041.999) (-1040.177) -- 0:00:32 136000 -- (-1041.342) (-1042.787) [-1044.225] (-1040.374) * (-1040.592) [-1042.802] (-1045.488) (-1044.877) -- 0:00:32 136500 -- [-1041.243] (-1044.452) (-1045.307) (-1042.241) * (-1044.282) (-1046.441) (-1050.258) [-1040.659] -- 0:00:31 137000 -- (-1044.915) (-1042.593) [-1045.960] (-1044.603) * (-1042.563) [-1041.644] (-1041.956) (-1040.277) -- 0:00:31 137500 -- (-1046.625) (-1040.503) [-1044.153] (-1042.688) * (-1043.396) (-1042.240) [-1041.773] (-1043.260) -- 0:00:31 138000 -- (-1040.226) (-1043.122) (-1042.273) [-1043.979] * (-1043.688) (-1040.678) (-1042.884) [-1039.991] -- 0:00:34 138500 -- [-1040.012] (-1040.589) (-1045.520) (-1043.418) * (-1040.971) (-1042.425) (-1042.550) [-1040.146] -- 0:00:33 139000 -- [-1041.262] (-1041.097) (-1046.960) (-1042.654) * (-1041.390) (-1041.087) (-1042.837) [-1040.170] -- 0:00:33 139500 -- (-1042.232) [-1040.383] (-1044.762) (-1050.758) * (-1045.720) [-1042.485] (-1045.444) (-1040.915) -- 0:00:33 140000 -- (-1041.414) (-1040.727) (-1045.056) [-1043.165] * (-1047.113) (-1040.429) [-1040.719] (-1041.121) -- 0:00:33 Average standard deviation of split frequencies: 0.019102 140500 -- (-1041.751) (-1050.369) [-1047.010] (-1044.114) * (-1041.635) (-1041.879) [-1039.913] (-1040.941) -- 0:00:33 141000 -- (-1041.441) (-1042.453) [-1041.293] (-1043.873) * (-1045.356) (-1040.902) (-1043.160) [-1042.141] -- 0:00:33 141500 -- (-1042.807) (-1041.171) [-1041.483] (-1043.834) * (-1047.413) [-1042.525] (-1041.986) (-1041.657) -- 0:00:32 142000 -- (-1042.712) [-1044.888] (-1044.080) (-1043.063) * [-1044.993] (-1049.083) (-1045.878) (-1043.289) -- 0:00:32 142500 -- [-1041.202] (-1042.483) (-1040.696) (-1042.535) * [-1042.745] (-1047.016) (-1043.422) (-1041.535) -- 0:00:32 143000 -- [-1042.486] (-1044.494) (-1040.566) (-1044.616) * [-1040.352] (-1045.765) (-1042.879) (-1041.618) -- 0:00:32 143500 -- (-1041.428) [-1042.877] (-1040.719) (-1041.762) * (-1041.113) [-1041.005] (-1047.215) (-1043.073) -- 0:00:32 144000 -- (-1041.111) (-1042.577) (-1043.312) [-1040.611] * [-1041.229] (-1044.830) (-1047.678) (-1043.279) -- 0:00:32 144500 -- (-1040.343) (-1042.665) (-1042.511) [-1040.998] * (-1042.889) (-1042.102) [-1049.438] (-1041.239) -- 0:00:31 145000 -- (-1042.972) (-1041.630) [-1043.023] (-1040.629) * (-1042.032) (-1041.206) (-1044.940) [-1040.179] -- 0:00:31 Average standard deviation of split frequencies: 0.019211 145500 -- (-1040.382) (-1044.125) (-1042.370) [-1042.776] * [-1041.349] (-1044.929) (-1041.541) (-1041.602) -- 0:00:31 146000 -- (-1044.516) [-1042.537] (-1043.056) (-1041.601) * (-1041.384) [-1044.109] (-1041.770) (-1042.076) -- 0:00:31 146500 -- (-1045.817) [-1041.047] (-1043.224) (-1041.761) * [-1044.695] (-1043.710) (-1042.653) (-1043.705) -- 0:00:31 147000 -- [-1045.067] (-1042.552) (-1041.949) (-1046.976) * (-1045.251) (-1040.992) (-1041.321) [-1040.389] -- 0:00:31 147500 -- (-1043.124) [-1041.553] (-1042.337) (-1041.929) * [-1043.124] (-1041.308) (-1044.994) (-1040.570) -- 0:00:31 148000 -- (-1042.472) (-1040.198) (-1042.920) [-1042.121] * (-1041.901) [-1042.460] (-1041.131) (-1040.564) -- 0:00:30 148500 -- (-1040.657) (-1042.271) (-1040.640) [-1040.087] * (-1042.534) (-1042.081) [-1040.517] (-1042.946) -- 0:00:30 149000 -- [-1046.108] (-1046.629) (-1040.595) (-1043.238) * (-1042.354) (-1042.698) [-1041.413] (-1042.873) -- 0:00:32 149500 -- (-1044.479) (-1044.259) (-1040.433) [-1039.991] * (-1040.330) (-1042.830) [-1042.799] (-1043.936) -- 0:00:32 150000 -- (-1045.085) (-1045.838) [-1042.040] (-1041.224) * [-1042.546] (-1042.853) (-1041.435) (-1043.514) -- 0:00:32 Average standard deviation of split frequencies: 0.019925 150500 -- (-1044.387) (-1042.942) [-1040.478] (-1041.134) * (-1041.305) [-1042.070] (-1040.664) (-1042.986) -- 0:00:32 151000 -- (-1040.165) [-1041.206] (-1046.166) (-1041.236) * (-1041.171) [-1041.708] (-1040.933) (-1041.415) -- 0:00:32 151500 -- (-1042.133) (-1039.951) [-1049.532] (-1044.824) * (-1040.568) (-1047.780) (-1042.214) [-1041.405] -- 0:00:32 152000 -- (-1045.002) (-1046.618) [-1045.592] (-1042.877) * [-1042.396] (-1041.665) (-1042.412) (-1043.766) -- 0:00:32 152500 -- (-1039.856) (-1041.270) (-1042.827) [-1043.441] * (-1042.418) (-1040.979) [-1041.638] (-1041.726) -- 0:00:31 153000 -- (-1042.100) (-1040.660) [-1044.068] (-1047.217) * (-1041.301) (-1040.652) [-1041.562] (-1048.212) -- 0:00:31 153500 -- [-1042.602] (-1041.370) (-1043.013) (-1045.995) * [-1039.974] (-1044.392) (-1040.926) (-1042.666) -- 0:00:31 154000 -- (-1045.380) (-1041.956) (-1042.640) [-1044.513] * (-1043.938) (-1043.299) (-1045.833) [-1041.778] -- 0:00:31 154500 -- [-1042.007] (-1043.770) (-1043.063) (-1043.710) * (-1042.378) (-1046.778) [-1041.631] (-1041.047) -- 0:00:31 155000 -- (-1042.875) [-1043.700] (-1041.984) (-1042.189) * [-1044.157] (-1046.800) (-1053.159) (-1042.705) -- 0:00:31 Average standard deviation of split frequencies: 0.018926 155500 -- (-1042.274) [-1041.265] (-1044.100) (-1042.447) * [-1043.205] (-1044.775) (-1044.059) (-1041.128) -- 0:00:31 156000 -- (-1043.412) (-1044.524) (-1044.389) [-1044.157] * [-1042.640] (-1042.205) (-1042.759) (-1042.048) -- 0:00:30 156500 -- (-1043.120) (-1041.485) [-1043.694] (-1043.268) * (-1041.330) (-1041.733) [-1040.588] (-1041.982) -- 0:00:30 157000 -- (-1042.149) [-1040.521] (-1041.215) (-1041.140) * (-1042.930) (-1042.178) (-1042.791) [-1040.321] -- 0:00:30 157500 -- [-1042.259] (-1040.880) (-1042.287) (-1043.408) * (-1040.964) (-1043.541) [-1041.786] (-1042.140) -- 0:00:30 158000 -- (-1042.105) (-1042.222) (-1047.484) [-1041.362] * [-1040.197] (-1041.992) (-1041.354) (-1041.238) -- 0:00:30 158500 -- (-1040.532) (-1045.293) (-1043.708) [-1043.941] * (-1040.284) [-1040.759] (-1041.622) (-1042.138) -- 0:00:30 159000 -- [-1040.361] (-1045.328) (-1043.566) (-1041.658) * (-1039.871) (-1044.021) (-1042.804) [-1040.717] -- 0:00:30 159500 -- (-1040.343) (-1046.240) [-1041.297] (-1041.564) * (-1041.433) (-1044.261) (-1042.224) [-1041.051] -- 0:00:29 160000 -- (-1043.659) [-1045.121] (-1043.136) (-1041.608) * (-1042.814) (-1043.274) (-1041.102) [-1042.661] -- 0:00:29 Average standard deviation of split frequencies: 0.019071 160500 -- (-1042.833) (-1041.992) [-1040.620] (-1042.157) * [-1040.826] (-1042.526) (-1045.286) (-1046.411) -- 0:00:31 161000 -- (-1042.635) (-1041.519) [-1042.748] (-1042.179) * [-1042.297] (-1041.398) (-1043.624) (-1046.863) -- 0:00:31 161500 -- (-1040.470) (-1042.260) (-1041.834) [-1041.408] * [-1042.316] (-1040.763) (-1043.012) (-1048.656) -- 0:00:31 162000 -- (-1041.149) (-1044.121) [-1043.177] (-1041.457) * [-1041.836] (-1043.133) (-1045.794) (-1040.755) -- 0:00:31 162500 -- (-1043.311) (-1043.614) [-1042.104] (-1043.670) * (-1041.292) (-1041.548) [-1041.988] (-1041.607) -- 0:00:31 163000 -- (-1042.575) [-1044.747] (-1041.455) (-1042.022) * (-1041.091) [-1040.698] (-1042.039) (-1045.673) -- 0:00:31 163500 -- (-1042.861) (-1040.564) (-1041.981) [-1040.950] * (-1042.391) (-1040.661) (-1041.961) [-1045.270] -- 0:00:30 164000 -- (-1041.465) [-1040.816] (-1040.616) (-1040.919) * (-1042.498) (-1042.542) (-1041.367) [-1042.430] -- 0:00:30 164500 -- [-1043.441] (-1041.402) (-1042.516) (-1043.694) * (-1042.824) (-1042.611) [-1041.083] (-1044.106) -- 0:00:30 165000 -- (-1043.819) (-1041.629) (-1044.829) [-1042.764] * (-1043.600) (-1042.660) [-1041.815] (-1045.309) -- 0:00:30 Average standard deviation of split frequencies: 0.018683 165500 -- [-1043.637] (-1041.083) (-1043.292) (-1041.919) * (-1042.720) [-1041.873] (-1041.491) (-1042.862) -- 0:00:30 166000 -- [-1040.992] (-1041.102) (-1041.188) (-1040.843) * [-1044.267] (-1041.767) (-1042.263) (-1040.589) -- 0:00:30 166500 -- (-1041.775) (-1040.451) (-1039.868) [-1041.143] * (-1043.753) (-1041.160) [-1039.929] (-1040.662) -- 0:00:30 167000 -- [-1040.910] (-1040.879) (-1039.980) (-1040.407) * (-1043.364) (-1044.071) (-1040.202) [-1042.668] -- 0:00:29 167500 -- [-1040.633] (-1042.378) (-1041.269) (-1041.732) * [-1040.515] (-1042.612) (-1040.363) (-1041.829) -- 0:00:29 168000 -- (-1041.548) (-1040.024) [-1040.560] (-1040.339) * (-1039.931) [-1042.964] (-1042.829) (-1045.072) -- 0:00:29 168500 -- (-1041.912) (-1042.084) [-1039.775] (-1039.967) * [-1040.307] (-1043.630) (-1041.558) (-1043.577) -- 0:00:29 169000 -- (-1042.729) [-1041.699] (-1040.689) (-1042.022) * (-1040.807) (-1045.350) [-1042.509] (-1043.118) -- 0:00:29 169500 -- (-1044.239) [-1041.812] (-1042.979) (-1043.763) * (-1046.753) [-1041.232] (-1041.907) (-1045.758) -- 0:00:29 170000 -- (-1045.009) (-1042.705) [-1044.021] (-1045.309) * [-1045.989] (-1041.319) (-1044.574) (-1042.930) -- 0:00:29 Average standard deviation of split frequencies: 0.018721 170500 -- (-1044.894) [-1048.222] (-1041.049) (-1040.729) * (-1042.997) (-1042.176) (-1045.642) [-1040.795] -- 0:00:28 171000 -- [-1042.288] (-1041.766) (-1041.109) (-1042.867) * (-1043.418) (-1046.362) (-1041.460) [-1040.708] -- 0:00:28 171500 -- (-1041.831) [-1041.645] (-1040.979) (-1040.525) * [-1041.980] (-1045.749) (-1044.952) (-1040.712) -- 0:00:28 172000 -- (-1041.628) (-1041.768) (-1044.039) [-1041.198] * (-1043.321) [-1044.738] (-1041.748) (-1040.852) -- 0:00:30 172500 -- (-1042.574) [-1043.107] (-1041.865) (-1042.103) * [-1043.058] (-1041.779) (-1043.104) (-1041.546) -- 0:00:30 173000 -- [-1040.598] (-1042.396) (-1042.065) (-1040.275) * [-1042.225] (-1040.368) (-1042.709) (-1041.231) -- 0:00:30 173500 -- (-1040.597) (-1042.826) [-1042.120] (-1041.651) * (-1042.394) [-1043.059] (-1041.487) (-1042.469) -- 0:00:30 174000 -- (-1042.776) (-1042.623) [-1044.938] (-1044.234) * (-1042.846) [-1041.750] (-1044.104) (-1042.615) -- 0:00:29 174500 -- (-1044.387) (-1043.412) (-1040.447) [-1040.559] * (-1045.862) (-1044.874) [-1042.020] (-1040.618) -- 0:00:29 175000 -- (-1043.824) (-1041.905) [-1041.640] (-1043.628) * (-1040.325) (-1047.394) [-1040.546] (-1044.475) -- 0:00:29 Average standard deviation of split frequencies: 0.016634 175500 -- (-1040.622) (-1042.542) [-1041.259] (-1049.718) * (-1041.420) [-1041.180] (-1040.684) (-1041.939) -- 0:00:29 176000 -- (-1046.507) (-1040.132) [-1040.475] (-1042.119) * (-1049.155) [-1042.672] (-1041.507) (-1040.461) -- 0:00:29 176500 -- [-1042.215] (-1040.265) (-1042.240) (-1043.347) * [-1043.556] (-1042.598) (-1041.346) (-1041.122) -- 0:00:29 177000 -- [-1042.566] (-1039.890) (-1041.527) (-1040.683) * (-1043.022) [-1040.876] (-1041.308) (-1042.205) -- 0:00:29 177500 -- (-1042.747) [-1042.889] (-1047.054) (-1041.455) * (-1042.482) [-1042.035] (-1043.886) (-1039.877) -- 0:00:29 178000 -- [-1045.978] (-1041.545) (-1041.020) (-1040.148) * (-1042.373) [-1047.938] (-1041.302) (-1040.467) -- 0:00:28 178500 -- (-1041.486) [-1042.024] (-1041.014) (-1040.357) * [-1041.909] (-1043.603) (-1043.540) (-1041.136) -- 0:00:28 179000 -- (-1045.136) (-1042.021) (-1041.469) [-1041.896] * (-1042.379) (-1044.017) [-1043.610] (-1041.413) -- 0:00:28 179500 -- [-1041.060] (-1042.537) (-1041.399) (-1040.728) * [-1044.065] (-1041.454) (-1044.184) (-1042.095) -- 0:00:28 180000 -- (-1046.381) (-1047.004) [-1043.284] (-1040.938) * (-1040.550) (-1041.259) (-1042.606) [-1044.928] -- 0:00:28 Average standard deviation of split frequencies: 0.017105 180500 -- (-1043.757) (-1040.041) [-1041.831] (-1046.306) * (-1044.973) (-1041.823) (-1044.509) [-1041.775] -- 0:00:28 181000 -- (-1041.423) (-1040.303) (-1043.180) [-1043.597] * (-1041.684) (-1042.904) (-1041.129) [-1041.709] -- 0:00:28 181500 -- (-1042.198) (-1042.278) (-1041.814) [-1040.014] * (-1041.543) (-1040.657) [-1041.776] (-1043.002) -- 0:00:28 182000 -- [-1041.691] (-1043.564) (-1043.105) (-1042.616) * (-1042.361) (-1044.276) (-1042.191) [-1043.468] -- 0:00:27 182500 -- (-1046.093) [-1042.673] (-1042.591) (-1042.850) * (-1041.423) (-1047.349) [-1041.781] (-1042.392) -- 0:00:27 183000 -- (-1041.657) [-1040.645] (-1041.070) (-1042.712) * (-1043.154) (-1041.411) (-1044.567) [-1040.874] -- 0:00:29 183500 -- (-1040.690) (-1042.507) [-1043.272] (-1041.058) * (-1041.536) (-1043.578) [-1043.292] (-1044.383) -- 0:00:29 184000 -- (-1040.688) [-1040.804] (-1044.456) (-1041.497) * (-1042.380) (-1041.558) (-1041.165) [-1041.552] -- 0:00:29 184500 -- (-1039.836) (-1040.792) (-1044.402) [-1040.906] * [-1042.022] (-1042.269) (-1044.201) (-1041.427) -- 0:00:29 185000 -- (-1043.154) [-1041.715] (-1044.455) (-1040.536) * [-1041.132] (-1042.617) (-1041.294) (-1041.657) -- 0:00:28 Average standard deviation of split frequencies: 0.014406 185500 -- (-1042.724) [-1041.063] (-1044.263) (-1045.456) * (-1041.845) (-1041.899) (-1041.044) [-1040.218] -- 0:00:28 186000 -- (-1046.832) (-1043.397) (-1042.459) [-1044.809] * [-1040.989] (-1043.347) (-1043.700) (-1040.826) -- 0:00:28 186500 -- (-1046.341) (-1041.275) (-1043.015) [-1044.964] * (-1040.895) [-1042.045] (-1043.983) (-1042.704) -- 0:00:28 187000 -- [-1046.450] (-1041.657) (-1042.047) (-1042.556) * [-1040.251] (-1040.875) (-1042.082) (-1044.920) -- 0:00:28 187500 -- (-1047.606) [-1042.717] (-1042.327) (-1042.746) * (-1047.596) (-1040.748) [-1042.060] (-1040.868) -- 0:00:28 188000 -- (-1048.349) (-1042.746) (-1043.469) [-1042.137] * (-1044.686) [-1040.476] (-1041.190) (-1041.084) -- 0:00:28 188500 -- [-1041.291] (-1042.783) (-1043.531) (-1048.285) * (-1042.811) (-1040.646) (-1040.951) [-1041.728] -- 0:00:28 189000 -- (-1040.462) [-1042.986] (-1042.661) (-1047.666) * (-1042.980) (-1041.103) (-1045.200) [-1041.366] -- 0:00:27 189500 -- [-1040.453] (-1042.854) (-1047.781) (-1045.687) * (-1040.476) [-1043.796] (-1043.119) (-1040.659) -- 0:00:27 190000 -- (-1040.834) (-1048.644) (-1044.476) [-1043.014] * [-1041.657] (-1040.326) (-1041.687) (-1044.125) -- 0:00:27 Average standard deviation of split frequencies: 0.013873 190500 -- (-1042.178) [-1044.585] (-1041.619) (-1045.839) * (-1042.669) (-1040.696) [-1041.543] (-1041.414) -- 0:00:27 191000 -- (-1045.765) (-1044.543) (-1041.469) [-1044.809] * [-1041.076] (-1040.414) (-1042.506) (-1040.141) -- 0:00:27 191500 -- [-1045.424] (-1045.595) (-1042.931) (-1045.057) * (-1042.160) [-1040.401] (-1041.412) (-1040.342) -- 0:00:27 192000 -- (-1046.722) (-1047.218) [-1041.891] (-1039.947) * [-1042.758] (-1045.589) (-1043.813) (-1041.767) -- 0:00:27 192500 -- [-1045.117] (-1044.386) (-1040.739) (-1040.180) * (-1040.610) [-1041.645] (-1043.227) (-1040.872) -- 0:00:27 193000 -- (-1046.825) [-1044.924] (-1044.703) (-1045.171) * (-1039.905) [-1041.931] (-1040.296) (-1042.293) -- 0:00:27 193500 -- (-1043.474) [-1042.254] (-1042.699) (-1042.962) * (-1040.096) [-1042.599] (-1040.416) (-1047.680) -- 0:00:28 194000 -- (-1042.663) [-1041.700] (-1042.549) (-1041.775) * (-1040.516) (-1044.453) (-1045.628) [-1044.531] -- 0:00:28 194500 -- (-1043.090) [-1042.271] (-1042.101) (-1041.150) * [-1042.034] (-1043.601) (-1040.816) (-1044.367) -- 0:00:28 195000 -- (-1041.082) (-1041.022) [-1040.225] (-1042.351) * [-1041.391] (-1042.049) (-1040.219) (-1045.007) -- 0:00:28 Average standard deviation of split frequencies: 0.012785 195500 -- (-1040.840) [-1043.050] (-1040.343) (-1042.306) * [-1043.350] (-1044.637) (-1039.951) (-1045.785) -- 0:00:28 196000 -- [-1041.754] (-1044.597) (-1043.112) (-1044.628) * [-1047.889] (-1043.305) (-1041.034) (-1042.995) -- 0:00:27 196500 -- (-1043.782) (-1043.370) [-1041.481] (-1047.452) * (-1045.840) [-1045.089] (-1043.216) (-1042.826) -- 0:00:27 197000 -- (-1044.137) (-1040.248) [-1043.087] (-1047.683) * (-1041.239) (-1043.414) [-1042.109] (-1041.640) -- 0:00:27 197500 -- (-1043.945) (-1042.052) (-1044.604) [-1041.904] * (-1041.969) (-1044.138) (-1044.228) [-1043.721] -- 0:00:27 198000 -- (-1044.767) (-1042.344) [-1041.657] (-1041.654) * (-1041.659) (-1041.116) (-1045.836) [-1042.033] -- 0:00:27 198500 -- (-1041.437) [-1041.437] (-1041.848) (-1041.430) * (-1041.450) [-1045.871] (-1039.997) (-1040.803) -- 0:00:27 199000 -- (-1042.105) [-1040.153] (-1043.886) (-1043.591) * (-1041.216) (-1040.757) [-1041.036] (-1041.252) -- 0:00:27 199500 -- (-1041.663) (-1042.439) [-1041.972] (-1041.951) * (-1041.529) (-1041.574) (-1041.769) [-1042.788] -- 0:00:27 200000 -- (-1041.232) (-1041.760) (-1041.350) [-1042.642] * [-1040.513] (-1042.724) (-1041.159) (-1042.843) -- 0:00:27 Average standard deviation of split frequencies: 0.013128 200500 -- [-1041.517] (-1040.260) (-1041.087) (-1050.112) * (-1044.056) (-1042.527) (-1045.000) [-1041.705] -- 0:00:26 201000 -- (-1040.006) (-1041.515) [-1043.950] (-1040.219) * [-1041.941] (-1042.700) (-1041.469) (-1041.779) -- 0:00:26 201500 -- (-1039.898) [-1044.859] (-1043.458) (-1041.128) * [-1042.413] (-1041.766) (-1041.585) (-1042.542) -- 0:00:26 202000 -- (-1044.022) [-1042.690] (-1044.997) (-1044.413) * [-1041.163] (-1041.488) (-1040.788) (-1040.397) -- 0:00:26 202500 -- (-1044.624) [-1042.311] (-1045.315) (-1043.524) * (-1042.929) (-1046.121) (-1043.404) [-1046.292] -- 