--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:22:56 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2332/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -596.23 -600.65
2 -596.19 -600.29
--------------------------------------
TOTAL -596.21 -600.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889164 0.091286 0.355571 1.483168 0.857933 546.36 621.12 1.000
r(A<->C){all} 0.167915 0.018904 0.000019 0.426497 0.136796 38.95 80.71 1.000
r(A<->G){all} 0.158349 0.017101 0.000100 0.413039 0.126857 34.53 105.50 1.001
r(A<->T){all} 0.161860 0.019524 0.000121 0.437717 0.126476 39.52 81.99 0.999
r(C<->G){all} 0.162326 0.020246 0.000109 0.455923 0.122942 46.36 76.49 0.999
r(C<->T){all} 0.180802 0.020469 0.000681 0.464706 0.141402 66.68 72.51 1.000
r(G<->T){all} 0.168749 0.019825 0.000113 0.465463 0.133746 60.62 80.77 0.999
pi(A){all} 0.225901 0.000399 0.187579 0.265320 0.225244 644.68 696.73 1.000
pi(C){all} 0.238156 0.000391 0.200462 0.275523 0.238093 641.44 696.22 0.999
pi(G){all} 0.334114 0.000469 0.294082 0.377732 0.333901 615.09 661.00 1.000
pi(T){all} 0.201829 0.000368 0.165622 0.238908 0.201419 541.26 571.19 1.000
alpha{1,2} 0.420462 0.214331 0.000256 1.313220 0.254164 380.55 448.93 1.000
alpha{3} 0.454315 0.222031 0.000503 1.416407 0.303629 398.74 428.73 1.001
pinvar{all} 0.996136 0.000024 0.986595 0.999997 0.997810 507.04 586.56 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -568.815032
Model 2: PositiveSelection -568.814992
Model 0: one-ratio -568.815081
Model 3: discrete -568.814994
Model 7: beta -568.815081
Model 8: beta&w>1 -568.815032
Model 0 vs 1 9.799999997994746E-5
Model 2 vs 1 8.000000002539309E-5
Model 8 vs 7 9.799999997994746E-5
>C1
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C2
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C3
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C4
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C5
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C6
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=145
C1 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C2 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C3 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C4 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C5 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C6 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
**************************************************
C1 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C2 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C3 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C4 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C5 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C6 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
**************************************************
C1 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C2 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C3 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C4 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C5 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C6 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
*********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 145 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 145 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4350]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4350]--->[4350]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.678 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C2 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C3 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C4 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C5 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
C6 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
**************************************************
C1 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C2 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C3 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C4 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C5 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
C6 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
**************************************************
C1 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C2 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C3 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C4 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C5 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
C6 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
*********************************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
C2 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
C3 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
C4 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
C5 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
C6 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
**************************************************
C1 AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
C2 AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
C3 AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
C4 AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
C5 AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
C6 AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
**************************************************
C1 TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
C2 TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
C3 TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
C4 TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
C5 TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
C6 TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
**************************************************
C1 GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
C2 GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
C3 GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
C4 GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
C5 GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
C6 GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
**************************************************
C1 TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
C2 TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
C3 TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
C4 TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
C5 TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
C6 TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
**************************************************
C1 CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
C2 CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
C3 CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
C4 CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
C5 CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
C6 CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
**************************************************
C1 TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
C2 TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
C3 TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
C4 TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
C5 TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
C6 TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
**************************************************
C1 CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
C2 CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
C3 CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
C4 CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
C5 CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
C6 CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
**************************************************
C1 AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
C2 AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
C3 AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
C4 AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
C5 AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
C6 AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
***********************************
>C1
ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>C2
ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>C3
ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>C4
ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>C5
ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>C6
ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT
AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT
TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG
GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA
TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG
CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA
TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG
CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG
AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>C1
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C2
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C3
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C4
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C5
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
>C6
MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 435 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857728
Setting output file names to "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1307777254
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5153264239
Seed = 1042490313
Swapseed = 1579857728
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -973.550853 -- -24.965149
Chain 2 -- -973.550853 -- -24.965149
Chain 3 -- -973.550796 -- -24.965149
Chain 4 -- -973.550853 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -973.550796 -- -24.965149
Chain 2 -- -973.550853 -- -24.965149
Chain 3 -- -973.550704 -- -24.965149
Chain 4 -- -973.550853 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-973.551] (-973.551) (-973.551) (-973.551) * [-973.551] (-973.551) (-973.551) (-973.551)
500 -- [-602.015] (-611.848) (-604.448) (-606.977) * [-605.874] (-605.620) (-603.683) (-612.315) -- 0:00:00
1000 -- [-605.680] (-606.462) (-609.736) (-608.492) * (-601.589) (-604.703) [-608.089] (-608.224) -- 0:00:00
1500 -- (-602.622) (-604.746) (-609.148) [-601.397] * (-599.233) (-606.703) [-611.120] (-608.179) -- 0:00:00
2000 -- (-609.084) (-602.598) (-604.310) [-605.084] * [-604.580] (-613.848) (-602.130) (-606.692) -- 0:00:00
2500 -- (-603.137) [-603.219] (-608.284) (-616.290) * (-603.339) [-599.410] (-603.570) (-607.571) -- 0:00:00
3000 -- (-608.493) [-605.798] (-605.981) (-604.214) * (-605.811) (-612.084) [-603.420] (-612.564) -- 0:00:00
3500 -- (-602.563) [-604.907] (-601.108) (-615.363) * (-602.449) (-610.150) (-605.902) [-601.216] -- 0:00:00
4000 -- (-609.891) (-613.978) [-605.617] (-606.617) * (-609.461) (-605.555) [-611.595] (-606.383) -- 0:00:00
4500 -- (-608.101) (-608.776) [-603.002] (-606.316) * (-615.963) (-600.818) (-602.709) [-607.665] -- 0:00:00
5000 -- (-603.675) (-606.600) [-602.617] (-607.264) * (-605.005) (-609.068) (-599.848) [-603.252] -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-607.696) (-605.368) [-608.545] (-604.110) * (-614.539) (-613.054) [-602.281] (-609.109) -- 0:00:00
6000 -- (-611.756) [-604.974] (-606.999) (-603.090) * [-607.298] (-605.451) (-608.644) (-607.288) -- 0:00:00
6500 -- (-607.420) (-606.122) [-603.018] (-605.715) * (-602.419) (-608.941) [-604.916] (-606.553) -- 0:00:00