0:00:26 203000 -- (-1041.836) (-1041.860) [-1043.798] (-1042.372) * [-1041.965] (-1043.850) (-1042.332) (-1040.509) -- 0:00:27 203500 -- (-1046.095) [-1040.586] (-1039.994) (-1042.615) * (-1044.540) [-1041.005] (-1046.285) (-1041.794) -- 0:00:27 204000 -- [-1041.480] (-1042.709) (-1040.077) (-1040.822) * (-1043.207) (-1041.081) [-1044.837] (-1041.968) -- 0:00:27 204500 -- (-1043.357) (-1042.019) [-1043.329] (-1043.988) * [-1042.670] (-1041.827) (-1039.857) (-1041.592) -- 0:00:27 205000 -- [-1044.000] (-1040.663) (-1041.135) (-1041.137) * (-1041.327) (-1042.693) [-1044.638] (-1042.313) -- 0:00:27 Average standard deviation of split frequencies: 0.014672 205500 -- [-1042.034] (-1040.880) (-1041.973) (-1040.818) * (-1042.497) (-1043.699) [-1046.290] (-1041.986) -- 0:00:27 206000 -- (-1041.618) (-1043.239) (-1041.726) [-1040.235] * (-1042.810) (-1044.312) (-1041.224) [-1042.098] -- 0:00:27 206500 -- (-1041.687) (-1042.258) (-1042.614) [-1041.120] * (-1040.430) (-1041.183) [-1040.507] (-1046.652) -- 0:00:27 207000 -- (-1041.002) (-1041.438) [-1043.055] (-1040.793) * (-1042.369) (-1040.842) [-1040.544] (-1044.236) -- 0:00:26 207500 -- (-1041.298) [-1042.843] (-1043.089) (-1040.399) * (-1043.368) [-1042.102] (-1041.536) (-1042.292) -- 0:00:26 208000 -- (-1040.031) (-1041.866) [-1042.062] (-1042.683) * (-1044.041) (-1042.511) [-1040.704] (-1040.970) -- 0:00:26 208500 -- (-1041.405) (-1044.076) [-1041.251] (-1041.025) * (-1044.098) (-1042.551) [-1043.126] (-1040.149) -- 0:00:26 209000 -- (-1048.120) [-1041.980] (-1040.478) (-1040.517) * (-1045.924) (-1042.894) (-1044.051) [-1039.981] -- 0:00:26 209500 -- [-1045.622] (-1042.270) (-1040.921) (-1041.698) * (-1049.300) (-1046.171) (-1044.657) [-1047.984] -- 0:00:26 210000 -- (-1042.057) (-1040.354) (-1041.142) [-1040.538] * (-1046.616) (-1042.279) (-1044.603) [-1042.061] -- 0:00:26 Average standard deviation of split frequencies: 0.014296 210500 -- [-1040.969] (-1041.105) (-1041.441) (-1040.536) * (-1041.834) (-1042.023) [-1043.292] (-1041.567) -- 0:00:26 211000 -- [-1040.443] (-1040.760) (-1041.777) (-1040.719) * (-1041.631) (-1043.258) (-1043.916) [-1042.605] -- 0:00:26 211500 -- [-1043.386] (-1040.629) (-1041.239) (-1041.387) * (-1041.402) (-1042.722) (-1042.359) [-1042.461] -- 0:00:25 212000 -- (-1041.916) (-1040.583) [-1041.574] (-1041.011) * [-1041.257] (-1042.803) (-1040.074) (-1042.503) -- 0:00:25 212500 -- (-1044.278) (-1043.225) (-1041.790) [-1041.405] * (-1040.811) (-1041.220) (-1042.282) [-1040.272] -- 0:00:25 213000 -- (-1046.163) [-1041.960] (-1041.948) (-1042.587) * (-1040.411) [-1041.601] (-1047.141) (-1040.172) -- 0:00:26 213500 -- [-1042.340] (-1044.701) (-1042.109) (-1042.004) * [-1041.003] (-1044.172) (-1044.436) (-1040.395) -- 0:00:26 214000 -- (-1043.216) [-1041.917] (-1040.289) (-1041.693) * (-1041.177) (-1045.359) (-1043.403) [-1041.929] -- 0:00:26 214500 -- (-1041.175) [-1043.107] (-1042.020) (-1046.691) * (-1041.396) (-1040.443) [-1044.186] (-1043.016) -- 0:00:26 215000 -- (-1042.154) [-1040.871] (-1041.668) (-1047.878) * (-1041.557) (-1043.892) [-1041.219] (-1040.175) -- 0:00:26 Average standard deviation of split frequencies: 0.015035 215500 -- (-1041.326) [-1043.904] (-1046.501) (-1042.223) * (-1043.438) (-1043.904) (-1042.340) [-1040.365] -- 0:00:26 216000 -- (-1040.804) (-1041.665) (-1041.223) [-1041.944] * (-1044.761) (-1042.722) [-1043.222] (-1041.569) -- 0:00:26 216500 -- [-1042.429] (-1044.388) (-1044.183) (-1041.495) * (-1041.649) [-1042.657] (-1041.457) (-1040.978) -- 0:00:26 217000 -- [-1042.393] (-1042.148) (-1042.112) (-1043.037) * (-1040.858) (-1040.664) [-1042.802] (-1043.591) -- 0:00:26 217500 -- [-1042.880] (-1042.770) (-1042.513) (-1043.467) * (-1042.619) [-1043.767] (-1046.468) (-1044.392) -- 0:00:25 218000 -- (-1041.594) (-1040.680) [-1041.725] (-1046.565) * (-1042.990) (-1046.261) [-1046.597] (-1045.061) -- 0:00:25 218500 -- (-1041.070) (-1040.810) (-1041.929) [-1046.634] * (-1044.955) (-1043.419) [-1040.092] (-1044.138) -- 0:00:25 219000 -- [-1041.081] (-1041.782) (-1042.592) (-1044.692) * (-1040.574) (-1042.244) (-1041.344) [-1043.790] -- 0:00:25 219500 -- (-1040.950) [-1041.229] (-1042.126) (-1043.197) * (-1041.627) (-1045.444) (-1042.164) [-1043.105] -- 0:00:25 220000 -- (-1042.693) (-1042.794) (-1041.233) [-1042.925] * [-1042.241] (-1044.659) (-1043.120) (-1041.672) -- 0:00:25 Average standard deviation of split frequencies: 0.015547 220500 -- [-1041.255] (-1042.053) (-1047.082) (-1043.192) * (-1041.987) (-1041.606) [-1049.102] (-1040.883) -- 0:00:25 221000 -- (-1040.860) [-1041.177] (-1045.199) (-1045.970) * (-1041.048) (-1040.841) [-1042.684] (-1042.341) -- 0:00:25 221500 -- (-1042.451) (-1040.986) [-1040.627] (-1043.599) * [-1041.365] (-1040.559) (-1042.207) (-1043.400) -- 0:00:25 222000 -- (-1040.444) [-1041.488] (-1040.923) (-1043.914) * (-1043.456) (-1042.935) (-1042.937) [-1043.310] -- 0:00:25 222500 -- (-1040.487) (-1042.084) [-1042.760] (-1041.653) * (-1042.374) (-1043.452) [-1041.880] (-1041.789) -- 0:00:24 223000 -- (-1040.130) (-1045.412) [-1043.025] (-1041.387) * [-1042.348] (-1042.266) (-1041.183) (-1042.722) -- 0:00:24 223500 -- (-1039.968) [-1041.114] (-1045.178) (-1041.365) * (-1042.342) [-1052.094] (-1046.376) (-1045.291) -- 0:00:24 224000 -- (-1040.360) [-1041.018] (-1045.755) (-1042.150) * (-1040.681) [-1042.758] (-1041.830) (-1044.582) -- 0:00:24 224500 -- (-1040.466) (-1041.032) (-1043.400) [-1041.704] * (-1041.321) (-1042.860) (-1045.490) [-1042.092] -- 0:00:24 225000 -- (-1041.532) [-1043.655] (-1041.052) (-1041.989) * (-1043.128) (-1044.033) [-1041.791] (-1043.939) -- 0:00:25 Average standard deviation of split frequencies: 0.015876 225500 -- [-1041.261] (-1043.750) (-1040.498) (-1043.519) * (-1043.232) [-1041.676] (-1044.280) (-1042.212) -- 0:00:25 226000 -- (-1041.928) (-1042.662) (-1044.379) [-1042.519] * (-1045.916) (-1040.746) [-1041.468] (-1042.298) -- 0:00:25 226500 -- (-1043.289) [-1041.763] (-1041.963) (-1041.454) * (-1042.515) (-1043.899) [-1042.195] (-1044.794) -- 0:00:25 227000 -- (-1042.397) (-1042.946) (-1040.789) [-1040.463] * (-1042.183) (-1042.063) (-1042.801) [-1041.799] -- 0:00:25 227500 -- (-1042.703) (-1044.278) (-1040.800) [-1041.110] * (-1043.267) (-1044.014) [-1042.684] (-1041.921) -- 0:00:25 228000 -- (-1044.438) (-1045.068) (-1042.055) [-1042.223] * (-1042.970) (-1048.626) (-1044.259) [-1040.327] -- 0:00:25 228500 -- (-1042.830) [-1041.048] (-1047.051) (-1042.257) * [-1042.348] (-1042.505) (-1047.166) (-1043.425) -- 0:00:24 229000 -- (-1042.129) (-1040.606) (-1040.708) [-1040.727] * (-1042.267) (-1043.139) [-1043.152] (-1042.260) -- 0:00:24 229500 -- (-1042.262) (-1039.920) (-1041.216) [-1040.846] * (-1040.986) [-1045.018] (-1053.997) (-1042.931) -- 0:00:24 230000 -- (-1042.952) [-1040.852] (-1041.252) (-1041.089) * (-1042.457) [-1042.666] (-1043.321) (-1043.582) -- 0:00:24 Average standard deviation of split frequencies: 0.016349 230500 -- (-1041.515) (-1040.423) (-1040.854) [-1040.860] * (-1041.498) (-1043.514) (-1043.694) [-1039.930] -- 0:00:24 231000 -- [-1041.838] (-1040.114) (-1040.722) (-1048.304) * (-1043.648) [-1042.917] (-1041.339) (-1040.935) -- 0:00:24 231500 -- (-1040.490) [-1042.650] (-1041.542) (-1041.618) * (-1041.164) (-1043.049) [-1040.161] (-1040.422) -- 0:00:24 232000 -- (-1041.992) (-1042.295) [-1040.603] (-1042.126) * (-1042.104) (-1042.787) (-1041.208) [-1041.741] -- 0:00:24 232500 -- (-1046.855) (-1041.801) (-1042.735) [-1041.197] * (-1041.917) (-1044.638) (-1042.500) [-1041.119] -- 0:00:24 233000 -- (-1045.478) [-1040.501] (-1043.542) (-1043.164) * (-1043.322) (-1043.784) [-1040.580] (-1047.276) -- 0:00:24 233500 -- (-1045.948) (-1041.205) (-1043.125) [-1043.388] * (-1043.744) [-1041.172] (-1040.047) (-1042.523) -- 0:00:23 234000 -- (-1040.689) [-1040.505] (-1044.121) (-1042.333) * (-1043.555) (-1041.820) (-1042.014) [-1042.637] -- 0:00:23 234500 -- (-1042.169) [-1041.696] (-1042.627) (-1044.071) * (-1040.652) [-1043.356] (-1040.849) (-1043.551) -- 0:00:23 235000 -- [-1040.594] (-1042.017) (-1040.599) (-1043.343) * (-1041.518) [-1041.581] (-1040.893) (-1045.968) -- 0:00:23 Average standard deviation of split frequencies: 0.016757 235500 -- [-1040.097] (-1044.622) (-1040.701) (-1043.245) * (-1047.428) (-1045.310) [-1040.025] (-1043.394) -- 0:00:23 236000 -- (-1040.272) [-1043.277] (-1041.742) (-1043.875) * (-1049.626) (-1040.894) [-1040.976] (-1043.167) -- 0:00:23 236500 -- (-1048.850) (-1042.687) (-1041.414) [-1043.524] * (-1043.707) (-1041.734) [-1041.233] (-1044.347) -- 0:00:23 237000 -- (-1041.793) (-1042.026) (-1040.855) [-1044.036] * (-1045.140) [-1041.725] (-1043.337) (-1044.387) -- 0:00:24 237500 -- (-1041.961) (-1046.295) (-1041.942) [-1042.146] * (-1040.906) [-1045.602] (-1042.583) (-1041.985) -- 0:00:24 238000 -- (-1041.748) (-1041.261) (-1043.212) [-1040.951] * (-1041.731) (-1047.767) [-1041.794] (-1042.121) -- 0:00:24 238500 -- [-1042.028] (-1041.834) (-1041.519) (-1041.580) * (-1041.468) (-1044.878) [-1042.174] (-1043.841) -- 0:00:24 239000 -- (-1042.174) [-1043.673] (-1052.133) (-1041.890) * (-1044.620) (-1051.986) (-1041.752) [-1043.993] -- 0:00:24 239500 -- (-1041.818) (-1042.015) [-1052.626] (-1042.979) * (-1041.842) (-1048.614) (-1041.053) [-1041.211] -- 0:00:23 240000 -- (-1042.495) (-1040.337) (-1047.078) [-1042.040] * [-1040.354] (-1043.688) (-1040.504) (-1041.982) -- 0:00:23 Average standard deviation of split frequencies: 0.015126 240500 -- (-1043.561) (-1042.569) (-1041.578) [-1042.332] * (-1041.104) (-1041.423) [-1045.954] (-1043.050) -- 0:00:23 241000 -- (-1042.204) (-1042.664) [-1042.588] (-1041.722) * (-1042.386) (-1042.670) (-1040.340) [-1043.303] -- 0:00:23 241500 -- [-1042.752] (-1041.928) (-1043.794) (-1041.722) * (-1041.351) (-1041.802) [-1041.387] (-1041.290) -- 0:00:23 242000 -- [-1041.339] (-1043.407) (-1041.194) (-1040.909) * (-1041.683) (-1043.319) (-1043.273) [-1041.218] -- 0:00:23 242500 -- (-1043.138) (-1041.840) (-1040.874) [-1041.818] * (-1041.687) (-1043.351) [-1042.598] (-1040.748) -- 0:00:23 243000 -- (-1044.154) (-1041.484) [-1040.672] (-1044.097) * (-1043.478) [-1044.049] (-1044.402) (-1041.827) -- 0:00:23 243500 -- [-1041.841] (-1043.816) (-1042.355) (-1042.610) * (-1044.293) (-1042.350) (-1043.912) [-1043.071] -- 0:00:23 244000 -- [-1040.784] (-1043.900) (-1046.694) (-1042.322) * (-1041.849) (-1043.513) (-1043.811) [-1040.735] -- 0:00:23 244500 -- (-1042.048) (-1041.174) (-1048.483) [-1043.054] * [-1040.500] (-1044.665) (-1041.303) (-1042.865) -- 0:00:22 245000 -- [-1040.693] (-1040.923) (-1043.551) (-1043.563) * (-1042.173) (-1046.903) [-1041.115] (-1040.847) -- 0:00:22 Average standard deviation of split frequencies: 0.013095 245500 -- (-1040.433) (-1041.339) [-1041.115] (-1044.129) * (-1043.507) [-1041.957] (-1042.190) (-1040.891) -- 0:00:22 246000 -- [-1040.198] (-1040.369) (-1042.512) (-1042.364) * [-1041.917] (-1041.245) (-1043.315) (-1040.851) -- 0:00:22 246500 -- [-1040.203] (-1044.556) (-1041.395) (-1041.598) * (-1044.038) [-1041.454] (-1043.325) (-1042.901) -- 0:00:22 247000 -- [-1040.496] (-1041.141) (-1040.062) (-1040.278) * [-1044.837] (-1042.993) (-1043.666) (-1042.242) -- 0:00:22 247500 -- (-1042.811) (-1040.234) [-1041.080] (-1041.066) * (-1044.590) (-1046.514) [-1041.257] (-1045.063) -- 0:00:22 248000 -- (-1040.304) (-1041.488) [-1042.626] (-1041.443) * (-1041.979) (-1045.298) [-1039.813] (-1040.420) -- 0:00:22 248500 -- (-1041.455) (-1043.000) (-1046.056) [-1042.352] * (-1041.024) (-1041.405) (-1040.788) [-1042.369] -- 0:00:23 249000 -- (-1042.359) (-1041.231) (-1042.610) [-1043.717] * (-1040.495) [-1041.910] (-1042.504) (-1044.933) -- 0:00:23 249500 -- (-1042.178) (-1041.835) [-1042.099] (-1040.422) * [-1045.737] (-1041.130) (-1042.175) (-1045.045) -- 0:00:23 250000 -- (-1044.063) (-1041.841) [-1041.915] (-1044.134) * (-1041.437) (-1043.544) (-1042.374) [-1041.915] -- 0:00:23 Average standard deviation of split frequencies: 0.012224 250500 -- (-1046.479) (-1044.036) [-1042.521] (-1045.902) * (-1045.375) (-1043.726) (-1041.799) [-1041.865] -- 0:00:22 251000 -- (-1043.853) (-1050.750) [-1040.888] (-1045.131) * (-1046.782) [-1041.763] (-1040.999) (-1043.929) -- 0:00:22 251500 -- (-1043.275) (-1048.572) [-1042.351] (-1044.203) * (-1042.874) (-1040.274) [-1040.663] (-1043.578) -- 0:00:22 252000 -- (-1042.100) (-1042.937) (-1041.604) [-1043.153] * [-1042.912] (-1040.323) (-1043.348) (-1046.935) -- 0:00:22 252500 -- [-1044.878] (-1048.077) (-1045.957) (-1043.683) * (-1043.278) [-1043.633] (-1042.177) (-1044.174) -- 0:00:22 253000 -- (-1042.574) (-1043.470) [-1040.820] (-1047.533) * (-1042.016) (-1044.171) [-1042.469] (-1042.457) -- 0:00:22 253500 -- (-1044.811) (-1041.335) [-1041.247] (-1042.696) * (-1040.922) (-1043.891) [-1041.516] (-1042.748) -- 0:00:22 254000 -- (-1041.389) (-1043.721) (-1042.388) [-1042.968] * [-1040.491] (-1042.556) (-1042.047) (-1043.022) -- 0:00:22 254500 -- (-1041.549) (-1047.233) (-1043.619) [-1041.123] * (-1040.959) [-1042.604] (-1040.456) (-1042.344) -- 0:00:22 255000 -- (-1043.921) (-1048.188) [-1042.274] (-1042.686) * (-1046.300) [-1042.555] (-1042.082) (-1045.177) -- 0:00:22 Average standard deviation of split frequencies: 0.011921 255500 -- (-1046.087) [-1042.381] (-1040.769) (-1041.803) * (-1040.538) (-1041.810) (-1042.650) [-1040.388] -- 0:00:22 256000 -- (-1043.073) [-1043.515] (-1040.764) (-1042.795) * [-1043.045] (-1042.323) (-1040.859) (-1041.652) -- 0:00:21 256500 -- (-1040.925) [-1041.498] (-1045.116) (-1040.505) * [-1041.163] (-1040.975) (-1043.991) (-1042.335) -- 0:00:21 257000 -- [-1042.001] (-1042.313) (-1043.855) (-1041.014) * (-1044.038) [-1040.884] (-1040.097) (-1042.128) -- 0:00:21 257500 -- [-1042.847] (-1048.401) (-1041.324) (-1041.674) * (-1040.685) (-1043.823) (-1041.113) [-1041.330] -- 0:00:21 258000 -- (-1045.519) (-1040.928) [-1040.584] (-1042.118) * (-1040.952) (-1045.917) (-1043.270) [-1041.143] -- 0:00:21 258500 -- (-1050.115) (-1041.242) [-1041.024] (-1042.095) * (-1041.049) [-1047.089] (-1041.238) (-1042.182) -- 0:00:21 259000 -- (-1046.765) [-1041.218] (-1041.143) (-1042.211) * [-1042.489] (-1042.050) (-1040.747) (-1042.084) -- 0:00:21 259500 -- [-1039.849] (-1041.055) (-1040.660) (-1041.027) * (-1046.601) (-1042.558) [-1040.687] (-1041.993) -- 0:00:21 260000 -- (-1041.934) (-1041.055) [-1040.396] (-1042.611) * (-1041.071) (-1045.981) (-1042.508) [-1040.261] -- 0:00:22 Average standard deviation of split frequencies: 0.012374 260500 -- (-1045.665) [-1043.750] (-1044.204) (-1044.537) * (-1043.271) (-1044.909) (-1042.831) [-1040.647] -- 0:00:22 261000 -- (-1045.306) [-1043.287] (-1046.815) (-1045.164) * (-1043.311) (-1043.005) [-1043.608] (-1040.931) -- 0:00:21 261500 -- [-1040.992] (-1041.059) (-1044.288) (-1043.110) * [-1042.019] (-1042.026) (-1040.550) (-1043.355) -- 0:00:21 262000 -- (-1041.500) (-1041.742) [-1041.666] (-1043.998) * (-1044.116) (-1041.298) (-1040.551) [-1043.484] -- 0:00:21 262500 -- (-1040.965) [-1041.233] (-1043.002) (-1042.950) * (-1044.751) (-1040.522) [-1042.521] (-1046.353) -- 0:00:21 263000 -- (-1044.072) [-1041.531] (-1042.882) (-1042.051) * (-1042.959) (-1041.292) [-1040.990] (-1040.401) -- 0:00:21 263500 -- [-1043.919] (-1043.342) (-1042.357) (-1041.206) * (-1041.335) (-1047.741) (-1043.567) [-1041.120] -- 0:00:21 264000 -- (-1046.413) (-1045.076) (-1046.161) [-1040.868] * (-1041.017) (-1048.467) [-1042.703] (-1041.616) -- 0:00:21 264500 -- (-1042.846) (-1046.074) [-1046.238] (-1043.278) * [-1041.038] (-1040.407) (-1042.622) (-1044.334) -- 0:00:21 265000 -- (-1042.360) (-1042.960) (-1046.026) [-1040.556] * (-1040.295) [-1040.670] (-1041.820) (-1042.443) -- 0:00:21 Average standard deviation of split frequencies: 0.012126 265500 -- [-1042.365] (-1044.067) (-1043.052) (-1040.661) * (-1040.346) (-1043.320) (-1041.486) [-1043.782] -- 0:00:21 266000 -- (-1047.658) [-1043.270] (-1045.959) (-1042.885) * (-1041.137) [-1041.719] (-1044.994) (-1042.747) -- 0:00:21 266500 -- (-1043.389) (-1042.269) (-1040.784) [-1044.842] * (-1041.355) (-1040.717) [-1041.639] (-1041.070) -- 0:00:21 267000 -- (-1043.126) (-1045.540) (-1044.889) [-1043.732] * [-1041.465] (-1043.469) (-1043.970) (-1041.878) -- 0:00:20 267500 -- (-1044.971) (-1042.471) (-1043.061) [-1039.930] * (-1046.208) (-1042.741) (-1043.647) [-1041.130] -- 0:00:20 268000 -- (-1045.768) (-1042.923) (-1044.444) [-1043.170] * [-1042.252] (-1040.869) (-1041.897) (-1042.023) -- 0:00:20 268500 -- (-1044.575) [-1044.287] (-1041.136) (-1042.225) * (-1043.232) (-1042.840) [-1041.137] (-1040.921) -- 0:00:20 269000 -- (-1042.509) (-1043.158) (-1042.504) [-1042.035] * (-1041.976) [-1045.799] (-1042.795) (-1040.697) -- 0:00:20 269500 -- [-1043.065] (-1042.912) (-1043.968) (-1041.629) * [-1043.273] (-1043.978) (-1041.004) (-1043.001) -- 