7000 -- (-596.616) (-603.797) [-604.435] (-607.078) * (-622.928) (-604.922) [-602.528] (-613.667) -- 0:00:00
7500 -- (-597.661) [-609.525] (-610.058) (-609.278) * (-603.938) [-595.720] (-606.951) (-610.839) -- 0:00:00
8000 -- [-595.050] (-608.677) (-603.313) (-607.165) * (-606.049) (-597.444) (-605.478) [-608.941] -- 0:00:00
8500 -- (-596.089) (-601.723) (-604.211) [-604.743] * (-610.480) (-597.106) [-607.355] (-609.488) -- 0:00:00
9000 -- (-596.897) [-607.897] (-610.932) (-598.371) * (-605.472) (-597.460) (-606.435) [-606.648] -- 0:00:00
9500 -- [-596.061] (-612.186) (-606.040) (-605.947) * (-610.188) [-595.975] (-606.557) (-602.739) -- 0:00:00
10000 -- (-596.836) (-607.351) [-603.704] (-606.164) * (-613.100) (-600.022) [-603.901] (-605.855) -- 0:00:00
Average standard deviation of split frequencies: 0.064082
10500 -- (-595.938) (-610.931) [-604.289] (-604.026) * [-604.718] (-595.481) (-608.587) (-616.380) -- 0:00:00
11000 -- (-596.771) [-605.844] (-606.279) (-605.255) * (-607.262) (-595.785) [-602.993] (-613.607) -- 0:00:00
11500 -- [-598.503] (-609.185) (-608.787) (-606.187) * (-611.518) (-595.482) [-604.625] (-604.363) -- 0:00:00
12000 -- (-595.438) [-606.931] (-601.996) (-609.644) * (-605.463) [-595.809] (-603.282) (-605.325) -- 0:00:00
12500 -- (-595.443) (-615.712) [-604.237] (-610.846) * [-602.742] (-595.970) (-602.039) (-595.993) -- 0:00:00
13000 -- (-595.992) (-616.361) (-608.076) [-599.785] * (-607.535) (-596.218) (-606.409) [-596.887] -- 0:00:00
13500 -- (-600.068) (-608.543) [-607.725] (-606.479) * (-606.452) [-595.703] (-612.763) (-598.272) -- 0:00:36
14000 -- (-598.260) (-613.866) [-606.358] (-602.102) * (-610.240) [-598.198] (-612.305) (-595.626) -- 0:00:34
14500 -- (-597.197) (-609.030) [-604.924] (-617.488) * [-608.895] (-595.943) (-605.495) (-595.428) -- 0:00:33
15000 -- (-597.839) [-603.163] (-606.224) (-598.251) * (-614.107) [-595.724] (-609.972) (-597.061) -- 0:00:32
Average standard deviation of split frequencies: 0.041868
15500 -- (-595.942) (-607.444) [-605.126] (-599.305) * (-605.264) [-595.950] (-609.358) (-597.076) -- 0:00:31
16000 -- (-596.503) (-603.179) [-610.266] (-596.128) * [-596.792] (-596.293) (-604.292) (-598.878) -- 0:00:30
16500 -- (-596.735) (-607.286) (-611.392) [-596.234] * (-595.890) (-595.953) [-601.548] (-596.020) -- 0:00:29
17000 -- (-597.436) (-603.859) (-606.655) [-595.824] * (-596.232) (-599.810) [-605.190] (-596.167) -- 0:00:28
17500 -- (-596.595) (-603.503) [-610.682] (-597.240) * [-599.089] (-595.370) (-606.041) (-597.713) -- 0:00:27
18000 -- (-596.004) [-610.060] (-610.089) (-597.023) * (-597.630) (-598.051) [-608.349] (-596.466) -- 0:00:26
18500 -- (-597.173) (-610.669) (-610.447) [-597.391] * (-597.519) (-597.395) [-604.544] (-596.238) -- 0:00:26
19000 -- (-597.091) (-616.528) [-611.336] (-596.439) * (-598.669) (-597.017) [-605.232] (-597.631) -- 0:00:25
19500 -- (-598.182) (-607.299) [-603.830] (-597.876) * (-595.678) [-600.619] (-605.715) (-596.972) -- 0:00:24
20000 -- (-595.313) (-606.777) [-605.494] (-596.622) * (-596.359) (-603.681) [-600.700] (-596.302) -- 0:00:24
Average standard deviation of split frequencies: 0.026612
20500 -- [-597.946] (-606.220) (-606.928) (-597.834) * (-599.148) [-595.415] (-609.193) (-595.122) -- 0:00:23
21000 -- [-596.482] (-611.223) (-600.763) (-599.950) * (-597.471) (-598.874) (-604.933) [-595.313] -- 0:00:22
21500 -- (-597.412) (-601.244) [-603.512] (-595.419) * [-599.344] (-599.523) (-601.055) (-596.695) -- 0:00:22
22000 -- (-598.205) (-613.697) [-602.953] (-597.702) * [-599.599] (-597.528) (-607.760) (-599.476) -- 0:00:21
22500 -- (-599.081) [-606.783] (-608.128) (-594.826) * (-595.312) (-596.543) (-606.158) [-597.411] -- 0:00:21
23000 -- (-596.835) (-615.908) [-604.208] (-596.332) * [-599.760] (-601.241) (-607.136) (-596.526) -- 0:00:20
23500 -- (-598.178) (-618.274) (-603.483) [-598.620] * (-596.722) [-597.310] (-610.753) (-598.105) -- 0:00:20
24000 -- (-599.387) (-610.727) (-606.070) [-597.250] * (-597.497) (-599.819) [-603.986] (-603.572) -- 0:00:19
24500 -- (-597.243) [-603.775] (-606.723) (-597.510) * (-597.437) (-596.561) [-606.964] (-599.818) -- 0:00:19
25000 -- (-597.133) (-619.139) (-602.790) [-596.585] * (-595.840) [-598.383] (-607.214) (-600.758) -- 0:00:19
Average standard deviation of split frequencies: 0.036262
25500 -- (-599.664) (-597.377) [-602.263] (-597.685) * [-595.495] (-598.369) (-615.117) (-596.747) -- 0:00:18
26000 -- [-596.015] (-597.180) (-604.219) (-596.340) * (-598.463) [-596.515] (-601.022) (-596.615) -- 0:00:18
26500 -- (-596.688) (-595.707) (-607.610) [-603.654] * (-600.659) (-597.337) (-613.267) [-595.649] -- 0:00:17
27000 -- (-601.294) (-597.893) (-603.969) [-595.204] * (-597.518) (-596.370) (-607.485) [-596.672] -- 0:00:17
27500 -- (-598.477) (-598.013) (-611.543) [-595.138] * (-598.815) (-597.144) [-602.466] (-595.567) -- 0:00:17
28000 -- [-597.412] (-595.953) (-608.214) (-597.690) * (-599.325) [-597.234] (-603.664) (-598.896) -- 0:00:33
28500 -- (-596.157) [-596.209] (-612.328) (-600.627) * (-597.190) (-597.687) [-607.313] (-598.219) -- 0:00:33
29000 -- (-596.329) (-595.747) [-606.131] (-598.104) * (-596.897) [-598.725] (-611.299) (-597.541) -- 0:00:32
29500 -- (-596.396) (-596.934) [-604.530] (-596.358) * (-596.385) [-600.743] (-607.172) (-598.032) -- 0:00:31
30000 -- (-598.574) (-595.759) [-604.636] (-597.220) * [-597.852] (-596.860) (-625.646) (-596.300) -- 0:00:31
Average standard deviation of split frequencies: 0.033818
30500 -- (-597.269) (-596.889) [-600.143] (-595.579) * (-596.975) (-599.576) (-615.581) [-597.908] -- 0:00:30
31000 -- (-598.854) (-596.151) (-609.884) [-595.689] * (-596.289) (-596.893) (-601.659) [-597.684] -- 0:00:30
31500 -- (-599.782) (-599.667) [-606.426] (-594.880) * (-597.195) [-600.075] (-598.909) (-598.436) -- 0:00:29
32000 -- (-598.266) (-599.025) (-606.222) [-600.730] * (-598.280) (-598.051) [-598.963] (-599.163) -- 0:00:29
32500 -- [-597.012] (-598.011) (-610.436) (-597.092) * [-596.298] (-596.844) (-601.362) (-597.089) -- 0:00:28
33000 -- (-604.787) (-600.819) (-617.315) [-595.201] * (-596.554) (-595.922) (-602.465) [-595.511] -- 0:00:28
33500 -- (-601.884) [-597.010] (-611.691) (-596.022) * (-595.284) [-601.224] (-598.388) (-595.626) -- 0:00:27
34000 -- [-595.023] (-595.959) (-601.734) (-597.318) * (-597.995) (-597.258) [-596.321] (-600.072) -- 0:00:27
34500 -- (-598.590) (-598.180) [-602.229] (-599.942) * (-595.454) [-595.585] (-598.025) (-595.710) -- 0:00:26
35000 -- [-596.414] (-596.967) (-612.755) (-600.633) * (-595.200) (-595.927) [-598.064] (-600.032) -- 0:00:26
Average standard deviation of split frequencies: 0.036665
35500 -- (-595.679) [-595.713] (-613.987) (-596.807) * [-599.845] (-597.434) (-598.258) (-597.717) -- 0:00:26
36000 -- (-597.898) (-599.199) [-599.548] (-605.086) * [-596.839] (-599.369) (-599.636) (-605.120) -- 0:00:25
36500 -- (-600.387) (-601.226) [-607.376] (-604.286) * (-597.750) [-595.400] (-596.222) (-597.247) -- 0:00:25
37000 -- (-596.471) (-597.128) (-608.834) [-597.262] * [-597.132] (-595.565) (-596.202) (-596.300) -- 0:00:25
37500 -- [-597.245] (-598.857) (-616.984) (-595.523) * (-597.695) [-595.565] (-602.201) (-599.457) -- 0:00:24
38000 -- (-599.509) (-598.372) (-619.935) [-595.381] * (-598.802) (-598.948) [-595.751] (-599.024) -- 0:00:24
38500 -- [-598.189] (-596.334) (-613.253) (-597.182) * (-602.371) [-595.618] (-595.647) (-595.880) -- 0:00:23
39000 -- [-596.753] (-596.817) (-605.049) (-597.131) * (-597.906) [-594.954] (-595.698) (-595.454) -- 0:00:23
39500 -- (-599.903) (-597.993) [-597.725] (-600.053) * (-595.580) (-594.952) [-598.351] (-597.294) -- 0:00:23
40000 -- (-595.989) (-600.457) [-596.384] (-598.129) * (-595.954) [-596.824] (-599.051) (-596.495) -- 0:00:23
Average standard deviation of split frequencies: 0.036708
40500 -- (-596.534) (-595.707) (-596.667) [-596.861] * [-595.127] (-596.615) (-600.002) (-596.328) -- 0:00:22
41000 -- (-596.028) [-594.835] (-596.033) (-595.915) * (-595.069) [-599.442] (-600.799) (-596.489) -- 0:00:22
41500 -- (-596.658) (-595.750) [-595.746] (-596.952) * (-598.691) [-597.728] (-599.989) (-595.734) -- 0:00:22
42000 -- (-597.477) [-595.314] (-595.687) (-599.052) * (-596.508) [-598.447] (-595.685) (-596.249) -- 0:00:21
42500 -- (-597.622) (-599.743) [-596.498] (-596.979) * (-595.916) [-597.447] (-595.367) (-597.767) -- 0:00:21
43000 -- [-596.987] (-599.230) (-599.374) (-596.932) * (-594.766) (-597.048) [-597.034] (-599.018) -- 0:00:21
43500 -- (-597.036) (-595.566) (-599.186) [-595.649] * (-596.000) (-598.610) [-595.667] (-602.064) -- 0:00:20
44000 -- (-599.710) (-596.897) (-597.061) [-596.869] * (-597.492) (-598.580) (-598.118) [-598.488] -- 0:00:31
44500 -- (-596.261) (-596.935) (-597.892) [-597.407] * (-598.136) (-598.097) (-596.983) [-595.152] -- 0:00:30
45000 -- (-595.884) [-594.587] (-596.795) (-596.722) * (-595.533) (-594.716) [-595.914] (-596.575) -- 0:00:30
Average standard deviation of split frequencies: 0.032607
45500 -- (-595.680) (-596.327) (-597.514) [-597.238] * (-598.668) (-596.201) [-597.408] (-598.467) -- 0:00:29
46000 -- [-596.287] (-597.172) (-595.726) (-597.480) * [-597.850] (-599.533) (-598.952) (-600.167) -- 0:00:29
46500 -- (-598.439) [-599.720] (-596.015) (-596.067) * (-598.548) [-594.899] (-598.853) (-600.708) -- 0:00:29
47000 -- (-597.544) (-596.573) [-595.949] (-594.862) * [-595.733] (-596.048) (-603.454) (-595.542) -- 0:00:28
47500 -- (-595.791) (-601.461) (-596.130) [-594.851] * [-596.396] (-595.954) (-595.490) (-597.197) -- 0:00:28
48000 -- (-602.741) (-596.814) (-595.126) [-595.390] * (-598.232) (-595.280) (-597.317) [-596.835] -- 0:00:28
48500 -- (-599.560) (-595.272) [-595.935] (-597.516) * (-595.335) (-596.253) [-595.047] (-595.137) -- 0:00:27
49000 -- (-599.703) (-598.304) (-595.655) [-596.949] * (-596.141) (-595.769) (-596.287) [-595.914] -- 0:00:27
49500 -- (-597.079) (-596.223) (-596.170) [-595.052] * (-595.440) (-595.250) (-597.104) [-595.909] -- 0:00:27
50000 -- [-595.642] (-595.082) (-595.999) (-596.362) * (-598.076) (-596.522) (-597.598) [-596.815] -- 0:00:27
Average standard deviation of split frequencies: 0.029773
50500 -- (-598.520) (-594.892) [-597.569] (-599.856) * (-596.250) (-596.698) [-597.322] (-596.380) -- 0:00:26
51000 -- [-597.684] (-595.955) (-595.988) (-603.866) * [-596.868] (-597.421) (-597.675) (-596.901) -- 0:00:26
51500 -- (-597.041) [-595.792] (-599.270) (-602.671) * [-597.096] (-597.039) (-598.411) (-595.007) -- 0:00:26
52000 -- [-595.774] (-595.410) (-597.267) (-603.822) * (-600.181) (-596.075) (-595.549) [-600.308] -- 0:00:25
52500 -- (-594.955) (-595.448) [-595.763] (-601.060) * (-599.674) [-595.877] (-595.155) (-594.828) -- 0:00:25
53000 -- [-595.254] (-596.750) (-597.137) (-595.273) * (-599.760) [-599.000] (-596.527) (-603.204) -- 0:00:25
53500 -- (-598.073) (-597.455) (-599.748) [-596.793] * (-597.969) [-599.951] (-597.381) (-596.050) -- 0:00:25
54000 -- [-596.509] (-601.163) (-604.333) (-597.656) * [-597.240] (-594.930) (-595.966) (-601.329) -- 0:00:24
54500 -- [-596.486] (-599.839) (-599.183) (-597.751) * (-597.975) [-597.046] (-595.884) (-604.534) -- 0:00:24
55000 -- (-595.084) (-597.990) [-597.521] (-600.899) * [-596.985] (-595.670) (-599.885) (-595.137) -- 0:00:24
Average standard deviation of split frequencies: 0.030398
55500 -- (-595.181) [-596.287] (-598.719) (-597.769) * (-598.823) (-598.398) (-597.382) [-596.957] -- 0:00:24
56000 -- (-596.397) (-598.601) [-598.370] (-599.600) * (-596.845) [-596.163] (-599.996) (-598.952) -- 0:00:23