0:00:20 270000 -- [-1043.613] (-1043.262) (-1043.457) (-1041.541) * (-1044.072) (-1041.856) [-1040.891] (-1042.393) -- 0:00:20 Average standard deviation of split frequencies: 0.011183 270500 -- [-1041.601] (-1041.373) (-1040.450) (-1041.244) * [-1041.560] (-1041.322) (-1043.716) (-1042.108) -- 0:00:20 271000 -- (-1042.235) (-1046.111) (-1042.052) [-1041.075] * (-1041.523) (-1041.564) (-1044.087) [-1042.205] -- 0:00:21 271500 -- (-1042.917) (-1042.851) (-1043.869) [-1040.695] * (-1042.409) (-1041.537) (-1042.665) [-1041.454] -- 0:00:21 272000 -- (-1041.645) (-1042.777) [-1045.856] (-1040.250) * (-1041.985) (-1041.421) [-1041.513] (-1040.746) -- 0:00:20 272500 -- (-1042.097) (-1042.857) [-1040.269] (-1040.385) * (-1041.703) [-1041.116] (-1044.125) (-1045.870) -- 0:00:20 273000 -- [-1040.868] (-1044.552) (-1040.975) (-1040.681) * (-1041.309) (-1044.246) [-1043.942] (-1043.085) -- 0:00:20 273500 -- [-1044.240] (-1043.532) (-1042.908) (-1040.228) * (-1041.290) [-1041.875] (-1041.003) (-1044.065) -- 0:00:20 274000 -- (-1045.819) (-1044.567) [-1041.999] (-1040.300) * [-1040.534] (-1042.439) (-1041.257) (-1040.912) -- 0:00:20 274500 -- (-1044.941) (-1043.365) [-1042.395] (-1044.841) * (-1040.888) (-1041.010) [-1041.763] (-1047.326) -- 0:00:20 275000 -- (-1042.117) [-1042.865] (-1045.402) (-1045.762) * (-1041.479) (-1043.513) [-1040.840] (-1041.227) -- 0:00:20 Average standard deviation of split frequencies: 0.012146 275500 -- (-1045.110) [-1040.543] (-1046.538) (-1044.731) * (-1045.801) (-1045.496) (-1042.652) [-1042.049] -- 0:00:20 276000 -- (-1042.483) (-1043.219) (-1042.158) [-1047.659] * [-1042.188] (-1041.356) (-1042.714) (-1042.710) -- 0:00:20 276500 -- (-1041.978) (-1041.118) [-1043.975] (-1043.388) * (-1044.319) (-1039.940) (-1047.003) [-1041.921] -- 0:00:20 277000 -- (-1045.820) (-1047.473) [-1041.953] (-1041.984) * [-1041.543] (-1044.424) (-1043.329) (-1041.507) -- 0:00:20 277500 -- (-1044.260) (-1046.087) [-1040.255] (-1040.359) * (-1042.260) (-1042.720) [-1041.233] (-1045.950) -- 0:00:20 278000 -- (-1043.275) (-1042.454) (-1041.620) [-1043.224] * (-1040.739) (-1043.268) [-1041.867] (-1045.350) -- 0:00:19 278500 -- [-1043.088] (-1043.022) (-1043.456) (-1043.947) * [-1040.792] (-1041.723) (-1041.515) (-1040.679) -- 0:00:19 279000 -- (-1042.314) (-1046.944) (-1042.807) [-1041.967] * (-1042.146) (-1042.193) (-1040.527) [-1041.030] -- 0:00:19 279500 -- (-1042.756) (-1047.223) (-1042.908) [-1043.818] * [-1046.233] (-1042.252) (-1041.436) (-1042.405) -- 0:00:19 280000 -- (-1043.209) [-1043.102] (-1042.816) (-1043.792) * (-1042.896) [-1043.465] (-1039.935) (-1041.826) -- 0:00:19 Average standard deviation of split frequencies: 0.012877 280500 -- [-1042.353] (-1044.877) (-1042.299) (-1045.485) * (-1043.754) [-1043.513] (-1040.103) (-1042.833) -- 0:00:19 281000 -- [-1044.716] (-1044.701) (-1045.415) (-1046.221) * (-1045.076) [-1044.000] (-1041.706) (-1041.691) -- 0:00:19 281500 -- (-1043.486) [-1041.014] (-1042.726) (-1044.319) * (-1044.354) (-1047.128) (-1041.864) [-1044.014] -- 0:00:19 282000 -- (-1042.462) (-1041.405) (-1040.756) [-1041.003] * [-1041.828] (-1047.763) (-1044.481) (-1043.765) -- 0:00:20 282500 -- (-1042.930) [-1040.406] (-1041.012) (-1043.812) * (-1041.785) (-1046.269) (-1044.130) [-1040.094] -- 0:00:20 283000 -- [-1041.199] (-1041.796) (-1040.231) (-1042.102) * (-1043.592) (-1042.046) (-1043.377) [-1040.638] -- 0:00:19 283500 -- (-1042.471) [-1041.332] (-1039.792) (-1041.921) * (-1043.296) (-1042.136) [-1044.547] (-1043.401) -- 0:00:19 284000 -- (-1044.308) (-1041.556) (-1042.524) [-1042.375] * [-1041.266] (-1044.228) (-1043.337) (-1042.287) -- 0:00:19 284500 -- [-1043.565] (-1042.561) (-1042.637) (-1042.884) * (-1041.357) (-1040.577) [-1041.710] (-1043.050) -- 0:00:19 285000 -- [-1041.523] (-1045.023) (-1041.411) (-1042.654) * (-1042.639) (-1040.543) [-1041.710] (-1045.462) -- 0:00:19 Average standard deviation of split frequencies: 0.012232 285500 -- [-1041.104] (-1043.392) (-1040.979) (-1041.778) * (-1043.070) [-1041.623] (-1041.523) (-1044.129) -- 0:00:19 286000 -- (-1040.260) (-1041.500) (-1041.768) [-1043.828] * (-1043.515) (-1041.110) [-1043.833] (-1040.444) -- 0:00:19 286500 -- (-1042.476) (-1044.283) [-1043.379] (-1042.517) * (-1040.108) (-1041.297) (-1046.206) [-1042.049] -- 0:00:19 287000 -- [-1041.608] (-1041.217) (-1046.250) (-1040.367) * (-1042.687) (-1045.192) [-1042.159] (-1041.154) -- 0:00:19 287500 -- (-1042.419) (-1043.172) (-1041.462) [-1045.269] * (-1040.524) (-1040.185) [-1044.927] (-1044.249) -- 0:00:19 288000 -- (-1042.396) [-1044.669] (-1041.766) (-1042.447) * [-1040.367] (-1042.830) (-1042.446) (-1044.627) -- 0:00:19 288500 -- (-1041.522) (-1041.553) (-1041.434) [-1044.930] * (-1043.523) (-1043.195) [-1042.547] (-1041.940) -- 0:00:19 289000 -- (-1042.443) [-1041.400] (-1042.507) (-1041.083) * (-1045.226) (-1040.703) [-1045.705] (-1041.824) -- 0:00:18 289500 -- [-1044.164] (-1042.293) (-1041.060) (-1041.551) * (-1047.462) (-1043.056) [-1043.127] (-1045.184) -- 0:00:18 290000 -- [-1043.903] (-1044.729) (-1040.653) (-1042.952) * [-1041.563] (-1041.644) (-1044.297) (-1045.719) -- 0:00:18 Average standard deviation of split frequencies: 0.011097 290500 -- [-1042.200] (-1042.987) (-1042.261) (-1041.559) * [-1045.212] (-1041.879) (-1041.840) (-1044.053) -- 0:00:18 291000 -- [-1041.493] (-1041.802) (-1043.035) (-1040.993) * (-1042.482) (-1043.274) (-1042.030) [-1041.255] -- 0:00:18 291500 -- (-1043.006) (-1042.019) (-1043.677) [-1043.669] * (-1043.889) (-1042.062) (-1041.681) [-1041.173] -- 0:00:18 292000 -- (-1042.987) (-1041.302) [-1043.729] (-1042.179) * (-1041.213) (-1041.706) [-1040.408] (-1042.614) -- 0:00:18 292500 -- [-1040.713] (-1040.874) (-1044.213) (-1040.930) * (-1044.339) [-1045.007] (-1041.531) (-1042.975) -- 0:00:18 293000 -- (-1041.011) (-1040.850) [-1041.139] (-1042.629) * (-1042.116) (-1042.050) [-1043.735] (-1041.407) -- 0:00:19 293500 -- [-1040.037] (-1040.388) (-1044.343) (-1046.464) * (-1041.202) (-1042.281) (-1043.689) [-1044.822] -- 0:00:18 294000 -- [-1040.353] (-1042.649) (-1044.451) (-1044.107) * [-1041.672] (-1042.586) (-1041.541) (-1041.882) -- 0:00:18 294500 -- (-1039.952) (-1040.641) [-1041.866] (-1041.805) * [-1040.550] (-1041.503) (-1041.141) (-1042.550) -- 0:00:18 295000 -- (-1040.473) (-1045.478) [-1042.737] (-1042.613) * (-1040.362) (-1042.677) [-1041.061] (-1041.766) -- 0:00:18 Average standard deviation of split frequencies: 0.009202 295500 -- (-1041.122) (-1042.169) [-1041.789] (-1040.501) * [-1040.205] (-1043.287) (-1043.497) (-1041.104) -- 0:00:18 296000 -- (-1041.580) [-1042.138] (-1042.859) (-1041.051) * (-1046.907) (-1046.263) (-1041.584) [-1041.188] -- 0:00:18 296500 -- [-1042.563] (-1043.888) (-1041.574) (-1041.424) * (-1041.061) (-1044.347) [-1042.580] (-1040.419) -- 0:00:18 297000 -- [-1041.864] (-1043.373) (-1041.851) (-1042.650) * [-1041.070] (-1045.947) (-1046.285) (-1040.009) -- 0:00:18 297500 -- (-1045.939) (-1042.847) [-1040.639] (-1044.005) * (-1041.845) (-1043.718) (-1041.882) [-1042.075] -- 0:00:18 298000 -- [-1043.876] (-1043.612) (-1040.866) (-1044.086) * [-1041.725] (-1042.069) (-1049.916) (-1045.089) -- 0:00:18 298500 -- [-1042.818] (-1041.849) (-1042.699) (-1041.661) * [-1043.820] (-1042.332) (-1048.662) (-1043.933) -- 0:00:18 299000 -- (-1041.690) (-1046.283) [-1042.018] (-1041.062) * (-1046.751) (-1045.344) [-1041.458] (-1042.205) -- 0:00:18 299500 -- (-1040.630) [-1041.142] (-1042.453) (-1041.070) * (-1042.445) (-1047.093) (-1040.563) [-1040.510] -- 0:00:18 300000 -- (-1040.520) (-1045.342) [-1041.070] (-1040.257) * (-1044.651) (-1043.016) [-1040.498] (-1042.632) -- 0:00:18 Average standard deviation of split frequencies: 0.009843 300500 -- (-1040.523) (-1042.337) (-1042.196) [-1040.331] * (-1042.961) [-1042.708] (-1040.559) (-1045.721) -- 0:00:17 301000 -- (-1040.971) (-1041.509) (-1044.087) [-1041.590] * [-1041.642] (-1043.505) (-1041.899) (-1045.675) -- 0:00:17 301500 -- (-1042.895) (-1044.752) (-1041.101) [-1042.385] * (-1043.441) (-1044.304) (-1044.717) [-1041.097] -- 0:00:17 302000 -- (-1042.085) (-1043.870) (-1041.521) [-1045.601] * (-1041.966) (-1046.083) (-1043.253) [-1040.367] -- 0:00:17 302500 -- (-1041.280) (-1047.170) [-1041.484] (-1043.782) * (-1039.923) (-1042.091) (-1041.274) [-1041.970] -- 0:00:17 303000 -- (-1040.229) (-1040.579) (-1041.068) [-1044.537] * (-1041.612) [-1041.513] (-1040.698) (-1043.175) -- 0:00:17 303500 -- (-1042.285) (-1042.531) (-1041.228) [-1042.339] * (-1041.384) (-1041.878) [-1040.664] (-1044.195) -- 0:00:17 304000 -- (-1041.338) (-1040.434) (-1042.346) [-1043.979] * (-1041.024) (-1041.000) [-1040.398] (-1040.872) -- 0:00:18 304500 -- (-1041.589) [-1041.375] (-1041.986) (-1041.025) * (-1041.024) (-1041.530) [-1043.218] (-1041.799) -- 0:00:17 305000 -- (-1039.862) [-1042.916] (-1043.678) (-1043.850) * (-1041.854) (-1042.010) [-1040.275] (-1041.594) -- 0:00:17 Average standard deviation of split frequencies: 0.011690 305500 -- (-1039.846) (-1041.258) [-1040.731] (-1042.079) * (-1041.269) [-1040.814] (-1041.431) (-1042.027) -- 0:00:17 306000 -- [-1039.890] (-1040.815) (-1043.817) (-1041.783) * (-1040.764) [-1041.616] (-1041.439) (-1043.332) -- 0:00:17 306500 -- (-1042.361) (-1040.926) (-1047.239) [-1040.647] * (-1041.388) [-1042.545] (-1041.278) (-1044.772) -- 0:00:17 307000 -- (-1041.294) [-1041.380] (-1045.358) (-1041.199) * [-1041.386] (-1043.261) (-1041.553) (-1041.172) -- 0:00:17 307500 -- (-1046.175) (-1040.782) [-1044.444] (-1040.770) * (-1041.290) (-1042.717) (-1039.886) [-1042.068] -- 0:00:17 308000 -- (-1044.213) [-1043.513] (-1040.301) (-1041.289) * (-1042.379) (-1040.291) (-1042.052) [-1042.797] -- 0:00:17 308500 -- (-1042.459) [-1043.828] (-1040.951) (-1043.177) * [-1041.107] (-1040.777) (-1043.257) (-1047.112) -- 0:00:17 309000 -- [-1042.769] (-1045.734) (-1041.303) (-1047.961) * [-1040.576] (-1040.316) (-1044.511) (-1043.385) -- 0:00:17 309500 -- (-1040.525) (-1044.271) (-1049.473) [-1040.905] * (-1042.070) (-1040.859) (-1041.508) [-1042.249] -- 0:00:17 310000 -- (-1040.249) (-1045.796) [-1045.971] (-1041.786) * [-1043.031] (-1042.353) (-1040.857) (-1042.589) -- 0:00:17 Average standard deviation of split frequencies: 0.012318 310500 -- (-1041.112) (-1041.720) (-1042.255) [-1044.009] * (-1042.367) (-1043.097) (-1041.428) [-1042.088] -- 0:00:17 311000 -- (-1042.444) [-1041.758] (-1042.332) (-1042.628) * (-1044.310) (-1049.766) [-1043.725] (-1045.738) -- 0:00:17 311500 -- (-1042.146) (-1042.916) (-1041.883) [-1042.342] * [-1046.089] (-1044.237) (-1042.086) (-1046.034) -- 0:00:16 312000 -- (-1044.638) [-1044.532] (-1047.673) (-1043.838) * (-1042.591) (-1042.053) [-1040.391] (-1041.399) -- 0:00:16 312500 -- [-1042.173] (-1043.750) (-1041.573) (-1042.214) * [-1039.744] (-1042.676) (-1040.158) (-1044.160) -- 0:00:16 313000 -- (-1041.729) (-1044.055) [-1042.988] (-1043.645) * (-1039.942) (-1041.046) (-1040.264) [-1041.451] -- 0:00:16 313500 -- (-1042.974) (-1045.466) (-1041.372) [-1042.862] * (-1042.341) [-1041.855] (-1042.232) (-1041.622) -- 0:00:16 314000 -- (-1045.372) (-1042.750) [-1040.639] (-1042.372) * (-1043.263) (-1041.770) [-1041.059] (-1044.810) -- 0:00:16 314500 -- (-1043.394) (-1042.285) [-1039.692] (-1041.311) * [-1040.149] (-1040.653) (-1040.416) (-1041.075) -- 0:00:16 315000 -- (-1041.038) [-1044.626] (-1042.337) (-1040.285) * [-1041.301] (-1040.796) (-1042.063) (-1041.660) -- 0:00:16 Average standard deviation of split frequencies: 0.011496 315500 -- (-1044.209) (-1042.171) (-1044.919) [-1042.473] * (-1041.099) [-1040.821] (-1044.031) (-1046.080) -- 0:00:16 316000 -- [-1039.834] (-1041.180) (-1048.027) (-1041.883) * (-1040.625) (-1041.413) [-1041.217] (-1043.826) -- 0:00:16 316500 -- (-1041.761) (-1041.442) (-1045.232) [-1039.873] * [-1040.265] (-1042.611) (-1041.444) (-1043.867) -- 0:00:16 317000 -- (-1047.747) [-1041.544] (-1040.311) (-1042.035) * (-1041.461) [-1042.136] (-1042.849) (-1043.105) -- 0:00:16 317500 -- (-1043.526) (-1041.216) [-1043.164] (-1040.618) * (-1041.732) (-1041.512) (-1040.973) [-1043.703] -- 0:00:16 318000 -- (-1043.159) (-1041.343) (-1040.688) [-1043.504] * (-1044.191) (-1042.164) (-1041.840) [-1042.460] -- 0:00:16 318500 -- [-1041.170] (-1044.139) (-1041.044) (-1043.950) * (-1051.788) (-1040.731) (-1043.659) [-1040.604] -- 0:00:16 319000 -- [-1041.599] (-1044.227) (-1042.089) (-1043.759) * (-1041.674) (-1040.307) [-1040.524] (-1040.222) -- 0:00:16 319500 -- (-1042.099) (-1042.169) (-1043.105) [-1043.336] * [-1042.615] (-1041.250) (-1040.549) (-1040.618) -- 0:00:16 320000 -- [-1045.105] (-1042.793) (-1042.529) (-1040.938) * (-1042.818) (-1042.729) (-1044.508) [-1041.079] -- 0:00:16 Average standard deviation of split frequencies: 0.010699 320500 -- (-1046.153) (-1044.408) (-1044.317) [-1040.299] * [-1045.178] (-1045.844) (-1044.752) (-1041.737) -- 0:00:16 321000 -- (-1041.249) (-1042.322) [-1043.928] (-1040.223) * (-1041.372) [-1045.123] (-1040.865) (-1043.922) -- 0:00:16 321500 -- (-1041.067) (-1041.211) [-1042.961] (-1039.917) * [-1041.793] (-1043.554) (-1045.329) (-1042.774) -- 0:00:16 322000 -- [-1040.858] (-1042.723) (-1044.844) (-1042.456) * (-1043.834) (-1043.485) [-1042.942] (-1040.142) -- 0:00:16 322500 -- [-1045.290] (-1044.853) (-1043.339) (-1043.025) * (-1044.198) (-1041.061) [-1040.901] (-1040.593) -- 0:00:15 323000 -- [-1041.988] (-1041.426) (-1043.545) (-1042.129) * (-1048.369) [-1042.114] (-1042.355) (-1040.971) -- 0:00:15 323500 -- (-1043.109) [-1041.761] (-1042.631) (-1041.639) * (-1045.843) (-1042.485) (-1042.670) [-1042.240] -- 0:00:15 324000 -- (-1042.265) (-1040.106) (-1047.235) [-1043.204] * (-1044.128) [-1043.587] (-1041.548) (-1045.446) -- 0:00:15 324500 -- (-1041.129) (-1040.094) (-1042.583) [-1041.779] * (-1040.745) (-1046.330) [-1044.572] (-1045.470) -- 0:00:15 325000 -- (-1046.459) (-1041.574) (-1040.684) [-1041.722] * (-1041.375) (-1044.591) [-1043.247] (-1043.740) -- 0:00:15 Average standard deviation of split frequencies: 0.009640 325500 -- (-1044.985) (-1042.114) [-1040.936] (-1041.083) * [-1040.317] (-1043.343) (-1043.972) (-1044.009) -- 0:00:15 326000 -- (-1043.839) [-1041.897] (-1044.456) (-1042.132) * [-1039.756] (-1041.797) (-1045.179) (-1042.508) -- 0:00:15 326500 -- (-1042.006) [-1041.936] (-1042.363) (-1041.383) * (-1040.136) (-1042.576) [-1040.779] (-1041.200) -- 0:00:15 327000 -- (-1043.765) (-1052.103) [-1044.436] (-1040.334) * [-1040.623] (-1050.908) (-1043.994) (-1043.579) -- 0:00:15 327500 -- (-1042.464) (-1040.932) (-1039.861) [-1043.970] * (-1040.029) (-1044.958) [-1044.374] (-1040.487) -- 0:00:15 328000 -- (-1041.394) (-1043.066) [-1040.007] (-1043.145) * (-1044.969) [-1043.618] (-1043.401) (-1042.983) -- 0:00:15 328500 -- (-1043.028) (-1040.604) (-1042.489) [-1045.214] * (-1045.193) (-1041.820) [-1042.463] (-1043.447) -- 0:00:15 329000 -- (-1045.147) [-1041.800] (-1042.875) (-1042.722) * (-1045.823) (-1040.199) (-1040.158) [-1043.551] -- 0:00:15 329500 -- (-1041.744) (-1042.183) (-1042.084) [-1040.817] * (-1047.879) (-1044.332) (-1041.563) [-1046.085] -- 0:00:15 330000 -- (-1043.720) [-1041.523] (-1043.132) (-1040.724) * (-1044.378) (-1044.147) [-1040.309] (-1041.869) -- 0:00:15 Average standard deviation of split frequencies: 0.009979 330500 -- (-1045.990) (-1044.046) [-1040.598] (-1043.382) * (-1044.379) (-1040.869) [-1040.888] (-1043.506) -- 0:00:15 331000 -- (-1043.555) [-1043.601] (-1044.762) (-1045.397) * (-1049.127) [-1044.028] (-1041.786) (-1043.950) -- 0:00:15 331500 -- (-1043.142) (-1042.853) (-1044.982) [-1042.212] * (-1044.238) (-1042.266) (-1040.317) [-1040.658] -- 0:00:15 332000 -- (-1042.927) [-1041.475] (-1043.678) (-1045.762) * (-1043.279) (-1044.714) [-1041.294] (-1041.605) -- 0:00:15 332500 -- [-1041.947] (-1040.315) (-1041.490) (-1041.172) * (-1043.283) [-1044.731] (-1044.135) (-1041.017) -- 0:00:15 333000 -- (-1040.715) (-1040.087) (-1040.805) [-1044.670] * (-1043.305) (-1047.915) (-1049.290) [-1041.088] -- 0:00:15 333500 -- (-1040.935) [-1042.807] (-1045.377) (-1041.990) * (-1044.678) (-1044.315) (-1046.721) [-1041.246] -- 0:00:14 334000 -- [-1040.303] (-1042.827) (-1040.690) (-1048.038) * (-1043.495) [-1043.093] (-1041.382) (-1041.351) -- 0:00:14 334500 -- (-1040.324) (-1040.359) (-1043.290) [-1043.110] * (-1043.401) [-1042.270] (-1042.454) (-1043.151) -- 0:00:14 335000 -- (-1041.996) (-1040.788) [-1040.995] (-1043.509) * (-1047.729) (-1042.414) [-1041.939] (-1043.746) -- 0:00:14 Average standard deviation of split frequencies: 0.008496 335500 -- (-1042.815) (-1044.181) (-1045.670) [-1042.412] * [-1042.334] (-1040.693) (-1042.457) (-1042.274) -- 0:00:14 336000 -- (-1041.828) (-1041.936) [-1048.794] (-1041.646) * [-1042.418] (-1042.226) (-1042.406) (-1042.527) -- 0:00:14 336500 -- (-1042.361) (-1043.680) [-1042.037] (-1044.654) * [-1043.850] (-1041.726) (-1040.070) (-1041.871) -- 0:00:14 337000 -- [-1041.328] (-1043.862) (-1040.801) (-1046.470) * (-1040.947) (-1041.736) [-1043.977] (-1045.709) -- 0:00:14 337500 -- [-1041.382] (-1043.601) (-1041.827) (-1042.026) * (-1042.737) [-1041.935] (-1044.650) (-1042.475) -- 0:00:14 338000 -- (-1041.150) [-1040.499] (-1041.560) (-1046.673) * (-1043.350) [-1042.762] (-1040.448) (-1044.628) -- 0:00:14 338500 -- (-1040.622) (-1042.062) [-1042.083] (-1041.438) * [-1044.238] (-1040.778) (-1042.478) (-1041.774) -- 0:00:14 339000 -- (-1041.580) [-1041.492] (-1042.158) (-1041.212) * (-1041.367) (-1041.780) (-1046.276) [-1042.783] -- 0:00:14 339500 -- (-1042.478) [-1040.223] (-1052.314) (-1041.350) * (-1040.989) [-1041.226] (-1046.325) (-1043.398) -- 0:00:14 340000 -- [-1041.547] (-1043.398) (-1045.662) (-1043.591) * (-1041.520) (-1042.174) (-1041.341) [-1042.891] -- 0:00:14 Average standard deviation of split frequencies: 0.008841 340500 -- (-1043.089) (-1045.241) [-1043.807] (-1043.797) * (-1043.046) [-1041.084] (-1044.692) (-1041.309) -- 0:00:14 341000 -- (-1040.322) (-1042.208) [-1042.452] (-1043.381) * (-1040.832) (-1041.184) [-1041.955] (-1041.215) -- 0:00:14 341500 -- (-1041.423) [-1041.568] (-1040.904) (-1045.338) * (-1042.436) (-1041.131) [-1041.094] (-1042.212) -- 0:00:14 342000 -- (-1042.179) (-1042.760) (-1040.457) [-1041.689] * (-1041.652) [-1040.616] (-1041.046) (-1042.201) -- 0:00:14 342500 -- [-1041.252] (-1041.322) (-1040.978) (-1041.173) * (-1040.905) (-1041.821) [-1041.244] (-1045.485) -- 0:00:14 343000 -- (-1042.992) [-1043.018] (-1044.525) (-1043.522) * (-1041.395) [-1042.621] (-1043.457) (-1047.037) -- 0:00:14 343500 -- (-1045.113) (-1041.900) [-1043.887] (-1044.646) * (-1042.215) [-1042.624] (-1043.535) (-1045.885) -- 0:00:14 344000 -- [-1041.380] (-1046.532) (-1041.675) (-1044.052) * (-1041.239) (-1043.623) [-1041.210] (-1041.668) -- 0:00:14 344500 -- (-1044.633) (-1041.563) (-1042.354) [-1043.923] * (-1044.163) (-1044.842) (-1043.923) [-1043.689] -- 0:00:13 345000 -- (-1048.133) (-1042.407) [-1041.845] (-1046.281) * (-1044.037) (-1045.785) (-1041.509) [-1040.848] -- 0:00:13 Average standard deviation of split frequencies: 0.009234 345500 -- (-1044.095) [-1041.530] (-1044.513) (-1041.539) * (-1042.913) (-1045.270) (-1042.491) [-1040.856] -- 0:00:13 346000 -- (-1045.297) [-1040.536] (-1044.436) (-1043.037) * (-1041.820) (-1044.390) [-1041.460] (-1041.772) -- 0:00:13 346500 -- [-1042.736] (-1046.041) (-1042.513) (-1040.941) * (-1044.070) (-1043.484) (-1040.736) [-1042.644] -- 0:00:13 347000 -- (-1042.806) [-1042.058] (-1040.795) (-1041.652) * (-1041.895) (-1047.434) [-1040.706] (-1042.090) -- 0:00:13 347500 -- (-1047.275) (-1042.830) [-1040.652] (-1045.200) * (-1041.230) (-1041.742) [-1040.308] (-1042.159) -- 0:00:13 348000 -- (-1042.420) (-1042.067) [-1044.512] (-1046.287) * (-1043.570) (-1041.229) [-1040.246] (-1040.261) -- 0:00:13 348500 -- (-1043.366) (-1041.262) [-1041.427] (-1044.519) * (-1041.231) (-1044.127) [-1043.072] (-1040.415) -- 0:00:13 349000 -- (-1041.087) (-1041.315) [-1041.408] (-1041.496) * (-1044.097) (-1042.526) (-1040.740) [-1042.509] -- 0:00:13 349500 -- (-1044.081) (-1040.527) (-1041.743) [-1050.099] * [-1041.290] (-1040.904) (-1041.084) (-1041.233) -- 0:00:13 350000 -- (-1046.601) [-1040.835] (-1040.297) (-1047.080) * [-1042.724] (-1041.880) (-1042.443) (-1042.302) -- 0:00:13 Average standard deviation of split frequencies: 0.008887 350500 -- (-1048.551) [-1043.654] (-1041.573) (-1041.957) * [-1044.703] (-1042.322) (-1040.928) (-1045.866) -- 0:00:13 351000 -- (-1045.563) (-1044.886) (-1041.930) [-1040.374] * [-1043.141] (-1045.510) (-1041.276) (-1045.306) -- 0:00:13 351500 -- (-1051.384) (-1043.344) (-1041.522) [-1039.948] * (-1042.243) (-1042.283) (-1040.125) [-1044.006] -- 0:00:13 352000 -- (-1044.205) (-1040.508) [-1044.632] (-1042.368) * (-1041.754) [-1042.251] (-1042.699) (-1045.950) -- 0:00:13 352500 -- (-1043.993) (-1040.705) [-1041.437] (-1043.917) * (-1042.342) (-1050.945) (-1043.758) [-1044.731] -- 0:00:13 353000 -- [-1044.572] (-1040.352) (-1041.689) (-1044.073) * [-1041.269] (-1042.880) (-1042.465) (-1042.700) -- 0:00:13 353500 -- (-1046.159) (-1043.968) [-1041.760] (-1041.166) * (-1040.148) (-1045.828) (-1042.389) [-1042.036] -- 0:00:13 354000 -- (-1041.797) (-1043.912) [-1041.283] (-1042.113) * [-1040.926] (-1043.503) (-1043.288) (-1044.334) -- 0:00:13 354500 -- (-1040.064) [-1043.526] (-1041.909) (-1045.022) * [-1045.081] (-1046.377) (-1044.634) (-1044.127) -- 0:00:13 355000 -- [-1041.385] (-1045.532) (-1044.939) (-1042.711) * (-1043.464) (-1044.166) [-1042.741] (-1040.757) -- 0:00:13 Average standard deviation of split frequencies: 0.008681 355500 -- [-1043.585] (-1040.387) (-1040.550) (-1043.016) * (-1043.131) [-1043.573] (-1044.707) (-1040.817) -- 0:00:13 356000 -- (-1042.143) (-1040.742) (-1041.128) [-1040.890] * (-1042.690) (-1043.003) (-1043.722) [-1040.848] -- 0:00:12 356500 -- (-1041.958) (-1041.629) [-1040.775] (-1043.333) * (-1041.096) [-1042.104] (-1044.866) (-1040.633) -- 0:00:12 357000 -- (-1043.340) [-1041.758] (-1042.825) (-1042.604) * [-1042.580] (-1043.497) (-1046.850) (-1045.447) -- 0:00:12 357500 -- (-1042.957) [-1042.479] (-1046.848) (-1043.781) * [-1044.018] (-1040.865) (-1042.144) (-1046.917) -- 0:00:12 358000 -- (-1043.675) [-1043.187] (-1041.472) (-1043.523) * (-1042.215) (-1046.816) (-1041.186) [-1044.152] -- 0:00:12 358500 -- (-1040.072) [-1044.575] (-1042.319) (-1042.155) * (-1043.972) (-1044.550) [-1040.239] (-1046.675) -- 0:00:12 359000 -- [-1041.534] (-1041.784) (-1040.844) (-1044.479) * (-1043.023) [-1042.792] (-1040.777) (-1043.249) -- 0:00:12 359500 -- (-1044.091) [-1042.506] (-1041.763) (-1040.837) * (-1043.792) (-1040.711) (-1044.234) [-1043.492] -- 0:00:12 360000 -- (-1041.356) (-1040.872) (-1044.558) [-1040.253] * (-1041.069) [-1041.671] (-1041.823) (-1043.572) -- 0:00:12 Average standard deviation of split frequencies: 0.008931 360500 -- (-1042.248) (-1041.528) [-1042.638] (-1040.247) * [-1042.228] (-1040.276) (-1041.260) (-1040.497) -- 0:00:12 361000 -- (-1040.863) (-1042.350) [-1040.759] (-1041.711) * (-1042.732) [-1041.426] (-1044.910) (-1040.204) -- 0:00:12 361500 -- (-1042.214) [-1043.651] (-1041.167) (-1040.418) * (-1041.622) (-1042.348) [-1043.623] (-1040.403) -- 0:00:12 362000 -- (-1041.702) [-1044.056] (-1045.500) (-1041.650) * (-1042.416) [-1042.930] (-1040.658) (-1041.767) -- 0:00:12 362500 -- [-1041.144] (-1046.485) (-1040.427) (-1040.646) * (-1044.070) (-1046.968) [-1047.083] (-1042.037) -- 0:00:12 363000 -- [-1041.757] (-1042.007) (-1042.334) (-1040.187) * (-1043.823) (-1046.603) (-1048.282) [-1041.839] -- 0:00:12 363500 -- [-1041.773] (-1040.624) (-1042.336) (-1040.166) * [-1040.710] (-1041.613) (-1045.812) (-1042.961) -- 0:00:12 364000 -- (-1041.266) (-1041.897) (-1041.099) [-1040.920] * (-1040.635) (-1044.244) [-1043.726] (-1042.936) -- 0:00:12 364500 -- (-1046.696) (-1041.059) [-1040.087] (-1040.751) * (-1042.325) (-1044.895) [-1045.007] (-1042.989) -- 0:00:12 365000 -- [-1042.025] (-1042.684) (-1042.294) (-1043.449) * [-1042.072] (-1040.932) (-1045.973) (-1045.340) -- 0:00:12 Average standard deviation of split frequencies: 0.008587 365500 -- (-1041.522) (-1042.586) (-1041.238) [-1041.180] * (-1042.369) (-1040.492) (-1043.792) [-1040.976] -- 0:00:12 366000 -- (-1042.413) (-1042.776) (-1041.007) [-1040.333] * (-1040.978) (-1045.084) (-1045.221) [-1040.415] -- 0:00:12 366500 -- (-1043.124) [-1043.367] (-1041.671) (-1048.446) * (-1042.688) [-1045.810] (-1044.221) (-1042.718) -- 0:00:12 367000 -- (-1045.005) (-1040.376) (-1041.678) [-1046.813] * (-1041.758) (-1047.046) [-1044.655] (-1040.982) -- 0:00:11 367500 -- (-1040.794) [-1040.522] (-1040.674) (-1042.879) * [-1041.459] (-1044.550) (-1042.274) (-1044.151) -- 0:00:11 368000 -- (-1041.370) (-1041.520) (-1042.720) [-1041.334] * [-1041.715] (-1042.616) (-1041.802) (-1041.338) -- 0:00:11 368500 -- (-1042.098) (-1040.438) [-1043.299] (-1041.764) * [-1042.785] (-1041.960) (-1041.233) (-1042.348) -- 0:00:11 369000 -- (-1044.087) [-1041.285] (-1044.397) (-1043.240) * (-1043.384) (-1041.672) (-1042.901) [-1041.309] -- 0:00:11 369500 -- (-1047.919) (-1041.229) [-1042.813] (-1043.126) * [-1044.050] (-1041.174) (-1041.364) (-1041.373) -- 0:00:11 370000 -- (-1044.793) (-1040.473) [-1041.283] (-1043.905) * [-1042.718] (-1041.326) (-1042.774) (-1044.300) -- 0:00:11 Average standard deviation of split frequencies: 0.008620 370500 -- (-1042.555) (-1044.196) [-1041.513] (-1042.239) * (-1041.478) [-1040.467] (-1043.455) (-1043.080) -- 0:00:11 371000 -- (-1041.198) (-1043.758) [-1042.924] (-1040.870) * (-1044.676) [-1041.347] (-1046.671) (-1043.161) -- 0:00:11 371500 -- [-1042.906] (-1043.326) (-1047.772) (-1042.342) * (-1047.449) (-1040.231) [-1041.490] (-1047.468) -- 0:00:11 372000 -- [-1042.078] (-1041.772) (-1041.325) (-1040.784) * (-1040.881) (-1039.781) (-1040.589) [-1041.677] -- 0:00:11 372500 -- (-1042.253) (-1040.710) [-1040.969] (-1041.590) * (-1041.957) (-1044.919) (-1043.101) [-1041.395] -- 0:00:11 373000 -- (-1041.534) (-1040.306) [-1045.974] (-1042.483) * (-1044.100) (-1042.802) (-1042.995) [-1040.671] -- 0:00:11 373500 -- [-1041.646] (-1040.995) (-1041.964) (-1044.182) * [-1042.965] (-1041.400) (-1042.558) (-1046.092) -- 0:00:11 374000 -- (-1041.619) (-1040.850) (-1041.269) [-1043.972] * (-1044.257) (-1041.625) [-1040.509] (-1040.767) -- 0:00:11 374500 -- (-1042.898) (-1041.181) (-1040.951) [-1042.834] * (-1040.364) (-1040.673) (-1042.120) [-1040.669] -- 0:00:11 375000 -- (-1043.783) [-1041.660] (-1040.503) (-1041.051) * (-1045.483) (-1041.201) [-1040.993] (-1042.264) -- 0:00:11 Average standard deviation of split frequencies: 0.008289 375500 -- (-1042.099) (-1042.025) (-1040.966) [-1040.455] * (-1042.918) (-1041.365) [-1041.220] (-1043.621) -- 0:00:10 376000 -- (-1040.176) [-1041.799] (-1040.295) (-1040.394) * (-1043.335) [-1041.726] (-1042.356) (-1040.903) -- 0:00:11 376500 -- [-1042.573] (-1044.393) (-1040.180) (-1040.619) * (-1043.338) (-1041.679) (-1042.429) [-1040.729] -- 0:00:11 377000 -- (-1048.723) (-1042.105) (-1041.077) [-1042.457] * (-1044.081) (-1042.356) [-1044.050] (-1042.605) -- 0:00:11 377500 -- (-1046.410) (-1041.211) [-1041.471] (-1042.163) * [-1042.938] (-1042.130) (-1042.798) (-1043.458) -- 0:00:11 378000 -- [-1040.744] (-1042.667) (-1043.761) (-1042.086) * [-1042.183] (-1043.097) (-1045.616) (-1044.423) -- 0:00:10 378500 -- (-1044.519) (-1043.545) (-1044.151) [-1045.057] * (-1043.914) [-1043.949] (-1043.357) (-1045.066) -- 0:00:10 379000 -- (-1040.487) [-1040.221] (-1043.604) (-1043.072) * (-1040.377) [-1043.891] (-1047.242) (-1041.440) -- 0:00:10 379500 -- (-1041.071) [-1040.091] (-1041.370) (-1045.747) * [-1041.274] (-1043.547) (-1044.694) (-1041.738) -- 0:00:10 380000 -- [-1043.806] (-1040.614) (-1040.959) (-1044.185) * (-1042.197) (-1042.310) [-1042.077] (-1042.312) -- 0:00:10 Average standard deviation of split frequencies: 0.008256 380500 -- (-1044.679) [-1040.695] (-1042.236) (-1040.770) * (-1042.485) (-1041.662) (-1041.246) [-1041.097] -- 0:00:10 381000 -- (-1042.978) [-1041.328] (-1041.484) (-1042.904) * (-1044.700) (-1042.244) (-1043.573) [-1041.384] -- 0:00:10 381500 -- [-1044.208] (-1042.135) (-1040.997) (-1040.613) * (-1043.500) (-1045.699) (-1040.331) [-1042.312] -- 0:00:10 382000 -- (-1046.124) [-1042.721] (-1042.457) (-1040.207) * (-1040.316) [-1044.866] (-1044.134) (-1041.478) -- 0:00:10 382500 -- (-1044.045) (-1042.683) (-1043.433) [-1040.950] * (-1041.753) (-1047.795) [-1041.078] (-1041.486) -- 0:00:10 383000 -- (-1044.974) [-1041.346] (-1042.944) (-1041.816) * [-1040.584] (-1043.302) (-1040.425) (-1042.745) -- 0:00:10 383500 -- (-1044.045) (-1040.953) [-1040.114] (-1040.891) * (-1045.890) [-1042.329] (-1043.275) (-1046.162) -- 0:00:10 384000 -- (-1045.231) (-1043.531) (-1043.924) [-1041.592] * (-1043.330) (-1039.901) (-1041.590) [-1040.533] -- 0:00:10 384500 -- [-1041.490] (-1042.515) (-1045.449) (-1044.000) * (-1042.405) (-1040.596) [-1042.064] (-1045.141) -- 0:00:10 385000 -- [-1041.153] (-1040.908) (-1047.563) (-1043.150) * (-1044.485) (-1043.289) [-1045.875] (-1040.778) -- 0:00:10 Average standard deviation of split frequencies: 0.008142 385500 -- (-1041.432) [-1041.962] (-1045.101) (-1041.120) * (-1042.681) [-1043.545] (-1042.010) (-1043.679) -- 0:00:10 386000 -- (-1044.282) (-1043.332) [-1042.887] (-1043.531) * (-1042.653) (-1043.450) [-1041.496] (-1043.520) -- 0:00:10 386500 -- (-1044.331) [-1041.310] (-1041.491) (-1042.698) * (-1040.393) (-1043.110) (-1042.347) [-1043.344] -- 0:00:09 387000 -- (-1041.993) (-1046.790) (-1043.537) [-1043.831] * (-1041.006) (-1040.863) (-1042.307) [-1041.015] -- 0:00:09 387500 -- (-1041.111) (-1042.101) [-1042.571] (-1040.281) * [-1040.978] (-1040.144) (-1040.852) (-1044.444) -- 0:00:09 388000 -- (-1044.689) [-1041.899] (-1042.021) (-1040.887) * [-1040.985] (-1040.256) (-1042.091) (-1041.883) -- 0:00:10 388500 -- (-1042.439) [-1043.130] (-1042.072) (-1040.879) * (-1041.984) (-1045.400) (-1042.577) [-1043.220] -- 0:00:10 389000 -- [-1040.995] (-1043.162) (-1040.753) (-1040.738) * (-1043.128) (-1043.645) [-1040.699] (-1044.302) -- 0:00:09 389500 -- (-1041.184) [-1041.381] (-1042.372) (-1041.479) * (-1042.616) (-1047.105) (-1040.967) [-1042.635] -- 0:00:09 390000 -- (-1042.052) (-1040.976) (-1041.569) [-1041.754] * (-1040.472) (-1043.403) (-1040.337) [-1042.578] -- 0:00:09 Average standard deviation of split frequencies: 0.008044 390500 -- (-1042.452) (-1040.492) [-1041.587] (-1041.866) * (-1040.987) [-1041.048] (-1040.573) (-1044.322) -- 0:00:09 391000 -- [-1043.924] (-1046.705) (-1043.680) (-1044.460) * (-1041.187) (-1040.137) (-1041.399) [-1044.112] -- 0:00:09 391500 -- [-1042.666] (-1044.863) (-1044.775) (-1044.831) * [-1040.796] (-1040.159) (-1040.566) (-1041.739) -- 0:00:09 392000 -- (-1044.660) [-1042.433] (-1041.727) (-1042.637) * (-1043.288) [-1040.777] (-1041.588) (-1042.467) -- 0:00:09 392500 -- (-1041.160) (-1046.024) [-1040.481] (-1046.454) * [-1041.843] (-1042.885) (-1041.871) (-1041.700) -- 0:00:09 393000 -- (-1042.174) (-1044.265) [-1040.115] (-1041.002) * (-1042.130) (-1043.259) [-1043.296] (-1041.532) -- 0:00:09 393500 -- [-1042.972] (-1042.552) (-1039.929) (-1041.007) * (-1043.518) (-1042.171) (-1042.281) [-1040.734] -- 0:00:09 394000 -- (-1040.338) (-1040.423) (-1043.500) [-1040.336] * (-1041.858) (-1040.850) [-1043.038] (-1040.221) -- 0:00:09 394500 -- (-1041.102) [-1040.382] (-1043.142) (-1044.969) * (-1044.645) (-1042.008) [-1041.975] (-1040.220) -- 0:00:09 395000 -- [-1041.281] (-1040.419) (-1043.809) (-1041.432) * (-1041.825) (-1046.210) [-1041.004] (-1041.917) -- 0:00:09 Average standard deviation of split frequencies: 0.007142 395500 -- [-1040.314] (-1041.135) (-1042.756) (-1041.106) * (-1040.902) [-1040.007] (-1043.891) (-1043.016) -- 0:00:09 396000 -- [-1045.679] (-1040.983) (-1042.798) (-1042.277) * (-1043.888) (-1043.588) [-1043.408] (-1043.380) -- 0:00:09 396500 -- (-1044.612) (-1041.233) [-1042.713] (-1042.456) * [-1045.748] (-1042.073) (-1041.057) (-1043.133) -- 0:00:09 397000 -- (-1042.743) (-1040.808) [-1041.656] (-1052.144) * (-1046.650) [-1040.508] (-1042.344) (-1043.767) -- 0:00:09 397500 -- (-1046.198) (-1040.680) (-1043.263) [-1052.796] * (-1040.720) (-1042.364) (-1043.202) [-1041.565] -- 0:00:09 398000 -- [-1041.662] (-1040.592) (-1042.858) (-1041.817) * (-1043.012) (-1043.759) (-1042.499) [-1040.970] -- 0:00:08 398500 -- (-1042.962) (-1042.136) (-1040.654) [-1041.104] * (-1041.214) (-1047.492) [-1040.579] (-1043.576) -- 0:00:08 399000 -- (-1042.450) (-1042.953) [-1041.610] (-1040.998) * (-1040.740) (-1042.888) [-1040.887] (-1043.717) -- 0:00:08 399500 -- (-1044.528) (-1042.562) [-1040.762] (-1042.997) * (-1042.322) (-1040.920) [-1041.776] (-1043.133) -- 0:00:08 400000 -- [-1042.895] (-1043.620) (-1041.437) (-1041.498) * (-1042.686) (-1041.485) (-1044.295) [-1041.856] -- 0:00:08 Average standard deviation of split frequencies: 0.007129 400500 -- (-1042.265) (-1047.108) [-1041.527] (-1041.003) * [-1042.464] (-1042.807) (-1043.182) (-1042.441) -- 0:00:08 401000 -- (-1043.450) [-1041.224] (-1042.825) (-1043.832) * (-1045.470) (-1041.511) [-1040.811] (-1043.677) -- 0:00:08 401500 -- (-1041.180) (-1043.235) (-1041.912) [-1042.235] * (-1042.680) (-1043.891) [-1041.532] (-1040.447) -- 0:00:08 402000 -- (-1041.652) (-1044.666) [-1040.694] (-1042.700) * [-1042.158] (-1040.582) (-1041.060) (-1041.613) -- 0:00:08 402500 -- (-1042.531) (-1043.072) (-1043.398) [-1042.032] * (-1041.047) [-1042.249] (-1039.864) (-1041.557) -- 0:00:08 403000 -- [-1040.675] (-1043.201) (-1048.622) (-1041.893) * (-1044.031) (-1042.139) (-1040.481) [-1047.694] -- 0:00:08 403500 -- [-1040.917] (-1046.805) (-1040.704) (-1041.238) * (-1042.427) (-1041.978) (-1041.201) [-1044.836] -- 