56500 -- (-596.819) (-597.801) (-601.060) [-596.340] * [-597.425] (-598.025) (-597.914) (-595.503) -- 0:00:23
57000 -- [-597.627] (-597.417) (-598.658) (-597.620) * (-596.360) (-600.386) [-596.256] (-595.692) -- 0:00:23
57500 -- (-598.405) [-596.590] (-596.941) (-595.117) * (-596.993) (-596.055) [-597.533] (-596.750) -- 0:00:23
58000 -- (-596.200) (-598.701) [-596.512] (-598.253) * (-599.123) (-598.302) (-601.188) [-595.879] -- 0:00:22
58500 -- (-598.663) (-597.718) [-595.929] (-600.733) * (-597.134) (-596.687) [-603.623] (-596.239) -- 0:00:22
59000 -- (-596.657) [-599.998] (-599.561) (-596.964) * (-596.881) [-597.376] (-599.205) (-595.858) -- 0:00:22
59500 -- (-596.581) [-599.050] (-598.427) (-598.859) * (-596.017) (-595.812) [-595.509] (-594.912) -- 0:00:22
60000 -- (-600.179) [-594.647] (-598.378) (-600.171) * (-595.259) (-595.933) (-599.471) [-595.516] -- 0:00:29
Average standard deviation of split frequencies: 0.035399
60500 -- (-598.438) (-595.045) (-597.568) [-601.245] * (-597.909) (-597.147) (-596.127) [-595.095] -- 0:00:29
61000 -- [-598.327] (-595.379) (-600.399) (-600.293) * (-597.185) (-596.593) (-594.873) [-594.863] -- 0:00:28
61500 -- (-596.909) (-596.114) (-596.361) [-597.123] * [-595.229] (-596.992) (-596.963) (-596.250) -- 0:00:28
62000 -- (-596.242) (-595.553) (-596.226) [-599.531] * (-597.228) [-597.691] (-596.447) (-596.248) -- 0:00:28
62500 -- (-596.171) [-598.840] (-597.293) (-599.301) * (-595.559) (-595.198) [-594.875] (-595.306) -- 0:00:28
63000 -- (-595.590) [-597.882] (-596.128) (-599.834) * [-599.006] (-595.442) (-596.935) (-595.267) -- 0:00:27
63500 -- (-595.355) [-595.229] (-598.813) (-596.704) * (-598.727) (-596.263) [-595.812] (-597.782) -- 0:00:27
64000 -- (-595.557) [-595.459] (-596.280) (-595.883) * [-595.487] (-595.699) (-595.807) (-599.058) -- 0:00:27
64500 -- (-596.781) (-599.857) (-596.322) [-595.042] * [-595.310] (-595.994) (-598.076) (-599.540) -- 0:00:27
65000 -- (-595.725) [-596.129] (-596.446) (-595.117) * (-596.278) (-595.549) [-599.282] (-597.784) -- 0:00:26
Average standard deviation of split frequencies: 0.033570
65500 -- (-596.579) (-595.556) [-598.199] (-595.829) * (-599.592) (-595.871) (-598.245) [-599.363] -- 0:00:26
66000 -- (-599.641) (-597.645) (-597.246) [-598.546] * (-599.671) (-599.886) [-597.819] (-597.028) -- 0:00:26
66500 -- [-602.323] (-598.217) (-598.759) (-597.214) * [-596.513] (-597.557) (-596.444) (-596.126) -- 0:00:26
67000 -- [-595.542] (-596.680) (-600.070) (-600.935) * (-595.769) [-595.904] (-595.151) (-595.465) -- 0:00:25
67500 -- (-595.085) (-598.119) (-602.063) [-598.126] * (-595.402) (-597.781) (-595.336) [-595.810] -- 0:00:25
68000 -- (-596.244) (-595.678) (-595.192) [-596.536] * (-595.398) [-596.044] (-597.492) (-595.972) -- 0:00:25
68500 -- (-601.172) (-595.344) [-596.838] (-595.630) * [-596.192] (-595.411) (-599.214) (-596.340) -- 0:00:25
69000 -- (-596.011) (-603.243) [-597.144] (-596.631) * (-599.367) (-598.846) [-599.131] (-600.055) -- 0:00:24
69500 -- [-596.679] (-594.932) (-597.977) (-597.600) * (-598.344) [-602.772] (-598.714) (-597.914) -- 0:00:24
70000 -- (-596.845) [-598.577] (-597.537) (-595.446) * (-602.811) [-595.750] (-596.680) (-599.476) -- 0:00:24
Average standard deviation of split frequencies: 0.036022
70500 -- (-596.326) (-596.807) (-598.591) [-595.688] * (-597.703) (-595.949) (-595.910) [-599.261] -- 0:00:24
71000 -- (-595.686) [-595.695] (-594.786) (-595.394) * (-600.009) [-596.320] (-595.822) (-601.234) -- 0:00:24
71500 -- (-596.562) (-598.520) [-597.336] (-596.098) * (-602.117) [-597.279] (-597.515) (-598.266) -- 0:00:23
72000 -- (-596.190) (-598.586) (-599.986) [-595.780] * (-599.169) (-599.480) (-595.827) [-596.866] -- 0:00:23
72500 -- (-602.989) [-597.353] (-600.686) (-595.441) * [-597.446] (-595.714) (-595.658) (-596.217) -- 0:00:23
73000 -- (-597.012) (-597.056) [-598.229] (-596.643) * (-595.412) (-598.983) (-596.892) [-598.971] -- 0:00:23
73500 -- (-597.568) [-595.275] (-597.024) (-596.027) * [-598.088] (-595.217) (-597.380) (-597.953) -- 0:00:23
74000 -- (-596.093) (-602.523) (-597.843) [-598.363] * (-600.329) (-596.423) [-595.623] (-596.288) -- 0:00:23
74500 -- [-595.772] (-597.248) (-596.742) (-598.133) * (-601.451) (-595.720) (-595.355) [-596.029] -- 0:00:22
75000 -- (-595.932) [-597.478] (-594.851) (-596.091) * (-596.525) [-594.900] (-597.319) (-594.663) -- 0:00:22
Average standard deviation of split frequencies: 0.037836
75500 -- [-596.775] (-599.506) (-596.380) (-597.587) * (-600.148) (-595.244) (-596.882) [-597.222] -- 0:00:22
76000 -- [-596.687] (-600.033) (-596.922) (-598.834) * (-598.239) [-597.327] (-597.310) (-594.710) -- 0:00:22
76500 -- (-596.255) (-595.794) [-597.772] (-599.116) * (-604.834) [-596.501] (-597.651) (-595.598) -- 0:00:22
77000 -- (-594.997) (-596.566) [-597.401] (-600.248) * (-602.159) (-596.405) [-595.020] (-598.883) -- 0:00:27
77500 -- (-596.083) (-597.013) (-597.688) [-597.479] * (-596.332) (-603.584) [-598.508] (-598.129) -- 0:00:27
78000 -- (-599.261) (-598.741) [-595.969] (-596.262) * (-596.131) (-598.438) (-596.175) [-595.634] -- 0:00:27
78500 -- (-596.162) [-595.271] (-597.163) (-597.387) * (-596.839) (-596.943) [-598.086] (-595.780) -- 0:00:26
79000 -- (-596.489) (-595.586) (-598.504) [-598.792] * (-596.238) (-598.550) (-595.509) [-598.718] -- 0:00:26
79500 -- [-598.284] (-596.679) (-598.870) (-598.047) * (-595.958) [-597.070] (-596.884) (-597.772) -- 0:00:26
80000 -- (-598.549) (-597.139) [-596.220] (-596.356) * [-595.082] (-597.970) (-595.753) (-597.905) -- 0:00:26
Average standard deviation of split frequencies: 0.034187
80500 -- (-599.929) (-595.913) [-594.826] (-597.871) * [-597.951] (-595.657) (-597.101) (-597.685) -- 0:00:26
81000 -- [-597.051] (-595.949) (-597.564) (-598.171) * (-594.852) [-596.458] (-602.526) (-594.888) -- 0:00:25