0:00:08 404000 -- (-1040.975) (-1043.639) [-1041.190] (-1041.983) * [-1041.355] (-1043.698) (-1046.244) (-1040.677) -- 0:00:08 404500 -- (-1047.036) [-1040.739] (-1043.422) (-1041.672) * (-1040.465) (-1044.157) (-1044.157) [-1043.953] -- 0:00:08 405000 -- (-1042.970) (-1042.621) (-1042.568) [-1045.620] * (-1043.833) (-1043.865) (-1044.045) [-1040.397] -- 0:00:08 Average standard deviation of split frequencies: 0.005805 405500 -- (-1041.034) (-1040.844) [-1041.618] (-1042.377) * (-1041.266) (-1040.761) [-1044.100] (-1041.310) -- 0:00:08 406000 -- (-1042.361) (-1041.329) [-1042.377] (-1043.456) * (-1043.640) [-1040.558] (-1043.524) (-1043.477) -- 0:00:08 406500 -- (-1041.434) [-1046.161] (-1047.380) (-1044.058) * (-1041.845) (-1040.802) [-1040.777] (-1045.232) -- 0:00:08 407000 -- [-1042.497] (-1045.605) (-1042.379) (-1041.839) * (-1040.566) (-1045.345) [-1041.093] (-1041.965) -- 0:00:08 407500 -- (-1041.492) (-1046.841) (-1041.383) [-1042.457] * [-1040.551] (-1042.581) (-1045.189) (-1042.764) -- 0:00:08 408000 -- (-1045.870) [-1040.534] (-1043.762) (-1042.842) * (-1040.971) [-1042.128] (-1044.166) (-1040.804) -- 0:00:08 408500 -- (-1042.282) (-1046.595) (-1041.494) [-1044.363] * (-1041.102) (-1040.402) [-1039.808] (-1044.725) -- 0:00:08 409000 -- [-1040.857] (-1041.888) (-1046.268) (-1044.993) * [-1042.721] (-1041.599) (-1040.014) (-1041.013) -- 0:00:08 409500 -- [-1043.142] (-1042.585) (-1045.776) (-1046.718) * (-1040.926) (-1042.020) [-1042.088] (-1048.133) -- 0:00:07 410000 -- (-1043.570) (-1046.448) (-1041.603) [-1046.839] * (-1042.151) (-1042.820) (-1048.809) [-1042.307] -- 0:00:07 Average standard deviation of split frequencies: 0.005612 410500 -- (-1042.494) (-1043.045) (-1041.204) [-1043.517] * [-1041.637] (-1041.212) (-1042.332) (-1042.075) -- 0:00:07 411000 -- (-1043.560) (-1041.115) [-1042.050] (-1043.526) * (-1040.485) (-1041.227) [-1041.173] (-1041.294) -- 0:00:07 411500 -- (-1043.143) [-1042.387] (-1044.486) (-1042.484) * (-1042.615) (-1043.756) (-1040.589) [-1041.051] -- 0:00:07 412000 -- (-1041.346) (-1047.008) [-1040.741] (-1041.855) * (-1040.262) [-1041.719] (-1040.241) (-1042.095) -- 0:00:07 412500 -- (-1040.396) [-1045.075] (-1040.209) (-1042.101) * (-1042.636) (-1041.640) [-1040.579] (-1047.406) -- 0:00:07 413000 -- (-1043.190) (-1044.135) [-1041.828] (-1041.314) * (-1041.378) (-1041.109) [-1040.539] (-1041.791) -- 0:00:07 413500 -- (-1044.251) [-1044.066] (-1040.056) (-1040.318) * (-1040.534) (-1042.572) (-1041.837) [-1041.203] -- 0:00:07 414000 -- [-1042.825] (-1042.694) (-1040.667) (-1041.213) * (-1042.452) [-1040.895] (-1042.431) (-1042.940) -- 0:00:07 414500 -- (-1043.440) [-1041.110] (-1040.831) (-1041.579) * (-1043.516) [-1040.611] (-1044.549) (-1045.099) -- 0:00:07 415000 -- (-1042.297) (-1041.127) (-1040.900) [-1042.508] * (-1044.204) (-1041.283) (-1042.931) [-1045.236] -- 0:00:07 Average standard deviation of split frequencies: 0.006484 415500 -- (-1041.106) [-1044.976] (-1040.579) (-1042.025) * (-1044.953) [-1042.284] (-1044.409) (-1050.279) -- 0:00:07 416000 -- (-1042.143) (-1041.445) [-1042.525] (-1042.997) * (-1040.599) [-1040.879] (-1043.206) (-1042.251) -- 0:00:07 416500 -- [-1044.572] (-1040.683) (-1046.481) (-1041.579) * [-1042.239] (-1042.906) (-1042.735) (-1043.788) -- 0:00:07 417000 -- [-1042.137] (-1040.257) (-1045.873) (-1040.927) * [-1042.423] (-1045.911) (-1041.299) (-1044.662) -- 0:00:07 417500 -- (-1044.872) (-1043.060) [-1042.476] (-1048.280) * (-1042.928) [-1043.405] (-1042.828) (-1044.180) -- 0:00:07 418000 -- (-1043.114) [-1041.586] (-1041.791) (-1046.644) * (-1045.451) (-1042.106) (-1042.213) [-1043.277] -- 0:00:07 418500 -- (-1043.153) [-1043.461] (-1044.225) (-1041.558) * (-1041.333) (-1041.567) (-1048.905) [-1043.021] -- 0:00:07 419000 -- [-1040.099] (-1040.854) (-1043.565) (-1041.660) * [-1041.689] (-1041.304) (-1041.191) (-1040.273) -- 0:00:07 419500 -- (-1040.280) [-1041.766] (-1045.155) (-1044.840) * (-1042.203) (-1044.244) (-1042.545) [-1046.070] -- 0:00:07 420000 -- [-1040.586] (-1043.891) (-1041.240) (-1041.744) * (-1041.815) (-1045.186) [-1042.804] (-1040.838) -- 0:00:07 Average standard deviation of split frequencies: 0.006856 420500 -- (-1042.389) (-1041.343) [-1041.280] (-1041.730) * (-1042.883) (-1044.469) (-1041.939) [-1041.074] -- 0:00:06 421000 -- (-1041.692) [-1043.263] (-1041.597) (-1040.956) * [-1040.857] (-1042.370) (-1041.760) (-1044.187) -- 0:00:06 421500 -- [-1047.737] (-1041.582) (-1041.544) (-1040.611) * (-1041.790) (-1042.670) [-1041.057] (-1045.663) -- 0:00:06 422000 -- (-1043.290) [-1041.149] (-1044.787) (-1042.889) * (-1043.078) [-1041.707] (-1042.635) (-1043.381) -- 0:00:06 422500 -- (-1042.475) (-1043.936) (-1042.163) [-1042.007] * (-1040.313) [-1041.672] (-1045.116) (-1041.144) -- 0:00:06 423000 -- [-1042.750] (-1042.286) (-1045.295) (-1043.096) * (-1041.907) (-1040.514) [-1044.004] (-1041.709) -- 0:00:06 423500 -- (-1042.165) [-1041.090] (-1047.569) (-1047.384) * [-1043.283] (-1040.434) (-1043.558) (-1042.044) -- 0:00:06 424000 -- [-1041.898] (-1041.983) (-1044.329) (-1042.969) * (-1040.558) [-1041.575] (-1042.085) (-1041.577) -- 0:00:06 424500 -- (-1041.215) [-1041.470] (-1042.250) (-1044.176) * [-1042.992] (-1045.342) (-1042.298) (-1041.209) -- 0:00:06 425000 -- (-1041.284) [-1043.242] (-1042.918) (-1042.266) * (-1043.838) (-1043.146) [-1043.600] (-1043.433) -- 0:00:06 Average standard deviation of split frequencies: 0.007095 425500 -- (-1040.733) [-1042.539] (-1040.918) (-1040.858) * (-1042.288) (-1044.031) (-1042.687) [-1043.803] -- 0:00:06 426000 -- (-1040.713) [-1044.156] (-1047.110) (-1044.310) * [-1042.377] (-1044.911) (-1045.621) (-1046.964) -- 0:00:06 426500 -- (-1040.604) (-1042.231) [-1039.947] (-1048.033) * [-1042.706] (-1043.896) (-1044.070) (-1041.119) -- 0:00:06 427000 -- (-1040.287) [-1043.818] (-1043.021) (-1048.056) * [-1040.701] (-1045.171) (-1043.630) (-1040.980) -- 0:00:06 427500 -- (-1042.031) (-1044.627) (-1041.597) [-1042.745] * (-1040.699) (-1046.100) (-1043.344) [-1043.658] -- 0:00:06 428000 -- [-1043.284] (-1046.138) (-1041.106) (-1048.833) * [-1040.663] (-1042.019) (-1040.823) (-1047.264) -- 0:00:06 428500 -- (-1044.269) (-1043.498) [-1040.355] (-1044.941) * (-1043.182) [-1043.657] (-1040.548) (-1042.468) -- 0:00:06 429000 -- [-1041.955] (-1040.686) (-1040.768) (-1043.328) * [-1042.413] (-1043.683) (-1040.836) (-1043.880) -- 0:00:06 429500 -- (-1042.226) (-1042.090) [-1040.918] (-1046.642) * [-1041.295] (-1041.111) (-1042.005) (-1042.462) -- 0:00:06 430000 -- (-1040.687) [-1042.729] (-1041.197) (-1043.269) * [-1042.316] (-1042.287) (-1042.208) (-1043.514) -- 0:00:06 Average standard deviation of split frequencies: 0.007276 430500 -- (-1042.603) (-1040.108) (-1040.905) [-1046.012] * (-1044.927) (-1041.310) [-1040.912] (-1044.353) -- 0:00:06 431000 -- (-1046.060) (-1042.625) [-1043.964] (-1042.912) * (-1043.742) (-1042.864) (-1040.798) [-1041.024] -- 0:00:06 431500 -- (-1045.405) (-1041.879) (-1042.155) [-1042.381] * (-1042.834) [-1041.359] (-1040.894) (-1041.224) -- 0:00:06 432000 -- (-1043.271) (-1046.653) (-1041.384) [-1042.133] * [-1042.512] (-1044.448) (-1042.030) (-1042.066) -- 0:00:05 432500 -- (-1043.142) (-1041.107) [-1046.672] (-1040.221) * (-1041.246) (-1043.588) [-1043.234] (-1041.827) -- 0:00:05 433000 -- (-1045.646) [-1040.714] (-1041.748) (-1040.673) * (-1040.958) (-1041.386) (-1040.938) [-1044.874] -- 0:00:05 433500 -- (-1042.428) [-1045.138] (-1040.259) (-1048.669) * (-1041.761) (-1041.396) (-1043.476) [-1043.302] -- 0:00:05 434000 -- (-1042.055) (-1041.884) [-1040.965] (-1040.488) * (-1040.545) [-1042.210] (-1045.900) (-1043.419) -- 0:00:05 434500 -- (-1044.107) (-1042.288) (-1042.628) [-1039.968] * (-1040.688) (-1042.772) [-1042.505] (-1041.594) -- 0:00:05 435000 -- (-1044.484) [-1042.209] (-1041.444) (-1041.096) * (-1042.706) (-1044.556) [-1041.178] (-1043.092) -- 0:00:05 Average standard deviation of split frequencies: 0.006968 435500 -- (-1043.529) (-1043.075) (-1041.210) [-1043.381] * (-1042.088) (-1042.005) [-1040.757] (-1041.200) -- 0:00:05 436000 -- (-1043.116) (-1044.097) (-1042.197) [-1043.317] * (-1042.059) [-1042.866] (-1041.491) (-1041.214) -- 0:00:05 436500 -- (-1041.529) (-1041.448) (-1041.937) [-1043.455] * (-1045.808) (-1042.476) (-1041.967) [-1042.488] -- 0:00:05 437000 -- (-1041.695) (-1041.680) [-1044.737] (-1040.823) * (-1041.751) (-1041.212) [-1040.987] (-1042.266) -- 0:00:05 437500 -- (-1040.903) [-1041.550] (-1043.867) (-1042.239) * (-1041.917) [-1041.605] (-1041.064) (-1042.162) -- 0:00:05 438000 -- (-1040.544) [-1041.740] (-1042.273) (-1045.654) * (-1040.812) [-1042.010] (-1041.181) (-1043.656) -- 0:00:05 438500 -- (-1042.856) (-1043.238) [-1041.700] (-1042.923) * (-1042.998) [-1043.073] (-1040.488) (-1044.546) -- 0:00:05 439000 -- (-1045.122) (-1042.136) [-1044.263] (-1042.122) * (-1042.079) (-1045.429) [-1044.258] (-1040.448) -- 0:00:05 439500 -- [-1042.821] (-1041.696) (-1042.312) (-1042.426) * (-1041.047) (-1045.061) (-1041.926) [-1040.956] -- 0:00:05 440000 -- (-1040.561) (-1041.732) [-1043.631] (-1040.952) * (-1043.894) (-1041.704) [-1041.296] (-1045.364) -- 0:00:05 Average standard deviation of split frequencies: 0.006985 440500 -- (-1044.188) [-1041.692] (-1042.774) (-1039.931) * (-1042.664) (-1044.646) [-1041.296] (-1042.847) -- 0:00:05 441000 -- [-1040.122] (-1043.566) (-1044.689) (-1041.123) * (-1041.176) (-1045.418) [-1042.709] (-1042.569) -- 0:00:05 441500 -- [-1041.104] (-1042.547) (-1044.250) (-1040.850) * [-1040.264] (-1044.025) (-1041.314) (-1042.329) -- 0:00:05 442000 -- (-1042.735) (-1042.378) (-1043.378) [-1040.445] * (-1041.576) [-1042.959] (-1041.654) (-1045.182) -- 0:00:05 442500 -- (-1043.481) (-1042.531) [-1042.156] (-1041.945) * [-1040.526] (-1043.943) (-1042.582) (-1053.488) -- 0:00:05 443000 -- [-1041.185] (-1046.111) (-1043.957) (-1044.498) * (-1041.052) (-1041.542) [-1040.253] (-1047.550) -- 0:00:05 443500 -- (-1044.060) (-1045.406) [-1041.123] (-1042.050) * (-1040.815) (-1041.720) (-1040.497) [-1042.230] -- 0:00:04 444000 -- (-1041.133) (-1040.703) (-1042.602) [-1042.450] * (-1046.357) [-1044.926] (-1042.780) (-1040.984) -- 0:00:04 444500 -- (-1041.169) [-1041.617] (-1045.410) (-1041.187) * (-1046.221) [-1043.192] (-1045.246) (-1045.318) -- 0:00:04 445000 -- [-1040.213] (-1040.311) (-1047.201) (-1041.187) * (-1043.752) (-1043.020) (-1041.846) [-1043.768] -- 0:00:04 Average standard deviation of split frequencies: 0.006518 445500 -- (-1040.890) (-1040.328) (-1043.033) [-1044.123] * (-1043.878) (-1042.035) [-1040.437] (-1042.472) -- 0:00:04 446000 -- (-1041.997) (-1041.026) (-1042.407) [-1040.819] * (-1040.987) (-1046.161) [-1041.278] (-1043.225) -- 0:00:04 446500 -- [-1042.839] (-1042.195) (-1041.499) (-1041.526) * (-1041.298) (-1050.384) (-1041.675) [-1040.262] -- 0:00:04 447000 -- (-1043.950) [-1043.265] (-1041.507) (-1047.197) * [-1041.209] (-1041.060) (-1044.256) (-1040.234) -- 0:00:04 447500 -- [-1041.670] (-1043.989) (-1043.733) (-1043.121) * [-1042.993] (-1040.806) (-1043.112) (-1050.084) -- 0:00:04 448000 -- (-1043.827) (-1042.806) (-1040.909) [-1042.033] * (-1041.992) (-1040.318) (-1044.064) [-1044.493] -- 0:00:04 448500 -- (-1043.200) (-1041.134) [-1040.903] (-1041.278) * (-1041.133) [-1041.218] (-1042.271) (-1041.576) -- 0:00:04 449000 -- [-1041.161] (-1040.831) (-1041.491) (-1045.147) * (-1040.762) (-1047.372) [-1044.778] (-1043.711) -- 0:00:04 449500 -- (-1044.519) (-1041.179) (-1042.858) [-1040.959] * [-1040.799] (-1042.329) (-1041.827) (-1044.778) -- 0:00:04 450000 -- (-1041.350) (-1042.277) (-1041.349) [-1040.610] * [-1041.092] (-1045.635) (-1041.001) (-1043.720) -- 0:00:04 Average standard deviation of split frequencies: 0.006645 450500 -- (-1046.046) (-1044.103) [-1042.456] (-1044.110) * [-1041.782] (-1049.844) (-1040.523) (-1045.496) -- 0:00:04 451000 -- (-1041.899) (-1042.337) [-1039.941] (-1044.543) * (-1043.018) (-1042.536) [-1042.614] (-1040.331) -- 0:00:04 451500 -- [-1045.096] (-1043.359) (-1040.476) (-1042.700) * (-1040.533) [-1048.226] (-1044.559) (-1040.469) -- 0:00:04 452000 -- (-1043.294) (-1041.726) (-1044.757) [-1041.402] * [-1040.448] (-1047.036) (-1045.345) (-1043.416) -- 0:00:04 452500 -- (-1041.533) (-1044.519) (-1040.908) [-1040.546] * [-1041.588] (-1043.432) (-1042.466) (-1042.438) -- 0:00:04 453000 -- (-1041.221) [-1042.827] (-1047.455) (-1043.735) * [-1040.554] (-1047.620) (-1042.068) (-1042.991) -- 0:00:04 453500 -- [-1041.066] (-1040.239) (-1040.227) (-1043.058) * (-1041.904) (-1041.028) [-1042.701] (-1042.060) -- 0:00:04 454000 -- (-1043.381) (-1042.735) [-1040.525] (-1042.174) * (-1041.199) (-1043.510) [-1043.891] (-1043.642) -- 0:00:04 454500 -- (-1041.620) [-1042.393] (-1044.530) (-1044.006) * (-1043.801) [-1042.260] (-1040.717) (-1040.970) -- 0:00:04 455000 -- [-1042.544] (-1044.244) (-1045.768) (-1040.459) * (-1041.547) (-1040.249) (-1042.743) [-1042.937] -- 0:00:03 Average standard deviation of split frequencies: 0.006461 455500 -- (-1041.414) (-1043.077) [-1041.264] (-1039.968) * (-1043.324) (-1045.689) [-1042.226] (-1043.491) -- 0:00:03 456000 -- (-1042.246) (-1041.003) (-1044.361) [-1040.800] * (-1042.868) [-1040.370] (-1043.408) (-1040.772) -- 0:00:03 456500 -- (-1042.719) (-1044.978) [-1045.972] (-1040.445) * (-1042.145) (-1048.523) [-1040.052] (-1040.849) -- 0:00:03 457000 -- (-1040.339) [-1042.090] (-1043.012) (-1041.391) * (-1040.238) (-1039.963) [-1041.056] (-1043.372) -- 0:00:03 457500 -- (-1042.679) [-1041.200] (-1042.362) (-1039.788) * [-1042.413] (-1040.363) (-1040.886) (-1046.994) -- 0:00:03 458000 -- (-1042.173) (-1041.366) (-1042.470) [-1040.530] * (-1043.027) (-1040.397) [-1040.944] (-1046.831) -- 0:00:03 458500 -- (-1043.574) [-1041.597] (-1042.458) (-1040.715) * (-1043.037) (-1039.969) [-1041.278] (-1042.053) -- 0:00:03 459000 -- (-1045.952) [-1042.639] (-1042.047) (-1040.437) * (-1040.961) (-1040.168) (-1045.789) [-1042.098] -- 0:00:03 459500 -- (-1040.722) (-1041.771) [-1041.128] (-1040.859) * (-1042.645) (-1041.340) [-1044.049] (-1040.096) -- 0:00:03 460000 -- (-1043.494) [-1043.894] (-1041.957) (-1042.385) * (-1040.157) (-1040.479) (-1046.422) [-1040.272] -- 0:00:03 Average standard deviation of split frequencies: 0.006843 460500 -- (-1042.115) (-1044.829) [-1043.107] (-1041.330) * [-1042.451] (-1040.829) (-1046.565) (-1041.006) -- 0:00:03 461000 -- (-1041.999) [-1040.020] (-1043.358) (-1043.446) * (-1044.386) (-1042.668) (-1045.908) [-1041.532] -- 0:00:03 461500 -- (-1043.465) (-1040.896) [-1044.677] (-1044.259) * (-1043.685) (-1043.425) (-1041.354) [-1041.501] -- 0:00:03 462000 -- (-1046.136) [-1042.256] (-1043.508) (-1041.900) * [-1047.446] (-1044.254) (-1043.428) (-1042.591) -- 0:00:03 462500 -- (-1042.811) [-1041.455] (-1041.451) (-1039.894) * [-1041.874] (-1042.023) (-1048.057) (-1042.371) -- 0:00:03 463000 -- (-1043.633) (-1041.524) (-1043.606) [-1040.010] * (-1040.248) (-1041.140) (-1046.519) [-1052.661] -- 0:00:03 463500 -- (-1041.733) [-1040.804] (-1040.401) (-1042.406) * [-1042.057] (-1042.627) (-1043.862) (-1042.161) -- 0:00:03 464000 -- (-1042.744) (-1044.346) (-1040.657) [-1045.484] * (-1041.627) (-1041.436) (-1045.007) [-1043.444] -- 0:00:03 464500 -- (-1042.905) (-1046.217) (-1043.699) [-1041.605] * (-1041.535) (-1040.776) [-1040.023] (-1041.477) -- 0:00:03 465000 -- [-1040.998] (-1047.451) (-1042.113) (-1045.000) * (-1041.335) (-1041.486) [-1040.276] (-1042.255) -- 0:00:03 Average standard deviation of split frequencies: 0.006308 465500 -- (-1040.584) [-1041.403] (-1042.289) (-1040.021) * (-1041.455) (-1041.109) [-1042.292] (-1046.102) -- 0:00:03 466000 -- [-1040.646] (-1040.639) (-1041.647) (-1040.710) * (-1045.846) [-1043.116] (-1042.580) (-1042.475) -- 0:00:02 466500 -- (-1041.866) (-1041.505) [-1043.095] (-1043.820) * (-1045.853) (-1044.544) [-1044.736] (-1041.107) -- 0:00:02 467000 -- (-1042.645) [-1042.530] (-1043.526) (-1043.857) * (-1042.604) (-1042.976) (-1040.980) [-1039.932] -- 0:00:02 467500 -- (-1042.896) [-1041.597] (-1041.493) (-1048.830) * (-1042.410) (-1042.168) [-1041.927] (-1041.786) -- 0:00:02 468000 -- (-1041.956) (-1042.601) (-1042.461) [-1043.142] * [-1043.652] (-1046.801) (-1043.742) (-1041.196) -- 0:00:02 468500 -- [-1041.962] (-1045.051) (-1041.808) (-1045.647) * (-1043.878) (-1043.583) [-1040.799] (-1041.579) -- 0:00:02 469000 -- (-1041.243) (-1041.272) (-1046.612) [-1041.431] * (-1042.019) (-1041.038) [-1043.787] (-1040.682) -- 0:00:02 469500 -- (-1040.132) (-1043.888) (-1046.093) [-1042.571] * (-1040.735) [-1041.107] (-1040.369) (-1040.682) -- 0:00:02 470000 -- (-1042.033) (-1042.014) (-1041.471) [-1042.805] * (-1041.237) (-1041.107) (-1040.139) [-1039.968] -- 0:00:02 Average standard deviation of split frequencies: 0.006716 470500 -- (-1043.531) (-1042.206) (-1041.312) [-1041.112] * (-1041.691) (-1042.043) [-1040.108] (-1040.294) -- 0:00:02 471000 -- [-1042.015] (-1041.990) (-1041.504) (-1042.428) * (-1042.025) (-1044.130) [-1040.210] (-1040.213) -- 0:00:02 471500 -- (-1045.483) [-1041.535] (-1043.435) (-1043.139) * (-1043.070) [-1040.652] (-1041.957) (-1041.171) -- 0:00:02 472000 -- (-1041.367) (-1041.886) (-1040.850) [-1040.388] * (-1045.338) (-1043.851) (-1040.835) [-1041.525] -- 0:00:02 472500 -- (-1042.883) [-1040.535] (-1050.736) (-1047.925) * [-1041.713] (-1042.371) (-1042.743) (-1045.377) -- 0:00:02 473000 -- (-1044.507) [-1040.431] (-1044.972) (-1043.286) * (-1040.407) [-1040.497] (-1043.117) (-1045.223) -- 0:00:02 473500 -- (-1041.998) (-1041.187) [-1041.632] (-1041.078) * [-1040.272] (-1043.422) (-1039.810) (-1041.895) -- 0:00:02 474000 -- (-1040.387) (-1040.815) [-1040.120] (-1043.182) * (-1041.863) (-1042.253) (-1041.251) [-1044.854] -- 0:00:02 474500 -- (-1043.480) [-1041.704] (-1041.356) (-1043.361) * [-1042.807] (-1040.968) (-1042.762) (-1044.001) -- 0:00:02 475000 -- [-1041.663] (-1042.424) (-1042.834) (-1041.914) * (-1042.006) (-1044.434) (-1042.554) [-1044.823] -- 0:00:02 Average standard deviation of split frequencies: 0.006641 475500 -- (-1045.342) (-1041.041) (-1044.641) [-1041.911] * (-1041.710) (-1040.699) [-1042.495] (-1047.094) -- 0:00:02 476000 -- (-1042.841) (-1042.794) [-1042.381] (-1041.560) * [-1041.622] (-1041.497) (-1040.450) (-1047.658) -- 0:00:02 476500 -- (-1045.426) (-1043.185) (-1041.534) [-1040.913] * (-1043.624) [-1041.673] (-1041.537) (-1045.016) -- 0:00:02 477000 -- [-1043.582] (-1045.824) (-1041.391) (-1041.998) * (-1046.637) (-1044.297) [-1041.155] (-1046.769) -- 0:00:02 477500 -- (-1042.188) [-1046.529] (-1041.998) (-1045.754) * (-1044.344) (-1045.533) (-1042.456) [-1042.335] -- 0:00:01 478000 -- [-1041.543] (-1045.306) (-1044.830) (-1045.088) * (-1042.585) (-1043.846) (-1040.347) [-1044.568] -- 0:00:01 478500 -- (-1040.957) [-1043.168] (-1040.544) (-1043.524) * (-1040.982) [-1042.082] (-1044.962) (-1044.177) -- 0:00:01 479000 -- (-1040.955) (-1041.214) (-1040.227) [-1040.455] * (-1042.616) (-1043.751) [-1042.796] (-1041.789) -- 0:00:01 479500 -- (-1043.652) (-1041.068) (-1040.275) [-1040.504] * (-1042.783) [-1041.412] (-1047.627) (-1042.883) -- 0:00:01 480000 -- (-1041.981) [-1041.121] (-1042.867) (-1040.710) * (-1043.966) (-1043.010) [-1048.242] (-1045.634) -- 0:00:01 Average standard deviation of split frequencies: 0.006634 480500 -- (-1041.285) (-1040.848) (-1040.417) [-1042.015] * (-1041.988) [-1044.052] (-1049.774) (-1043.827) -- 0:00:01 481000 -- (-1042.261) [-1040.510] (-1045.321) (-1042.015) * (-1040.943) (-1043.554) [-1044.064] (-1045.103) -- 0:00:01 481500 -- (-1041.109) (-1040.985) [-1045.553] (-1041.452) * (-1042.156) [-1042.517] (-1040.407) (-1043.148) -- 0:00:01 482000 -- (-1040.832) (-1042.144) (-1043.744) [-1040.329] * (-1042.380) [-1042.940] (-1041.481) (-1041.663) -- 0:00:01 482500 -- (-1042.350) (-1049.572) [-1040.728] (-1041.147) * [-1040.504] (-1042.335) (-1041.376) (-1043.737) -- 0:00:01 483000 -- [-1043.105] (-1046.034) (-1044.875) (-1041.485) * (-1040.558) [-1042.449] (-1041.380) (-1042.115) -- 0:00:01 483500 -- (-1043.008) [-1042.073] (-1042.074) (-1042.420) * [-1041.131] (-1043.844) (-1040.196) (-1041.072) -- 0:00:01 484000 -- (-1041.319) (-1041.300) [-1041.096] (-1042.409) * (-1040.545) (-1043.631) [-1040.499] (-1041.707) -- 0:00:01 484500 -- (-1045.131) [-1040.406] (-1042.858) (-1043.966) * (-1042.545) (-1043.590) (-1040.729) [-1041.346] -- 0:00:01 485000 -- (-1041.679) [-1040.667] (-1043.124) (-1042.967) * (-1041.307) (-1040.902) (-1043.629) [-1046.814] -- 0:00:01 Average standard deviation of split frequencies: 0.007189 485500 -- (-1040.534) (-1040.460) [-1040.418] (-1041.718) * (-1041.579) [-1042.763] (-1041.391) (-1042.106) -- 0:00:01 486000 -- (-1042.531) (-1041.352) [-1039.854] (-1042.838) * [-1043.265] (-1041.688) (-1044.147) (-1041.129) -- 0:00:01 486500 -- (-1040.699) (-1042.352) (-1041.894) [-1041.794] * [-1043.408] (-1041.222) (-1049.059) (-1045.462) -- 0:00:01 487000 -- [-1041.088] (-1041.158) (-1041.706) (-1042.520) * (-1041.005) (-1040.667) [-1044.019] (-1042.031) -- 0:00:01 487500 -- [-1041.718] (-1042.876) (-1042.077) (-1043.490) * (-1042.125) [-1043.005] (-1041.575) (-1043.528) -- 0:00:01 488000 -- (-1041.443) (-1040.767) (-1043.119) [-1042.997] * [-1042.329] (-1041.489) (-1040.637) (-1042.821) -- 0:00:01 488500 -- (-1041.674) (-1042.430) (-1042.010) [-1041.381] * (-1040.836) (-1041.919) (-1041.148) [-1042.216] -- 0:00:01 489000 -- [-1041.239] (-1041.015) (-1041.955) (-1041.402) * (-1040.788) [-1041.735] (-1040.862) (-1040.442) -- 0:00:00 489500 -- (-1041.227) [-1040.846] (-1043.956) (-1045.821) * (-1041.625) [-1044.335] (-1041.121) (-1041.278) -- 0:00:00 490000 -- (-1043.206) (-1043.173) [-1042.414] (-1043.765) * (-1041.991) (-1041.099) (-1044.273) [-1044.274] -- 0:00:00 Average standard deviation of split frequencies: 0.007177 490500 -- (-1045.138) (-1042.162) [-1046.162] (-1040.914) * (-1039.822) (-1041.477) (-1045.356) [-1042.562] -- 0:00:00 491000 -- (-1041.290) (-1041.281) (-1043.844) [-1040.810] * (-1043.410) (-1042.365) [-1042.568] (-1042.651) -- 0:00:00 491500 -- [-1040.053] (-1041.642) (-1042.173) (-1040.416) * [-1044.055] (-1041.644) (-1042.234) (-1046.210) -- 0:00:00 492000 -- [-1040.304] (-1042.045) (-1040.598) (-1045.883) * (-1040.926) (-1040.553) (-1040.946) [-1044.365] -- 0:00:00 492500 -- (-1041.058) (-1048.536) [-1042.121] (-1042.986) * (-1040.220) [-1042.263] (-1042.394) (-1042.553) -- 0:00:00 493000 -- (-1043.193) (-1046.141) [-1040.510] (-1041.150) * [-1042.078] (-1040.012) (-1045.167) (-1042.393) -- 0:00:00 493500 -- (-1040.962) (-1045.153) (-1044.609) [-1040.771] * (-1042.051) (-1040.855) (-1046.240) [-1042.668] -- 0:00:00 494000 -- [-1041.118] (-1042.341) (-1043.452) (-1041.458) * [-1041.271] (-1041.263) (-1042.667) (-1042.958) -- 0:00:00 494500 -- (-1044.523) [-1043.146] (-1043.498) (-1043.699) * (-1040.419) (-1040.853) (-1041.591) [-1040.869] -- 0:00:00 495000 -- (-1041.223) (-1044.720) [-1043.119] (-1042.324) * (-1041.708) (-1045.449) (-1041.482) [-1041.226] -- 0:00:00 Average standard deviation of split frequencies: 0.007100 495500 -- (-1042.513) [-1042.481] (-1042.242) (-1045.512) * (-1042.006) (-1042.648) [-1041.561] (-1040.389) -- 0:00:00 496000 -- (-1042.648) (-1043.092) (-1044.449) [-1040.851] * (-1042.983) [-1041.020] (-1042.082) (-1043.501) -- 0:00:00 496500 -- (-1043.832) [-1042.206] (-1047.982) (-1043.519) * (-1041.999) (-1040.758) [-1042.110] (-1046.461) -- 0:00:00 497000 -- (-1042.751) (-1041.533) (-1046.007) [-1041.166] * (-1041.562) (-1040.785) (-1042.508) [-1040.784] -- 0:00:00 497500 -- (-1043.892) (-1042.159) [-1041.276] (-1041.833) * (-1041.553) [-1040.723] (-1042.861) (-1042.024) -- 0:00:00 498000 -- (-1041.233) [-1042.014] (-1040.123) (-1041.233) * (-1041.164) [-1043.136] (-1045.637) (-1044.865) -- 0:00:00 498500 -- [-1041.422] (-1042.831) (-1040.546) (-1042.741) * [-1040.308] (-1041.892) (-1044.330) (-1043.236) -- 0:00:00 499000 -- [-1041.183] (-1043.262) (-1042.849) (-1041.151) * [-1040.279] (-1044.274) (-1042.079) (-1045.041) -- 0:00:00 499500 -- (-1042.685) (-1042.977) (-1044.910) [-1042.234] * (-1044.420) (-1042.244) (-1043.949) [-1040.197] -- 0:00:00 500000 -- (-1042.480) [-1044.978] (-1044.298) (-1041.358) * (-1042.660) (-1042.479) (-1042.470) [-1041.664] -- 0:00:00 Average standard deviation of split frequencies: 0.006923 Analysis completed in 44 seconds Analysis used 43.61 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1039.69 Likelihood of best state for "cold" chain of run 2 was -1039.69 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 78.0 % ( 66 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 28.9 % ( 26 %) Dirichlet(Pi{all}) 31.7 % ( 26 %) Slider(Pi{all}) 88.5 % ( 80 %) Multiplier(Alpha{1,2}) 87.7 % ( 77 %) Multiplier(Alpha{3}) 16.4 % ( 20 %) Slider(Pinvar{all}) 98.6 % ( 97 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 89 %) ParsSPR(Tau{all},V{all}) 30.6 % ( 32 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 35.2 % ( 21 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 79.0 % ( 76 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 27.6 % ( 23 %) Dirichlet(Pi{all}) 32.3 % ( 28 %) Slider(Pi{all}) 88.5 % ( 84 %) Multiplier(Alpha{1,2}) 88.3 % ( 81 %) Multiplier(Alpha{3}) 16.9 % ( 11 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 86 %) ParsSPR(Tau{all},V{all}) 30.8 % ( 30 %) Multiplier(V{all}) 97.5 % ( 97 %) Nodeslider(V{all}) 35.2 % ( 26 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ------------------------------ 1 | 0.81 0.64 0.50 2 | 83443 0.82 0.67 3 | 83385 83453 0.84 4 | 83079 83152 83488 Chain swap information for run 2: 1 2 3 4 ------------------------------ 1 | 0.81 0.64 0.50 2 | 83612 0.82 0.67 3 | 83269 83168 0.84 4 | 83454 83331 83166 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 1250 Summarizing parameters in files /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1041.17 | 2 2 2 2| |2 2 12 2 2 * 1 | |1 2 1 1 12 2 2 1 1 | | 1 21 1 1 1 1 1 221 *1 | | 2 2 1 222 1 1 11 2 1 1 | | 1 1 1 2 2 2 2 1 1 2 1 2 12 2 1| | 11 2 1 12 2 22 1 2 2 2 21 | | 2 2 1 1 2 1 12 2 | | 12 1 1 * 1 1 1 2 | | 2 2 * 1 2 2 1 1 2 2 | | 1 2 1 1 | | 1 2 | | 1 2 | | | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1043.90 ^ ^ 125000 500000 Estimated marginal likelihoods for runs sampled in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1041.42 -1046.90 2 -1041.42 -1046.61 -------------------------------------- TOTAL -1041.42 -1046.77 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 1502 samples from 2 runs. Each run produced 1001 samples of which 751 samples were included. Parameter summaries saved to file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.895202 0.089328 0.325676 1.456397 0.868260 729.96 740.48 1.000 r(A<->C){all} 0.168432 0.019310 0.000043 0.443438 0.136281 93.78 107.07 1.002 r(A<->G){all} 0.192433 0.024017 0.000022 0.503135 0.155764 41.84 79.21 1.001 r(A<->T){all} 0.169539 0.021820 0.000240 0.466215 0.128169 69.01 120.24 1.006 r(C<->G){all} 0.154293 0.016582 0.000276 0.406617 0.117219 54.48 98.75 1.002 r(C<->T){all} 0.145424 0.016265 0.000134 0.395582 0.110449 63.26 119.80 1.032 r(G<->T){all} 0.169880 0.020505 0.000020 0.457476 0.131016 95.05 134.20 1.008 pi(A){all} 0.196097 0.000199 0.168737 0.222238 0.195464 300.40 466.37 1.000 pi(C){all} 0.326833 0.000284 0.297580 0.360595 0.326626 660.63 705.82 1.000 pi(G){all} 0.297105 0.000277 0.266385 0.329805 0.297330 612.57 615.96 1.000 pi(T){all} 0.179965 0.000191 0.153129 0.204972 0.179892 650.52 652.47 1.000 alpha{1,2} 0.416760 0.222502 0.000250 1.381453 0.251733 457.58 501.57 1.001 alpha{3} 0.455643 0.229273 0.000172 1.445714 0.295882 445.76 480.74 0.999 pinvar{all} 0.997970 0.000006 0.993335 0.999996 0.998708 381.36 490.88 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 1250 Summarizing trees in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 2002 trees in 2 files (sampling 1502 of them) (Each file contained 1001 trees of which 751 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ..*.*. 8 -- ..**** 9 -- ...*.* 10 -- .****. 11 -- .**... 12 -- ....** 13 -- ...**. 14 -- ..**.. 15 -- .**.** 16 -- ..*..* 17 -- .*.*.. 18 -- .*..*. 19 -- .*.*** 20 -- .*...* 21 -- .***.* 22 -- ..*.** 23 -- .**.*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 240 0.159787 0.003766 0.157124 0.162450 2 8 236 0.157124 0.003766 0.154461 0.159787 2 9 231 0.153795 0.010357 0.146471 0.161119 2 10 228 0.151798 0.007532 0.146471 0.157124 2 11 223 0.148469 0.006591 0.143808 0.153129 2 12 221 0.147137 0.002825 0.145140 0.149134 2 13 221 0.147137 0.002825 0.145140 0.149134 2 14 220 0.146471 0.005649 0.142477 0.150466 2 15 213 0.141811 0.012240 0.133156 0.150466 2 16 211 0.140479 0.014123 0.130493 0.150466 2 17 208 0.138482 0.011299 0.130493 0.146471 2 18 206 0.137150 0.007532 0.131824 0.142477 2 19 196 0.130493 0.001883 0.129161 0.131824 2 20 185 0.123169 0.010357 0.115846 0.130493 2 21 184 0.122503 0.005649 0.118509 0.126498 2 22 150 0.099867 0.001883 0.098535 0.101198 2 23 144 0.095872 0.009416 0.089214 0.102530 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.100056 0.009789 0.000182 0.302592 0.069442 1.001 2 length{all}[2] 0.097597 0.008919 0.000034 0.284201 0.067188 1.000 2 length{all}[3] 0.099444 0.010196 0.000144 0.298166 0.067240 1.000 2 length{all}[4] 0.098003 0.008757 0.000053 0.294465 0.070536 0.999 2 length{all}[5] 0.104621 0.010947 0.000037 0.314465 0.070007 1.002 2 length{all}[6] 0.097124 0.009337 0.000049 0.287910 0.069461 0.999 2 length{all}[7] 0.097970 0.009204 0.000325 0.290049 0.063694 1.019 2 length{all}[8] 0.104769 0.011448 0.000807 0.320207 0.075298 1.002 2 length{all}[9] 0.101494 0.009410 0.000379 0.278272 0.078624 0.996 2 length{all}[10] 0.090285 0.012789 0.000184 0.272015 0.053769 0.998 2 length{all}[11] 0.101878 0.009688 0.000166 0.301546 0.073550 0.996 2 length{all}[12] 0.108176 0.009707 0.001626 0.306230 0.077215 1.001 2 length{all}[13] 0.109606 0.011187 0.000138 0.296311 0.079378 0.997 2 length{all}[14] 0.103312 0.010754 0.000047 0.330521 0.079023 0.998 2 length{all}[15] 0.097460 0.009591 0.000252 0.279395 0.063305 1.001 2 length{all}[16] 0.109133 0.012361 0.000765 0.330198 0.076298 0.996 2 length{all}[17] 0.094915 0.009073 0.000605 0.277254 0.069501 1.005 2 length{all}[18] 0.086670 0.006111 0.000822 0.249745 0.063034 1.003 2 length{all}[19] 0.101936 0.011311 0.002357 0.274881 0.067985 0.995 2 length{all}[20] 0.111489 0.010409 0.000465 0.301181 0.079401 0.995 2 length{all}[21] 0.095368 0.007698 0.000183 0.278732 0.066915 0.995 2 length{all}[22] 0.092191 0.005995 0.001285 0.239327 0.065157 1.001 2 length{all}[23] 0.087018 0.006687 0.000320 0.254134 0.058868 1.071 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006923 Maximum standard deviation of split frequencies = 0.014123 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.003 Maximum PSRF for parameter values = 1.071 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |--------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------------ C4 (4) | |----------------------------------------------------------------------- C5 (5) | \----------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 40 trees 90 % credible set contains 87 trees 95 % credible set contains 96 trees 99 % credible set contains 103 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 804 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sites with gaps or missing data are removed. 36 ambiguity characters in seq. 1 36 ambiguity characters in seq. 2 36 ambiguity characters in seq. 3 36 ambiguity characters in seq. 4 72 ambiguity characters in seq. 5 72 ambiguity characters in seq. 6 24 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 257 258 259 260 261 262 263 264 265 266 267 268 Sequences read.. Counting site patterns.. 