81500 -- (-596.101) (-597.213) (-596.033) [-597.780] * (-595.658) (-596.061) (-597.715) [-596.628] -- 0:00:25
82000 -- (-595.408) [-596.832] (-596.459) (-595.530) * (-595.883) (-597.138) (-596.513) [-594.898] -- 0:00:25
82500 -- (-601.753) [-596.339] (-596.429) (-595.570) * (-595.716) (-596.835) (-595.885) [-595.475] -- 0:00:25
83000 -- [-596.597] (-597.929) (-598.914) (-596.013) * (-599.082) (-595.708) (-596.442) [-594.907] -- 0:00:25
83500 -- [-595.039] (-597.443) (-595.275) (-595.817) * (-598.676) (-596.395) (-595.512) [-595.186] -- 0:00:24
84000 -- [-594.912] (-595.925) (-595.347) (-600.315) * (-595.667) [-596.838] (-596.473) (-597.200) -- 0:00:24
84500 -- [-595.669] (-596.715) (-596.931) (-602.189) * (-595.562) (-595.257) (-598.501) [-595.523] -- 0:00:24
85000 -- (-595.522) (-599.706) (-597.700) [-596.729] * (-600.196) [-594.694] (-596.876) (-595.017) -- 0:00:24
Average standard deviation of split frequencies: 0.032106
85500 -- (-596.235) (-598.029) (-595.326) [-595.889] * (-600.727) (-599.275) (-597.103) [-595.066] -- 0:00:24
86000 -- (-597.198) (-603.065) (-596.675) [-596.620] * [-598.179] (-595.834) (-600.472) (-596.855) -- 0:00:24
86500 -- [-595.821] (-597.593) (-598.235) (-598.338) * (-598.257) (-595.680) (-598.953) [-595.253] -- 0:00:23
87000 -- [-595.748] (-595.652) (-598.235) (-598.957) * (-601.529) [-595.654] (-595.356) (-595.563) -- 0:00:23
87500 -- [-595.466] (-598.858) (-596.147) (-595.801) * (-601.098) [-597.255] (-597.403) (-596.709) -- 0:00:23
88000 -- (-598.661) (-596.121) (-597.996) [-595.080] * (-601.404) (-597.816) [-597.389] (-597.643) -- 0:00:23
88500 -- (-597.727) (-600.162) [-595.305] (-595.002) * (-595.294) [-597.446] (-599.274) (-600.736) -- 0:00:23
89000 -- [-595.693] (-596.705) (-601.775) (-596.784) * (-595.144) (-596.100) (-597.208) [-596.185] -- 0:00:23
89500 -- [-594.539] (-596.802) (-598.404) (-595.995) * (-596.112) (-597.197) [-597.318] (-599.106) -- 0:00:22
90000 -- [-595.862] (-596.591) (-597.204) (-598.776) * (-595.799) (-597.401) [-598.079] (-595.953) -- 0:00:22
Average standard deviation of split frequencies: 0.032564
90500 -- (-598.713) [-595.517] (-599.330) (-600.302) * (-595.793) (-597.868) (-595.516) [-598.303] -- 0:00:22
91000 -- (-596.777) (-597.306) [-597.902] (-601.637) * (-597.765) (-596.579) (-599.090) [-597.172] -- 0:00:22
91500 -- (-598.626) [-602.316] (-597.306) (-596.141) * (-601.688) [-597.191] (-597.397) (-597.332) -- 0:00:22
92000 -- (-597.046) (-598.025) [-598.891] (-596.586) * [-595.831] (-597.779) (-596.264) (-598.311) -- 0:00:22
92500 -- (-596.678) (-599.711) [-596.082] (-596.520) * [-597.227] (-595.724) (-602.383) (-600.503) -- 0:00:22
93000 -- (-599.810) (-600.875) [-595.415] (-599.170) * (-597.675) (-597.043) (-595.879) [-595.215] -- 0:00:21
93500 -- (-595.897) (-601.646) [-596.803] (-596.312) * [-597.615] (-596.560) (-597.829) (-597.484) -- 0:00:21
94000 -- [-595.885] (-598.903) (-596.218) (-597.774) * (-595.912) (-596.824) (-599.694) [-595.689] -- 0:00:25
94500 -- (-596.927) [-598.206] (-597.360) (-597.067) * (-597.975) (-597.761) (-595.949) [-596.973] -- 0:00:25
95000 -- (-595.160) [-596.693] (-602.649) (-596.623) * (-595.801) (-602.177) [-598.187] (-598.930) -- 0:00:25
Average standard deviation of split frequencies: 0.028946
95500 -- (-596.660) (-599.610) (-599.658) [-597.092] * (-601.308) (-601.277) (-596.258) [-598.609] -- 0:00:25
96000 -- (-595.084) [-598.458] (-595.737) (-598.976) * (-599.854) [-595.663] (-599.045) (-598.380) -- 0:00:25
96500 -- [-598.020] (-597.112) (-595.315) (-599.732) * [-596.774] (-595.961) (-596.041) (-598.709) -- 0:00:25
97000 -- (-596.116) [-596.870] (-596.857) (-598.249) * (-598.996) [-595.517] (-597.283) (-600.742) -- 0:00:24
97500 -- [-597.213] (-598.507) (-594.801) (-598.805) * (-594.966) (-597.084) (-597.638) [-598.449] -- 0:00:24
98000 -- [-595.864] (-596.467) (-597.638) (-598.671) * (-598.050) (-597.438) [-596.464] (-596.637) -- 0:00:24
98500 -- (-596.853) [-595.193] (-595.760) (-597.894) * [-597.705] (-596.789) (-596.015) (-594.599) -- 0:00:24
99000 -- (-596.001) (-596.230) [-596.570] (-597.399) * (-595.932) [-596.028] (-596.270) (-595.525) -- 0:00:24
99500 -- (-596.781) (-596.554) (-597.940) [-595.987] * (-596.202) (-595.627) [-596.231] (-598.089) -- 0:00:24
100000 -- (-595.559) (-602.153) (-596.847) [-596.788] * (-598.243) (-597.325) (-596.139) [-598.046] -- 0:00:24
Average standard deviation of split frequencies: 0.032287
100500 -- [-595.440] (-596.191) (-595.541) (-596.662) * [-596.686] (-596.468) (-595.948) (-599.686) -- 0:00:23
101000 -- (-595.410) [-595.748] (-597.142) (-603.053) * [-596.465] (-595.469) (-598.984) (-599.186) -- 0:00:23
101500 -- (-595.507) [-597.947] (-599.081) (-598.076) * [-595.710] (-598.745) (-597.665) (-597.181) -- 0:00:23
102000 -- (-595.602) (-596.722) [-596.251] (-599.695) * (-596.740) [-600.580] (-596.455) (-595.577) -- 0:00:23
102500 -- (-598.578) (-597.317) [-597.529] (-595.728) * (-597.715) (-597.570) [-595.702] (-596.209) -- 0:00:23
103000 -- [-601.072] (-596.511) (-597.449) (-595.867) * [-595.760] (-599.111) (-595.344) (-596.802) -- 0:00:23
103500 -- (-596.090) [-599.375] (-598.647) (-595.818) * [-595.883] (-598.019) (-596.349) (-602.933) -- 0:00:22
104000 -- (-597.890) (-597.460) (-598.601) [-596.998] * (-595.706) [-595.709] (-596.190) (-600.070) -- 0:00:22
104500 -- (-597.187) [-596.839] (-597.110) (-595.903) * (-596.638) (-597.061) (-596.847) [-598.614] -- 0:00:22
105000 -- (-601.357) (-595.553) (-597.559) [-598.509] * (-598.451) [-598.074] (-596.993) (-596.829) -- 0:00:22
Average standard deviation of split frequencies: 0.031130
105500 -- [-599.512] (-597.017) (-596.408) (-597.475) * (-598.404) [-598.206] (-598.563) (-596.515) -- 0:00:22
106000 -- [-598.684] (-596.249) (-596.244) (-598.720) * (-599.399) (-598.240) (-597.221) [-595.990] -- 0:00:22
106500 -- [-599.111] (-597.478) (-597.911) (-595.924) * (-596.435) (-599.321) [-598.904] (-596.313) -- 0:00:22
107000 -- (-596.760) [-598.335] (-602.510) (-596.610) * (-596.323) [-596.415] (-600.642) (-596.493) -- 0:00:22
107500 -- [-598.238] (-601.779) (-606.623) (-597.708) * [-598.942] (-595.975) (-597.401) (-595.635) -- 0:00:21
108000 -- (-601.402) [-595.589] (-597.555) (-595.868) * (-596.269) [-598.556] (-597.118) (-597.776) -- 0:00:21
108500 -- [-597.496] (-596.474) (-596.043) (-595.466) * [-599.613] (-600.650) (-598.943) (-597.475) -- 0:00:21
109000 -- (-597.543) (-595.304) [-595.938] (-600.083) * (-600.316) (-600.759) (-596.977) [-595.871] -- 0:00:21
109500 -- [-597.657] (-596.176) (-597.293) (-604.608) * (-595.022) (-598.859) (-596.028) [-596.727] -- 0:00:21
110000 -- (-597.817) (-597.662) [-598.679] (-601.013) * (-594.729) (-598.143) (-596.561) [-600.366] -- 0:00:21
Average standard deviation of split frequencies: 0.031163
110500 -- (-597.851) [-596.259] (-596.448) (-596.298) * [-594.836] (-599.243) (-596.255) (-596.389) -- 0:00:24
111000 -- (-596.497) (-595.659) (-600.236) [-596.223] * (-598.834) [-595.795] (-603.655) (-597.196) -- 0:00:24
111500 -- [-597.184] (-597.611) (-596.146) (-596.155) * (-595.962) (-598.309) [-597.884] (-596.508) -- 0:00:24
112000 -- (-595.461) [-595.650] (-595.547) (-596.997) * (-600.619) (-595.812) [-596.107] (-597.213) -- 0:00:24
112500 -- (-594.994) [-595.680] (-595.808) (-599.196) * (-598.378) [-595.458] (-596.501) (-598.509) -- 0:00:24
113000 -- (-598.867) (-598.346) [-596.826] (-594.949) * (-596.400) (-595.117) [-597.278] (-597.866) -- 0:00:23
113500 -- (-604.149) [-595.677] (-595.520) (-595.957) * [-596.636] (-595.237) (-596.799) (-595.031) -- 0:00:23
114000 -- (-600.521) (-596.440) (-598.293) [-597.247] * (-599.046) (-598.094) (-599.643) [-595.935] -- 0:00:23
114500 -- (-597.783) [-599.165] (-598.050) (-596.512) * (-595.712) (-596.810) (-597.143) [-595.206] -- 0:00:23
115000 -- (-596.626) [-596.269] (-597.503) (-596.758) * (-597.170) (-598.857) (-596.630) [-596.157] -- 0:00:23
Average standard deviation of split frequencies: 0.026950
115500 -- (-597.299) (-596.976) [-596.784] (-598.406) * (-597.105) (-604.780) (-596.107) [-599.259] -- 0:00:23
116000 -- [-597.416] (-598.275) (-600.522) (-598.394) * (-595.559) [-598.465] (-595.246) (-596.100) -- 0:00:23
116500 -- (-596.488) [-597.477] (-596.070) (-600.764) * (-597.702) (-599.624) [-596.907] (-596.388) -- 0:00:23
117000 -- (-595.227) (-597.428) (-595.948) [-599.350] * (-599.058) [-596.274] (-599.286) (-596.860) -- 0:00:22
117500 -- (-596.826) [-594.969] (-598.628) (-600.450) * (-597.029) (-596.246) [-597.764] (-596.973) -- 0:00:22
118000 -- (-596.879) (-595.663) [-596.778] (-597.283) * (-599.667) (-597.301) [-595.691] (-598.172) -- 0:00:22
118500 -- (-597.949) [-596.763] (-599.793) (-599.196) * (-602.472) [-595.676] (-595.158) (-598.661) -- 0:00:22
119000 -- (-595.949) [-598.334] (-596.960) (-596.407) * (-601.476) [-595.365] (-599.613) (-599.287) -- 0:00:22
119500 -- (-595.267) [-595.817] (-596.389) (-596.522) * (-599.559) (-597.253) (-599.066) [-596.703] -- 0:00:22
120000 -- (-595.910) [-596.586] (-596.160) (-595.642) * [-598.996] (-599.321) (-600.084) (-596.592) -- 0:00:22
Average standard deviation of split frequencies: 0.025702
120500 -- [-596.159] (-595.415) (-598.747) (-596.205) * [-601.350] (-601.001) (-598.359) (-599.731) -- 0:00:22
121000 -- (-597.367) (-597.166) (-597.558) [-594.735] * (-596.943) (-598.510) [-598.506] (-596.449) -- 0:00:21
121500 -- (-598.317) (-596.713) (-600.199) [-595.025] * (-596.248) [-596.718] (-600.991) (-599.051) -- 0:00:21
122000 -- (-595.643) [-596.264] (-600.230) (-595.845) * [-597.173] (-598.126) (-599.681) (-597.569) -- 0:00:21
122500 -- (-598.556) (-595.836) [-596.456] (-596.963) * (-602.496) (-595.931) (-597.078) [-595.481] -- 0:00:21
123000 -- (-597.286) [-597.939] (-596.119) (-597.689) * (-600.879) (-596.307) [-598.871] (-597.817) -- 0:00:21
123500 -- (-595.678) (-596.317) (-596.693) [-597.912] * (-598.462) (-596.465) [-596.057] (-596.793) -- 0:00:21
124000 -- (-596.424) (-599.384) (-597.369) [-595.371] * (-597.358) [-596.784] (-597.485) (-598.233) -- 0:00:21
124500 -- [-596.322] (-598.083) (-597.722) (-596.791) * (-595.967) [-597.998] (-596.814) (-596.289) -- 0:00:21
125000 -- (-597.246) (-599.594) (-595.198) [-595.290] * (-595.817) (-597.516) (-600.029) [-596.547] -- 0:00:21
Average standard deviation of split frequencies: 0.024880
125500 -- (-596.944) (-598.776) (-597.049) [-601.923] * (-595.324) [-597.050] (-596.875) (-594.629) -- 0:00:20
126000 -- [-594.673] (-597.783) (-595.820) (-599.924) * [-598.488] (-597.325) (-599.719) (-596.667) -- 0:00:20
126500 -- (-594.976) [-598.294] (-596.858) (-594.911) * (-599.249) (-598.023) (-599.082) [-596.063] -- 0:00:20
127000 -- (-596.051) (-595.875) (-596.579) [-600.045] * [-595.404] (-602.123) (-597.766) (-598.202) -- 0:00:20
127500 -- [-595.656] (-600.143) (-597.502) (-599.014) * (-596.702) [-595.463] (-597.651) (-599.391) -- 0:00:23
128000 -- (-598.760) [-596.162] (-597.103) (-596.371) * (-595.748) (-595.131) [-597.858] (-595.164) -- 0:00:23
128500 -- (-596.961) (-599.178) (-601.252) [-598.672] * (-594.952) (-595.861) (-597.786) [-595.460] -- 0:00:23
129000 -- (-598.527) [-595.336] (-599.053) (-599.665) * (-596.930) [-595.542] (-596.113) (-596.678) -- 0:00:23
129500 -- [-597.755] (-595.476) (-596.080) (-597.519) * (-603.326) [-595.931] (-595.417) (-600.487) -- 0:00:22
130000 -- (-597.273) [-594.934] (-597.733) (-595.888) * (-600.619) [-594.761] (-597.659) (-597.908) -- 0:00:22
Average standard deviation of split frequencies: 0.027599