0:00 Compressing, 57 patterns at 244 / 244 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 57 patterns at 244 / 244 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 55632 bytes for conP 5016 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.103177 0.062397 0.097971 0.087220 0.108440 0.031599 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1081.659218 Iterating by ming2 Initial: fx= 1081.659218 x= 0.10318 0.06240 0.09797 0.08722 0.10844 0.03160 0.30000 1.30000 1 h-m-p 0.0000 0.0001 584.4495 ++ 1036.723693 m 0.0001 13 | 1/8 2 h-m-p 0.0021 0.0105 30.3367 ------------.. | 1/8 3 h-m-p 0.0000 0.0001 535.7016 ++ 999.711566 m 0.0001 45 | 2/8 4 h-m-p 0.0042 0.0287 14.6965 ------------.. | 2/8 5 h-m-p 0.0000 0.0001 481.2787 ++ 975.531260 m 0.0001 77 | 3/8 6 h-m-p 0.0045 0.9251 9.6135 ------------.. | 3/8 7 h-m-p 0.0000 0.0000 418.4512 ++ 967.608182 m 0.0000 109 | 4/8 8 h-m-p 0.0015 0.7634 10.6163 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 342.1924 ++ 965.041290 m 0.0000 140 | 5/8 10 h-m-p 0.0020 0.9968 8.3599 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 242.0849 ++ 963.741338 m 0.0000 172 | 6/8 12 h-m-p 0.1558 8.0000 0.0000 --C 963.741338 0 0.0035 185 | 6/8 13 h-m-p 1.1203 8.0000 0.0000 -Y 963.741338 0 0.0700 199 Out.. lnL = -963.741338 200 lfun, 200 eigenQcodon, 1200 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.048153 0.020854 0.017190 0.086902 0.058492 0.074479 0.299976 0.786414 0.469428 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 10.968097 np = 9 lnL0 = -1036.588035 Iterating by ming2 Initial: fx= 1036.588035 x= 0.04815 0.02085 0.01719 0.08690 0.05849 0.07448 0.29998 0.78641 0.46943 1 h-m-p 0.0000 0.0001 574.9613 ++ 1012.432736 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0001 298.9258 ++ 1008.022719 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0002 481.4708 ++ 983.947604 m 0.0002 38 | 3/9 4 h-m-p 0.0000 0.0002 318.4695 ++ 974.393387 m 0.0002 50 | 4/9 5 h-m-p 0.0000 0.0000 4586.9457 ++ 966.410621 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 10322.5845 ++ 963.741330 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 963.741330 m 8.0000 86 | 6/9 8 h-m-p 0.0376 8.0000 0.0107 ++++ 963.741328 m 8.0000 103 | 6/9 9 h-m-p 0.2731 3.1526 0.3135 ---------------.. | 6/9 10 h-m-p 0.0160 8.0000 0.0000 +++++ 963.741328 m 8.0000 149 | 6/9 11 h-m-p 0.0107 5.3462 0.1893 -------------.. | 6/9 12 h-m-p 0.0160 8.0000 0.0000 +++++ 963.741328 m 8.0000 193 | 6/9 13 h-m-p 0.0100 5.0074 0.2021 --------Y 963.741328 0 0.0000 216 | 6/9 14 h-m-p 0.0130 6.5104 0.0086 +++++ 963.741326 m 6.5104 234 | 7/9 15 h-m-p 0.2748 5.2773 0.1562 -----------C 963.741326 0 0.0000 260 | 7/9 16 h-m-p 0.0160 8.0000 0.0578 ----------C 963.741326 0 0.0000 284 | 7/9 17 h-m-p 0.0160 8.0000 0.0000 -----C 963.741326 0 0.0000 303 Out.. lnL = -963.741326 304 lfun, 912 eigenQcodon, 3648 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.018319 0.065040 0.037574 0.025167 0.071433 0.012390 0.290194 1.289782 0.467199 0.136577 1.532910 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 11.023978 np = 11 lnL0 = -1016.171798 Iterating by ming2 Initial: fx= 1016.171798 x= 0.01832 0.06504 0.03757 0.02517 0.07143 0.01239 0.29019 1.28978 0.46720 0.13658 1.53291 1 h-m-p 0.0000 0.0001 528.2469 ++ 999.967844 m 0.0001 16 | 1/11 2 h-m-p 0.0001 0.0004 144.9525 ++ 992.831147 m 0.0004 30 | 2/11 3 h-m-p 0.0000 0.0000 753.7833 ++ 987.202757 m 0.0000 44 | 3/11 4 h-m-p 0.0000 0.0001 1095.9326 ++ 981.088097 m 0.0001 58 | 4/11 5 h-m-p 0.0004 0.0018 46.0744 ++ 978.617767 m 0.0018 72 | 5/11 6 h-m-p 0.0000 0.0001 214.4650 ++ 973.554326 m 0.0001 86 | 6/11 7 h-m-p 0.0014 0.1110 12.5217 -----------.. | 6/11 8 h-m-p 0.0000 0.0002 231.2733 +++ 963.741333 m 0.0002 124 | 7/11 9 h-m-p 1.6000 8.0000 0.0000 ++ 963.741333 m 8.0000 138 | 7/11 10 h-m-p 0.1414 8.0000 0.0006 +++ 963.741333 m 8.0000 157 | 7/11 11 h-m-p 0.0066 3.2816 0.7275 ++++C 963.741329 0 1.5066 179 | 7/11 12 h-m-p 1.6000 8.0000 0.0628 C 963.741329 0 1.3795 197 | 7/11 13 h-m-p 1.6000 8.0000 0.0029 Y 963.741329 0 0.8886 215 | 7/11 14 h-m-p 1.6000 8.0000 0.0004 C 963.741329 0 1.6000 233 | 7/11 15 h-m-p 1.6000 8.0000 0.0000 ++ 963.741329 m 8.0000 251 | 7/11 16 h-m-p 0.0160 8.0000 0.0625 +++Y 963.741329 0 2.1582 272 | 7/11 17 h-m-p 1.6000 8.0000 0.0111 ++ 963.741329 m 8.0000 290 | 7/11 18 h-m-p 0.1501 1.2410 0.5902 ---------------.. | 7/11 19 h-m-p 0.0160 8.0000 0.0000 Y 963.741329 0 0.0040 339 Out.. lnL = -963.741329 340 lfun, 1360 eigenQcodon, 6120 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -963.760724 S = -963.738758 -0.008428 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:03 did 20 / 57 patterns 0:03 did 30 / 57 patterns 0:03 did 40 / 57 patterns 0:03 did 50 / 57 patterns 0:03 did 57 / 57 patterns 0:03 Time used: 0:03 Model 3: discrete TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.085672 0.014262 0.096270 0.062760 0.092408 0.032027 1.357039 0.647629 0.115657 0.649998 1.646842 2.138391 ntime & nrate & np: 6 4 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 4.181819 np = 12 lnL0 = -1052.572319 Iterating by ming2 Initial: fx= 1052.572319 x= 0.08567 0.01426 0.09627 0.06276 0.09241 0.03203 1.35704 0.64763 0.11566 0.65000 1.64684 2.13839 1 h-m-p 0.0000 0.0001 545.4435 ++ 1033.525367 m 0.0001 17 | 1/12 2 h-m-p 0.0002 0.0008 171.4948 ++ 1011.851273 m 0.0008 32 | 2/12 3 h-m-p 0.0000 0.0002 621.5933 ++ 984.202687 m 0.0002 47 | 3/12 4 h-m-p 0.0003 0.0014 180.3016 ++ 967.544887 m 0.0014 62 | 4/12 5 h-m-p 0.0000 0.0001 1775.5222 ++ 964.535177 m 0.0001 77 | 5/12 6 h-m-p 0.0000 0.0000 1804.9488 ++ 964.205887 m 0.0000 92 | 6/12 7 h-m-p 0.0010 0.1284 29.2273 -----------.. | 6/12 8 h-m-p 0.0000 0.0000 241.3216 ++ 963.741326 m 0.0000 131 | 7/12 9 h-m-p 0.0160 8.0000 0.0000 +++++ 963.741326 m 8.0000 149 | 7/12 10 h-m-p 0.2059 8.0000 0.0002 +++ 963.741326 m 8.0000 170 | 7/12 11 h-m-p 0.0160 8.0000 1.4174 +++++ 963.741302 m 8.0000 193 | 7/12 12 h-m-p 0.1319 0.6593 5.3613 ++ 963.741298 m 0.6593 208 | 7/12 13 h-m-p 0.0000 0.0000 9.4418 h-m-p: 3.93906543e-18 1.96953271e-17 9.44183652e+00 963.741298 .. | 7/12 14 h-m-p 0.0160 8.0000 0.0000 +++++ 963.741298 m 8.0000 238 | 7/12 15 h-m-p 0.0656 8.0000 0.0003 ++++ 963.741298 m 8.0000 260 | 7/12 16 h-m-p 0.0003 0.0013 1.6476 -------Y 963.741298 0 0.0000 287 | 7/12 17 h-m-p 0.0233 7.4200 0.0000 C 963.741298 0 0.0233 302 | 7/12 18 h-m-p 0.1244 8.0000 0.0000 ---------C 963.741298 0 0.0000 331 Out.. lnL = -963.741298 332 lfun, 1328 eigenQcodon, 5976 P(t) Time used: 0:05 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.036024 0.031899 0.040732 0.037108 0.050819 0.050467 7.198563 0.266843 1.789074 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 5.485563 np = 9 lnL0 = -1021.667882 Iterating by ming2 Initial: fx= 1021.667882 x= 0.03602 0.03190 0.04073 0.03711 0.05082 0.05047 7.19856 0.26684 1.78907 1 h-m-p 0.0000 0.0001 556.2634 ++ 977.374270 m 0.0001 14 | 1/9 2 h-m-p 0.0028 0.1398 25.5597 ------------.. | 1/9 3 h-m-p 0.0000 0.0000 533.2295 ++ 972.365266 m 0.0000 48 | 2/9 4 h-m-p 0.0008 0.4151 10.6539 -----------.. | 2/9 5 h-m-p 0.0000 0.0000 479.3683 ++ 971.306349 m 0.0000 81 | 3/9 6 h-m-p 0.0012 0.6000 7.7577 -----------.. | 3/9 7 h-m-p 0.0000 0.0000 415.0779 ++ 968.646418 m 0.0000 114 | 4/9 8 h-m-p 0.0017 0.8729 5.4082 ------------.. | 4/9 9 h-m-p 0.0000 0.0000 339.6295 ++ 963.829474 m 0.0000 148 | 5/9 10 h-m-p 0.0038 1.9017 3.5937 ------------.. | 5/9 11 h-m-p 0.0000 0.0000 242.4550 ++ 963.741343 m 0.0000 182 | 6/9 12 h-m-p 0.0160 8.0000 0.0000 --C 963.741343 0 0.0003 196 | 6/9 13 h-m-p 0.0160 8.0000 0.0000 -----------N 963.741343 0 0.0000 222 Out.. lnL = -963.741343 223 lfun, 2453 eigenQcodon, 13380 P(t) Time used: 0:09 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.062920 0.069957 0.068828 0.103689 0.023476 0.058571 7.198566 0.900000 0.573355 1.289819 1.299996 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 3.415754 np = 11 lnL0 = -1050.634522 Iterating by ming2 Initial: fx= 1050.634522 x= 0.06292 0.06996 0.06883 0.10369 0.02348 0.05857 7.19857 0.90000 0.57336 1.28982 1.30000 1 h-m-p 0.0000 0.0001 513.5532 ++ 1020.910942 m 0.0001 16 | 1/11 2 h-m-p 0.0003 0.0015 180.5446 ++ 979.589254 m 0.0015 30 | 2/11 3 h-m-p 0.0000 0.0000 2556.2064 ++ 975.668889 m 0.0000 44 | 3/11 4 h-m-p 0.0006 0.0031 38.9960 ++ 975.125245 m 0.0031 58 | 4/11 5 h-m-p 0.0000 0.0000 2230.0918 ++ 974.181116 m 0.0000 72 | 5/11 6 h-m-p 0.0002 0.0024 227.7443 ++ 970.930138 m 0.0024 86 | 5/11 7 h-m-p 0.0003 0.0014 824.6008 ----------.. | 5/11 8 h-m-p 0.0000 0.0001 237.5622 ++ 963.741326 m 0.0001 122 | 6/11 9 h-m-p 0.9935 8.0000 0.0000 ++ 963.741326 m 8.0000 136 | 6/11 10 h-m-p 0.0011 0.0055 0.0762 ------N 963.741326 0 0.0000 161 | 6/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 963.741326 m 8.0000 183 | 6/11 12 h-m-p 0.0160 8.0000 0.3322 +++++ 963.741315 m 8.0000 205 | 6/11 13 h-m-p 1.6000 8.0000 0.5584 ++ 963.741309 m 8.0000 224 | 6/11 14 h-m-p 0.1231 0.6157 4.6884 ++ 963.741307 m 0.6157 243 | 7/11 15 h-m-p 0.0257 1.0047 111.9419 +++ 963.741301 m 1.0047 258 | 7/11 16 h-m-p 0.0000 0.0000 25.0714 h-m-p: 0.00000000e+00 0.00000000e+00 2.50713765e+01 963.741301 .. | 7/11 17 h-m-p 0.0160 8.0000 0.0000 +++++ 963.741301 m 8.0000 286 | 8/11 18 h-m-p 0.0630 8.0000 0.0018 ++++ 963.741301 m 8.0000 306 | 8/11 19 h-m-p 0.0175 8.0000 0.8019 +++++ 963.741285 m 8.0000 326 | 8/11 20 h-m-p 1.6000 8.0000 0.2564 ++ 963.741284 m 8.0000 343 | 8/11 21 h-m-p 0.5777 8.0000 3.5501 ++ 963.741282 m 8.0000 360 | 8/11 22 h-m-p 1.6000 8.0000 2.9093 ---------C 963.741282 0 0.0000 383 | 8/11 23 h-m-p 1.6000 8.0000 0.0000 Y 963.741282 0 1.6000 397 Out.. lnL = -963.741282 398 lfun, 4776 eigenQcodon, 26268 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -963.736062 S = -963.735583 -0.000210 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:16 did 20 / 57 patterns 0:16 did 30 / 57 patterns 0:17 did 40 / 57 patterns 0:17 did 50 / 57 patterns 0:17 did 57 / 57 patterns 0:17 Time used: 0:17 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=268 NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NC_002677_1_NP_302517_1_1389_ML2331 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 ------------MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 ------------MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH ************************************** NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL NC_002677_1_NP_302517_1_1389_ML2331 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL ************************************************** NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG NC_002677_1_NP_302517_1_1389_ML2331 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG ************************************************** NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD NC_002677_1_NP_302517_1_1389_ML2331 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD ************************************************** NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA NC_002677_1_NP_302517_1_1389_ML2331 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA ************************************************** NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 TQSRAR------------ NC_002677_1_NP_302517_1_1389_ML2331 TQSRAR------------ NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 TQSRAR------------ NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 TQSRAR------------ NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 TQSRARoooooooooooo NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 TQSRARoooooooooooo ******
>NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >NC_002677_1_NP_302517_1_1389_ML2331 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 GTGAACACACGAGTTAGCCTCCGTATCGGGTTCCGAATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 ------------------------------------ATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ---- >NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 ------------------------------------ATGGTCGTAGGCCT ATTAGTAGCGGCCTTAACGACAATCACCCCGACCGCGGTAGCCTATCCCT CTAATCCCGCCAATATAGCTGGCATGATCGTGTTCATCGATCCTGGCCAC AACGGCTCCAATGACGCATCCATCAGCCGTCAGGTACCCACCGGTCGTGG CGGCACCAAAGACTGCCAGGCCAGCGGCACGTCGACGAACAGTGGCTATC CGGAGCACACCTTTACCTGGGACACCGCACTGCAGGTGCGCGCCGCGTTG GACGGCCTGGGTGTGCGGACCGCCCTGTCACGCGGAGACGACACTGGGCT GGGTCCGTGCGTAGACGCACGGGCCAACATGGCCAATGCGTTGCACCCCA ATGCCTCCGTCAGCCTGCACGGCGACGGAGGTCCGGCGTCCGGTCGGGGC TTTCACGTCATCTATTCTGCCCCGCCGCTCAACCCGGTGCAGGCCGGGCC ATCGGTGCAGTTCGCCCGAATCATGCGCGACCAGCTACAGGCCTCGGGCA TTCCTCCGGCTAACTACATTGGCCAGAGCGGTCTGTGCGGACGCTCAGAT TTGGCTGGCCTGAATCTGGCACAATATTCGTCGATCCTGATCGAGTTGGG CAACATGAAGAATCCAGCGGACTCGGCACTAATGGAGTCGTCAGAAGGCA GGAAGAAATACGCCGACGCCGTGGTCCGCGGCGTCGAGGGCTTCCTTGCC ACCCAGAGCCGAGCGCGC-------------------------------- ----
>NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >NC_002677_1_NP_302517_1_1389_ML2331 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 VNTRVSLRIGFRMVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 ------------MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR >NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 ------------MVVGLLVAALTTITPTAVAYPSNPANIAGMIVFIDPGH NGSNDASISRQVPTGRGGTKDCQASGTSTNSGYPEHTFTWDTALQVRAAL DGLGVRTALSRGDDTGLGPCVDARANMANALHPNASVSLHGDGGPASGRG FHVIYSAPPLNPVQAGPSVQFARIMRDQLQASGIPPANYIGQSGLCGRSD LAGLNLAQYSSILIELGNMKNPADSALMESSEGRKKYADAVVRGVEGFLA TQSRAR
#NEXUS [ID: 5933904565] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 NC_002677_1_NP_302517_1_1389_ML2331 NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 ; end; begin trees; translate 1 NC_011896_1_WP_010908837_1_2490_MLBR_RS11860, 2 NC_002677_1_NP_302517_1_1389_ML2331, 3 NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345, 4 NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105, 5 NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795, 6 NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06944173,2:0.06718809,3:0.06724037,4:0.0705364,5:0.07000728,6:0.06946108); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06944173,2:0.06718809,3:0.06724037,4:0.0705364,5:0.07000728,6:0.06946108); end;
Estimated marginal likelihoods for runs sampled in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1041.42 -1046.90 2 -1041.42 -1046.61 -------------------------------------- TOTAL -1041.42 -1046.77 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 1502 samples from 2 runs. Each run produced 1001 samples of which 751 samples were included. Parameter summaries saved to file "/data/8res/ML2331/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.895202 0.089328 0.325676 1.456397 0.868260 729.96 740.48 1.000 r(A<->C){all} 0.168432 0.019310 0.000043 0.443438 0.136281 93.78 107.07 1.002 r(A<->G){all} 0.192433 0.024017 0.000022 0.503135 0.155764 41.84 79.21 1.001 r(A<->T){all} 0.169539 0.021820 0.000240 0.466215 0.128169 69.01 120.24 1.006 r(C<->G){all} 0.154293 0.016582 0.000276 0.406617 0.117219 54.48 98.75 1.002 r(C<->T){all} 0.145424 0.016265 0.000134 0.395582 0.110449 63.26 119.80 1.032 r(G<->T){all} 0.169880 0.020505 0.000020 0.457476 0.131016 95.05 134.20 1.008 pi(A){all} 0.196097 0.000199 0.168737 0.222238 0.195464 300.40 466.37 1.000 pi(C){all} 0.326833 0.000284 0.297580 0.360595 0.326626 660.63 705.82 1.000 pi(G){all} 0.297105 0.000277 0.266385 0.329805 0.297330 612.57 615.96 1.000 pi(T){all} 0.179965 0.000191 0.153129 0.204972 0.179892 650.52 652.47 1.000 alpha{1,2} 0.416760 0.222502 0.000250 1.381453 0.251733 457.58 501.57 1.001 alpha{3} 0.455643 0.229273 0.000172 1.445714 0.295882 445.76 480.74 0.999 pinvar{all} 0.997970 0.000006 0.993335 0.999996 0.998708 381.36 490.88 1.002 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2331/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 244 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0 TTC 3 3 3 3 3 3 | TCC 4 4 4 4 4 4 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3 Leu TTA 2 2 2 2 2 2 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2 CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 5 5 5 5 5 5 | CGC 6 6 6 6 6 6 CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2 CTG 9 9 9 9 9 9 | CCG 8 8 8 8 8 8 | CAG 9 9 9 9 9 9 | CGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 7 7 7 7 7 7 | Ser AGT 1 1 1 1 1 1 ATC 8 8 8 8 8 8 | ACC 9 9 9 9 9 9 | AAC 6 6 6 6 6 6 | AGC 5 5 5 5 5 5 ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0 Met ATG 6 6 6 6 6 6 | ACG 3 3 3 3 3 3 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 2 2 2 2 2 2 | Gly GGT 6 6 6 6 6 6 GTC 5 5 5 5 5 5 | GCC 16 16 16 16 16 16 | GAC 11 11 11 11 11 11 | GGC 18 18 18 18 18 18 GTA 5 5 5 5 5 5 | GCA 5 5 5 5 5 5 | Glu GAA 1 1 1 1 1 1 | GGA 3 3 3 3 3 3 GTG 6 6 6 6 6 6 | GCG 7 7 7 7 7 7 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908837_1_2490_MLBR_RS11860 position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 #2: NC_002677_1_NP_302517_1_1389_ML2331 position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 #3: NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345 position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 #4: NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105 position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 #5: NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795 position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 #6: NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130 position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 0 TTC 18 | TCC 24 | TAC 12 | TGC 18 Leu L TTA 12 | TCA 18 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 42 | TAG 0 | Trp W TGG 6 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 12 CTC 6 | CCC 24 | CAC 30 | CGC 36 CTA 18 | CCA 12 | Gln Q CAA 6 | CGA 12 CTG 54 | CCG 48 | CAG 54 | CGG 18 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 42 | Ser S AGT 6 ATC 48 | ACC 54 | AAC 36 | AGC 30 ATA 6 | ACA 6 | Lys K AAA 12 | Arg R AGA 0 Met M ATG 36 | ACG 18 | AAG 12 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 0 | Ala A GCT 18 | Asp D GAT 12 | Gly G GGT 36 GTC 30 | GCC 96 | GAC 66 | GGC 108 GTA 30 | GCA 30 | Glu E GAA 6 | GGA 18 GTG 36 | GCG 42 | GAG 24 | GGG 12 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.15164 C:0.23770 A:0.22541 G:0.38525 position 2: T:0.23770 C:0.31557 A:0.22951 G:0.21721 position 3: T:0.14344 C:0.43443 A:0.12705 G:0.29508 Average T:0.17760 C:0.32923 A:0.19399 G:0.29918 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -963.741338 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299976 1.299996 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908837_1_2490_MLBR_RS11860: 0.000004, NC_002677_1_NP_302517_1_1389_ML2331: 0.000004, NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345: 0.000004, NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105: 0.000004, NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795: 0.000004, NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29998 omega (dN/dS) = 1.30000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 567.6 164.4 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 567.6 164.4 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 567.6 164.4 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 567.6 164.4 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 567.6 164.4 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 567.6 164.4 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -963.741326 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.290194 0.824103 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908837_1_2490_MLBR_RS11860: 0.000004, NC_002677_1_NP_302517_1_1389_ML2331: 0.000004, NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345: 0.000004, NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105: 0.000004, NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795: 0.000004, NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29019 MLEs of dN/dS (w) for site classes (K=2) p: 0.82410 0.17590 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 567.7 164.3 0.1759 0.0000 0.0000 0.0 0.0 7..2 0.000 567.7 164.3 0.1759 0.0000 0.0000 0.0 0.0 7..3 0.000 567.7 164.3 0.1759 0.0000 0.0000 0.0 0.0 7..4 0.000 567.7 164.3 0.1759 0.0000 0.0000 0.0 0.0 7..5 0.000 567.7 164.3 0.1759 0.0000 0.0000 0.0 0.0 7..6 0.000 567.7 164.3 0.1759 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -963.741329 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.357039 0.714213 0.160894 0.000001 1.395805 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908837_1_2490_MLBR_RS11860: 0.000004, NC_002677_1_NP_302517_1_1389_ML2331: 0.000004, NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345: 0.000004, NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105: 0.000004, NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795: 0.000004, NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 1.35704 MLEs of dN/dS (w) for site classes (K=3) p: 0.71421 0.16089 0.12489 w: 0.00000 1.00000 1.39581 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 559.5 172.5 0.3352 0.0000 0.0000 0.0 0.0 7..2 0.000 559.5 172.5 0.3352 0.0000 0.0000 0.0 0.0 7..3 0.000 559.5 172.5 0.3352 0.0000 0.0000 0.0 0.0 7..4 0.000 559.5 172.5 0.3352 0.0000 0.0000 0.0 0.0 7..5 0.000 559.5 172.5 0.3352 0.0000 0.0000 0.0 0.0 7..6 0.000 559.5 172.5 0.3352 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908837_1_2490_MLBR_RS11860) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908837_1_2490_MLBR_RS11860) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 3: discrete (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 12): -963.741298 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 7.198563 0.000000 0.001382 0.000001 0.000001 4.015230 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908837_1_2490_MLBR_RS11860: 0.000004, NC_002677_1_NP_302517_1_1389_ML2331: 0.000004, NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345: 0.000004, NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105: 0.000004, NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795: 0.000004, NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 7.19856 MLEs of dN/dS (w) for site classes (K=3) p: 0.00000 0.00138 0.99862 w: 0.00000 0.00000 4.01523 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 548.1 183.9 4.0097 0.0000 0.0000 0.0 0.0 7..2 0.000 548.1 183.9 4.0097 0.0000 0.0000 0.0 0.0 7..3 0.000 548.1 183.9 4.0097 0.0000 0.0000 0.0 0.0 7..4 0.000 548.1 183.9 4.0097 0.0000 0.0000 0.0 0.0 7..5 0.000 548.1 183.9 4.0097 0.0000 0.0000 0.0 0.0 7..6 0.000 548.1 183.9 4.0097 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908837_1_2490_MLBR_RS11860) Pr(w>1) post mean +- SE for w 1 M 0.999** 4.010 2 V 0.999** 4.010 3 V 0.999** 4.010 4 G 0.999** 4.010 5 L 0.999** 4.010 6 L 0.999** 4.010 7 V 0.999** 4.010 8 A 0.999** 4.010 9 A 0.999** 4.010 10 L 0.999** 4.010 11 T 0.999** 4.010 12 T 0.999** 4.010 13 I 0.999** 4.010 14 T 0.999** 4.010 15 P 0.999** 4.010 16 T 0.999** 4.010 17 A 0.999** 4.010 18 V 0.999** 4.010 19 A 0.999** 4.010 20 Y 0.999** 4.010 21 P 0.999** 4.010 22 S 0.999** 4.010 23 N 0.999** 4.010 24 P 0.999** 4.010 25 A 0.999** 4.010 26 N 0.999** 4.010 27 I 0.999** 4.010 28 A 0.999** 4.010 29 G 0.999** 4.010 30 M 0.999** 4.010 31 I 0.999** 4.010 32 V 0.999** 4.010 33 F 0.999** 4.010 34 I 0.999** 4.010 35 D 0.999** 4.010 36 P 0.999** 4.010 37 G 0.999** 4.010 38 H 0.999** 4.010 39 N 0.999** 4.010 40 G 0.999** 4.010 41 S 0.999** 4.010 42 N 0.999** 4.010 43 D 0.999** 4.010 44 A 0.999** 4.010 45 S 0.999** 4.010 46 I 0.999** 4.010 47 S 0.999** 4.010 48 R 0.999** 4.010 49 Q 0.999** 4.010 50 V 0.999** 4.010 51 P 0.999** 4.010 52 T 0.999** 4.010 53 G 0.999** 4.010 54 R 0.999** 4.010 55 G 0.999** 4.010 56 G 0.999** 4.010 57 T 0.999** 4.010 58 K 0.999** 4.010 59 D 0.999** 4.010 60 C 0.999** 4.010 61 Q 0.999** 4.010 62 A 0.999** 4.010 63 S 0.999** 4.010 64 G 0.999** 4.010 65 T 0.999** 4.010 66 S 0.999** 4.010 67 T 0.999** 4.010 68 N 0.999** 4.010 69 S 0.999** 4.010 70 G 0.999** 4.010 71 Y 0.999** 4.010 72 P 0.999** 4.010 73 E 0.999** 4.010 74 H 0.999** 4.010 75 T 0.999** 4.010 76 F 0.999** 4.010 77 T 0.999** 4.010 78 W 0.999** 4.010 79 D 0.999** 4.010 80 T 0.999** 4.010 81 A 0.999** 4.010 82 L 0.999** 4.010 83 Q 0.999** 4.010 84 V 0.999** 4.010 85 R 0.999** 4.010 86 A 0.999** 4.010 87 A 0.999** 4.010 88 L 0.999** 4.010 89 D 0.999** 4.010 90 G 0.999** 4.010 91 L 0.999** 4.010 92 G 0.999** 4.010 93 V 0.999** 4.010 94 R 0.999** 4.010 95 T 0.999** 4.010 96 A 0.999** 4.010 97 L 0.999** 4.010 98 S 0.999** 4.010 99 R 0.999** 4.010 100 G 0.999** 4.010 101 D 0.999** 4.010 102 D 0.999** 4.010 103 T 0.999** 4.010 104 G 0.999** 4.010 105 L 0.999** 4.010 106 G 0.999** 4.010 107 P 0.999** 4.010 108 C 0.999** 4.010 109 V 0.999** 4.010 110 D 0.999** 4.010 111 A 0.999** 4.010 112 R 0.999** 4.010 113 A 0.999** 4.010 114 N 0.999** 4.010 115 M 0.999** 4.010 116 A 0.999** 4.010 117 N 0.999** 4.010 118 A 0.999** 4.010 119 L 0.999** 4.010 120 H 0.999** 4.010 121 P 0.999** 4.010 122 N 0.999** 4.010 123 A 0.999** 4.010 124 S 0.999** 4.010 125 V 0.999** 4.010 126 S 0.999** 4.010 127 L 0.999** 4.010 128 H 0.999** 4.010 129 G 0.999** 4.010 130 D 0.999** 4.010 131 G 0.999** 4.010 132 G 0.999** 4.010 133 P 0.999** 4.010 134 A 0.999** 4.010 135 S 0.999** 4.010 136 G 0.999** 4.010 137 R 0.999** 4.010 138 G 0.999** 4.010 139 F 0.999** 4.010 140 H 0.999** 4.010 141 V 0.999** 4.010 142 I 0.999** 4.010 143 Y 0.999** 4.010 144 S 0.999** 4.010 145 A 0.999** 4.010 146 P 0.999** 4.010 147 P 0.999** 4.010 148 L 0.999** 4.010 149 N 0.999** 4.010 150 P 0.999** 4.010 151 V 0.999** 4.010 152 Q 0.999** 4.010 153 A 0.999** 4.010 154 G 0.999** 4.010 155 P 0.999** 4.010 156 S 0.999** 4.010 157 V 0.999** 4.010 158 Q 0.999** 4.010 159 F 0.999** 4.010 160 A 0.999** 4.010 161 R 0.999** 4.010 162 I 0.999** 4.010 163 M 0.999** 4.010 164 R 0.999** 4.010 165 D 0.999** 4.010 166 Q 0.999** 4.010 167 L 0.999** 4.010 168 Q 0.999** 4.010 169 A 0.999** 4.010 170 S 0.999** 4.010 171 G 0.999** 4.010 172 I 0.999** 4.010 173 P 0.999** 4.010 174 P 0.999** 4.010 175 A 0.999** 4.010 176 N 0.999** 4.010 177 Y 0.999** 4.010 178 I 0.999** 4.010 179 G 0.999** 4.010 180 Q 0.999** 4.010 181 S 0.999** 4.010 182 G 0.999** 4.010 183 L 0.999** 4.010 184 C 0.999** 4.010 185 G 0.999** 4.010 186 R 0.999** 4.010 187 S 0.999** 4.010 188 D 0.999** 4.010 189 L 0.999** 4.010 190 A 0.999** 4.010 191 G 0.999** 4.010 192 L 0.999** 4.010 193 N 0.999** 4.010 194 L 0.999** 4.010 195 A 0.999** 4.010 196 Q 0.999** 4.010 197 Y 0.999** 4.010 198 S 0.999** 4.010 199 S 0.999** 4.010 200 I 0.999** 4.010 201 L 0.999** 4.010 202 I 0.999** 4.010 203 E 0.999** 4.010 204 L 0.999** 4.010 205 G 0.999** 4.010 206 N 0.999** 4.010 207 M 0.999** 4.010 208 K 0.999** 4.010 209 N 0.999** 4.010 210 P 0.999** 4.010 211 A 0.999** 4.010 212 D 0.999** 4.010 213 S 0.999** 4.010 214 A 0.999** 4.010 215 L 0.999** 4.010 216 M 0.999** 4.010 217 E 0.999** 4.010 218 S 0.999** 4.010 219 S 0.999** 4.010 220 E 0.999** 4.010 221 G 0.999** 4.010 222 R 0.999** 4.010 223 K 0.999** 4.010 224 K 0.999** 4.010 225 Y 0.999** 4.010 226 A 0.999** 4.010 227 D 0.999** 4.010 228 A 0.999** 4.010 229 V 0.999** 4.010 230 V 0.999** 4.010 231 R 0.999** 4.010 232 G 0.999** 4.010 233 V 0.999** 4.010 234 E 0.999** 4.010 235 G 0.999** 4.010 236 F 0.999** 4.010 237 L 0.999** 4.010 238 A 0.999** 4.010 239 T 0.999** 4.010 240 Q 0.999** 4.010 241 S 0.999** 4.010 242 R 0.999** 4.010 243 A 0.999** 4.010 244 R 0.999** 4.010 Time used: 0:05 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -963.741343 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 7.198566 0.267015 1.788979 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908837_1_2490_MLBR_RS11860: 0.000004, NC_002677_1_NP_302517_1_1389_ML2331: 0.000004, NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345: 0.000004, NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105: 0.000004, NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795: 0.000004, NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 7.19857 Parameters in M7 (beta): p = 0.26701 q = 1.78898 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00001 0.00039 0.00263 0.00930 0.02405 0.05190 0.10004 0.18008 0.31506 0.57696 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 548.1 183.9 0.1260 0.0000 0.0000 0.0 0.0 7..2 0.000 548.1 183.9 0.1260 0.0000 0.0000 0.0 0.0 7..3 0.000 548.1 183.9 0.1260 0.0000 0.0000 0.0 0.0 7..4 0.000 548.1 183.9 0.1260 0.0000 0.0000 0.0 0.0 7..5 0.000 548.1 183.9 0.1260 0.0000 0.0000 0.0 0.0 7..6 0.000 548.1 183.9 0.1260 0.0000 0.0000 0.0 0.0 Time used: 0:09 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -963.741282 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 23.307199 0.000010 99.000000 72.536299 38.078082 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908837_1_2490_MLBR_RS11860: 0.000004, NC_002677_1_NP_302517_1_1389_ML2331: 0.000004, NZ_LVXE01000002_1_WP_010908837_1_772_A3216_RS01345: 0.000004, NZ_LYPH01000022_1_WP_010908837_1_862_A8144_RS04105: 0.000004, NZ_CP029543_1_WP_049769878_1_2512_DIJ64_RS12795: 0.000004, NZ_AP014567_1_WP_049769878_1_2579_JK2ML_RS13130: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 23.30720 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 99.00000 q = 72.53630 (p1 = 0.99999) w = 38.07808 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.51474 0.53803 0.55184 0.56284 0.57269 0.58218 0.59194 0.60276 0.61620 0.63851 38.07808 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 543.8 188.2 38.0777 0.0000 0.0000 0.0 0.0 7..2 0.000 543.8 188.2 38.0777 0.0000 0.0000 0.0 0.0 7..3 0.000 543.8 188.2 38.0777 0.0000 0.0000 0.0 0.0 7..4 0.000 543.8 188.2 38.0777 0.0000 0.0000 0.0 0.0 7..5 0.000 543.8 188.2 38.0777 0.0000 0.0000 0.0 0.0 7..6 0.000 543.8 188.2 38.0777 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908837_1_2490_MLBR_RS11860) Pr(w>1) post mean +- SE for w 1 M 1.000** 38.078 2 V 1.000** 38.078 3 V 1.000** 38.078 4 G 1.000** 38.078 5 L 1.000** 38.078 6 L 1.000** 38.078 7 V 1.000** 38.078 8 A 1.000** 38.078 9 A 1.000** 38.078 10 L 1.000** 38.078 11 T 1.000** 38.078 12 T 1.000** 38.078 13 I 1.000** 38.078 14 T 1.000** 38.078 15 P 1.000** 38.078 16 T 1.000** 38.078 17 A 1.000** 38.078 18 V 1.000** 38.078 19 A 1.000** 38.078 20 Y 1.000** 38.078 21 P 1.000** 38.078 22 S 1.000** 38.078 23 N 1.000** 38.078 24 P 1.000** 38.078 25 A 1.000** 38.078 26 N 1.000** 38.078 27 I 1.000** 38.078 28 A 1.000** 38.078 29 G 1.000** 38.078 30 M 1.000** 38.078 31 I 1.000** 38.078 32 V 1.000** 38.078 33 F 1.000** 38.078 34 I 1.000** 38.078 35 D 1.000** 38.078 36 P 1.000** 38.078 37 G 1.000** 38.078 38 H 1.000** 38.078 39 N 1.000** 38.078 40 G 1.000** 38.078 41 S 1.000** 38.078 42 N 1.000** 38.078 43 D 1.000** 38.078 44 A 1.000** 38.078 45 S 1.000** 38.078 46 I 1.000** 38.078 47 S 1.000** 38.078 48 R 1.000** 38.078 49 Q 1.000** 38.078 50 V 1.000** 38.078 51 P 1.000** 38.078 52 T 1.000** 38.078 53 G 1.000** 38.078 54 R 1.000** 38.078 55 G 1.000** 38.078 56 G 1.000** 38.078 57 T 1.000** 38.078 58 K 1.000** 38.078 59 D 1.000** 38.078 60 C 1.000** 38.078 61 Q 1.000** 38.078 62 A 1.000** 38.078 63 S 1.000** 38.078 64 G 1.000** 38.078 65 T 1.000** 38.078 66 S 1.000** 38.078 67 T 1.000** 38.078 68 N 1.000** 38.078 69 S 1.000** 38.078 70 G 1.000** 38.078 71 Y 1.000** 38.078 72 P 1.000** 38.078 73 E 1.000** 38.078 74 H 1.000** 38.078 75 T 1.000** 38.078 76 F 1.000** 38.078 77 T 1.000** 38.078 78 W 1.000** 38.078 79 D 1.000** 38.078 80 T 1.000** 38.078 81 A 1.000** 38.078 82 L 1.000** 38.078 83 Q 1.000** 38.078 84 V 1.000** 38.078 85 R 1.000** 38.078 86 A 1.000** 38.078 87 A 1.000** 38.078 88 L 1.000** 38.078 89 D 1.000** 38.078 90 G 1.000** 38.078 91 L 1.000** 38.078 92 G 1.000** 38.078 93 V 1.000** 38.078 94 R 1.000** 38.078 95 T 1.000** 38.078 96 A 1.000** 38.078 97 L 1.000** 38.078 98 S 1.000** 38.078 99 R 1.000** 38.078 100 G 1.000** 38.078 101 D 1.000** 38.078 102 D 1.000** 38.078 103 T 1.000** 38.078 104 G 1.000** 38.078 105 L 1.000** 38.078 106 G 1.000** 38.078 107 P 1.000** 38.078 108 C 1.000** 38.078 109 V 1.000** 38.078 110 D 1.000** 38.078 111 A 1.000** 38.078 112 R 1.000** 38.078 113 A 1.000** 38.078 114 N 1.000** 38.078 115 M 1.000** 38.078 116 A 1.000** 38.078 117 N 1.000** 38.078 118 A 1.000** 38.078 119 L 1.000** 38.078 120 H 1.000** 38.078 121 P 1.000** 38.078 122 N 1.000** 38.078 123 A 1.000** 38.078 124 S 1.000** 38.078 125 V 1.000** 38.078 126 S 1.000** 38.078 127 L 1.000** 38.078 128 H 1.000** 38.078 129 G 1.000** 38.078 130 D 1.000** 38.078 131 G 1.000** 38.078 132 G 1.000** 38.078 133 P 1.000** 38.078 134 A 1.000** 38.078 135 S 1.000** 38.078 136 G 1.000** 38.078 137 R 1.000** 38.078 138 G 1.000** 38.078 139 F 1.000** 38.078 140 H 1.000** 38.078 141 V 1.000** 38.078 142 I 1.000** 38.078 143 Y 1.000** 38.078 144 S 1.000** 38.078 145 A 1.000** 38.078 146 P 1.000** 38.078 147 P 1.000** 38.078 148 L 1.000** 38.078 149 N 1.000** 38.078 150 P 1.000** 38.078 151 V 1.000** 38.078 152 Q 1.000** 38.078 153 A 1.000** 38.078 154 G 1.000** 38.078 155 P 1.000** 38.078 156 S 1.000** 38.078 157 V 1.000** 38.078 158 Q 1.000** 38.078 159 F 1.000** 38.078 160 A 1.000** 38.078 161 R 1.000** 38.078 162 I 1.000** 38.078 163 M 1.000** 38.078 164 R 1.000** 38.078 165 D 1.000** 38.078 166 Q 1.000** 38.078 167 L 1.000** 38.078 168 Q 1.000** 38.078 169 A 1.000** 38.078 170 S 1.000** 38.078 171 G 1.000** 38.078 172 I 1.000** 38.078 173 P 1.000** 38.078 174 P 1.000** 38.078 175 A 1.000** 38.078 176 N 1.000** 38.078 177 Y 1.000** 38.078 178 I 1.000** 38.078 179 G 1.000** 38.078 180 Q 1.000** 38.078 181 S 1.000** 38.078 182 G 1.000** 38.078 183 L 1.000** 38.078 184 C 1.000** 38.078 185 G 1.000** 38.078 186 R 1.000** 38.078 187 S 1.000** 38.078 188 D 1.000** 38.078 189 L 1.000** 38.078 190 A 1.000** 38.078 191 G 1.000** 38.078 192 L 1.000** 38.078 193 N 1.000** 38.078 194 L 1.000** 38.078 195 A 1.000** 38.078 196 Q 1.000** 38.078 197 Y 1.000** 38.078 198 S 1.000** 38.078 199 S 1.000** 38.078 200 I 1.000** 38.078 201 L 1.000** 38.078 202 I 1.000** 38.078 203 E 1.000** 38.078 204 L 1.000** 38.078 205 G 1.000** 38.078 206 N 1.000** 38.078 207 M 1.000** 38.078 208 K 1.000** 38.078 209 N 1.000** 38.078 210 P 1.000** 38.078 211 A 1.000** 38.078 212 D 1.000** 38.078 213 S 1.000** 38.078 214 A 1.000** 38.078 215 L 1.000** 38.078 216 M 1.000** 38.078 217 E 1.000** 38.078 218 S 1.000** 38.078 219 S 1.000** 38.078 220 E 1.000** 38.078 221 G 1.000** 38.078 222 R 1.000** 38.078 223 K 1.000** 38.078 224 K 1.000** 38.078 225 Y 1.000** 38.078 226 A 1.000** 38.078 227 D 1.000** 38.078 228 A 1.000** 38.078 229 V 1.000** 38.078 230 V 1.000** 38.078 231 R 1.000** 38.078 232 G 1.000** 38.078 233 V 1.000** 38.078 234 E 1.000** 38.078 235 G 1.000** 38.078 236 F 1.000** 38.078 237 L 1.000** 38.078 238 A 1.000** 38.078 239 T 1.000** 38.078 240 Q 1.000** 38.078 241 S 1.000** 38.078 242 R 1.000** 38.078 243 A 1.000** 38.078 244 R 1.000** 38.078 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908837_1_2490_MLBR_RS11860) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:17
Model 1: NearlyNeutral -963.741326 Model 2: PositiveSelection -963.741329 Model 0: one-ratio -963.741338 Model 3: discrete -963.741298 Model 7: beta -963.741343 Model 8: beta&w>1 -963.741282 Model 0 vs 1 2.40000001667795E-5 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 1.2200000014672696E-4