130500 -- [-599.302] (-595.359) (-599.814) (-596.654) * (-602.822) [-595.350] (-598.261) (-596.944) -- 0:00:22
131000 -- (-599.668) [-597.631] (-598.742) (-595.692) * (-595.589) [-599.111] (-596.156) (-598.283) -- 0:00:22
131500 -- (-597.090) [-597.779] (-597.612) (-598.541) * (-596.764) (-597.684) (-595.040) [-597.349] -- 0:00:22
132000 -- (-595.023) (-596.759) (-599.502) [-595.765] * (-594.915) (-601.032) [-596.848] (-597.090) -- 0:00:22
132500 -- (-596.778) [-600.426] (-598.202) (-597.896) * (-595.885) [-598.040] (-596.092) (-598.017) -- 0:00:22
133000 -- (-595.780) [-597.972] (-596.830) (-595.800) * (-596.313) [-597.915] (-597.959) (-598.034) -- 0:00:22
133500 -- (-595.730) [-595.575] (-596.162) (-602.527) * (-597.139) (-601.098) [-595.667] (-596.889) -- 0:00:21
134000 -- (-596.629) (-595.639) [-597.916] (-599.115) * [-596.812] (-597.399) (-595.469) (-594.787) -- 0:00:21
134500 -- (-599.156) (-604.234) (-596.063) [-597.814] * [-597.123] (-595.695) (-599.164) (-599.543) -- 0:00:21
135000 -- (-598.398) [-598.122] (-596.900) (-596.115) * (-596.451) [-596.131] (-600.743) (-600.084) -- 0:00:21
Average standard deviation of split frequencies: 0.026690
135500 -- (-596.463) (-595.112) (-599.448) [-596.545] * (-598.031) (-595.906) [-598.531] (-597.851) -- 0:00:21
136000 -- [-599.545] (-596.313) (-600.504) (-601.271) * (-598.055) (-595.259) (-597.176) [-596.864] -- 0:00:21
136500 -- (-599.212) [-595.725] (-598.898) (-600.334) * (-597.515) (-597.929) [-595.366] (-595.323) -- 0:00:21
137000 -- (-596.147) [-596.721] (-596.705) (-597.973) * [-596.394] (-595.245) (-595.524) (-599.714) -- 0:00:21
137500 -- [-598.391] (-596.859) (-596.694) (-596.166) * (-600.595) [-598.138] (-601.629) (-601.489) -- 0:00:21
138000 -- [-595.089] (-600.656) (-597.401) (-595.887) * (-610.533) [-595.591] (-599.475) (-596.938) -- 0:00:20
138500 -- (-595.814) (-595.548) [-597.568] (-600.154) * (-597.468) (-598.588) [-595.307] (-595.118) -- 0:00:20
139000 -- [-596.383] (-597.115) (-596.690) (-596.936) * (-597.189) (-595.559) [-595.969] (-597.985) -- 0:00:20
139500 -- (-597.628) (-596.644) [-596.594] (-597.179) * (-598.257) (-596.920) (-600.116) [-596.633] -- 0:00:20
140000 -- [-599.216] (-597.194) (-595.241) (-596.935) * (-595.806) [-596.734] (-597.782) (-595.765) -- 0:00:20
Average standard deviation of split frequencies: 0.025134
140500 -- (-597.241) (-599.133) [-595.494] (-597.095) * (-597.644) [-599.117] (-595.373) (-598.493) -- 0:00:20
141000 -- (-596.940) (-595.842) [-595.599] (-599.757) * (-598.256) (-597.864) [-596.997] (-596.729) -- 0:00:20
141500 -- [-597.016] (-598.312) (-597.052) (-597.485) * (-599.302) (-595.918) [-596.606] (-597.216) -- 0:00:20
142000 -- (-597.207) [-596.011] (-600.733) (-596.236) * (-597.722) [-604.004] (-594.682) (-597.564) -- 0:00:20
142500 -- (-596.651) (-596.843) (-595.731) [-597.428] * (-598.340) (-601.700) (-596.401) [-598.519] -- 0:00:20
143000 -- (-598.118) [-600.441] (-600.680) (-597.703) * (-599.184) [-604.611] (-598.213) (-602.575) -- 0:00:19
143500 -- (-597.839) (-597.529) [-600.820] (-604.890) * [-598.997] (-594.683) (-598.701) (-596.634) -- 0:00:19
144000 -- (-595.657) [-595.326] (-596.715) (-598.961) * (-594.888) (-597.919) [-598.238] (-598.114) -- 0:00:19
144500 -- (-597.422) [-599.299] (-595.718) (-600.676) * (-595.321) [-595.888] (-598.214) (-596.455) -- 0:00:22
145000 -- (-597.933) (-608.039) [-599.606] (-597.194) * (-597.184) (-594.983) (-594.566) [-597.013] -- 0:00:22
Average standard deviation of split frequencies: 0.022117
145500 -- (-597.087) [-596.132] (-597.279) (-600.026) * [-597.081] (-596.612) (-602.486) (-598.087) -- 0:00:21
146000 -- (-597.722) (-599.539) (-597.149) [-598.424] * (-594.926) (-599.649) (-595.310) [-596.304] -- 0:00:21
146500 -- (-600.362) (-595.838) [-596.906] (-598.774) * [-596.581] (-599.636) (-596.043) (-596.741) -- 0:00:21
147000 -- (-598.252) [-597.929] (-595.872) (-595.652) * [-595.473] (-599.872) (-600.351) (-595.435) -- 0:00:21
147500 -- (-601.226) [-596.532] (-595.883) (-597.944) * (-598.268) [-601.164] (-596.610) (-595.979) -- 0:00:21
148000 -- (-601.776) (-595.279) (-595.627) [-596.404] * [-597.503] (-598.004) (-595.425) (-596.337) -- 0:00:21
148500 -- (-600.235) (-596.637) [-596.283] (-597.669) * (-596.067) (-597.623) [-601.419] (-596.288) -- 0:00:21
149000 -- [-596.496] (-601.195) (-597.317) (-595.245) * (-595.323) (-595.221) (-598.665) [-596.778] -- 0:00:21
149500 -- (-597.514) (-598.773) (-595.991) [-596.049] * (-596.788) (-597.590) (-595.691) [-598.984] -- 0:00:21
150000 -- (-598.936) (-595.829) [-595.774] (-596.908) * (-596.141) (-598.200) (-596.049) [-596.915] -- 0:00:21
Average standard deviation of split frequencies: 0.022840
150500 -- (-601.221) [-596.316] (-596.544) (-596.775) * (-599.939) (-599.471) [-595.927] (-596.762) -- 0:00:20
151000 -- [-596.251] (-598.794) (-596.719) (-601.420) * (-596.208) (-598.665) (-595.361) [-597.642] -- 0:00:20
151500 -- (-594.645) (-596.372) [-595.192] (-598.644) * (-597.846) [-597.744] (-598.530) (-598.878) -- 0:00:20
152000 -- (-599.922) [-599.716] (-595.817) (-595.626) * (-601.398) (-597.163) [-598.088] (-598.759) -- 0:00:20
152500 -- (-598.085) (-596.695) [-597.060] (-596.969) * (-599.409) (-599.122) (-599.386) [-598.526] -- 0:00:20
153000 -- (-596.504) [-596.156] (-596.691) (-598.974) * (-595.587) (-597.473) (-602.649) [-597.835] -- 0:00:20
153500 -- (-596.371) (-599.533) (-597.031) [-597.031] * (-597.298) [-595.875] (-598.437) (-601.829) -- 0:00:20
154000 -- (-595.729) (-598.214) [-597.172] (-596.159) * [-596.109] (-595.303) (-600.230) (-597.002) -- 0:00:20
154500 -- (-598.776) (-598.415) (-601.051) [-596.008] * (-596.734) (-595.536) (-597.666) [-595.549] -- 0:00:20
155000 -- (-597.035) [-601.048] (-596.664) (-595.308) * (-595.026) [-595.257] (-595.592) (-596.280) -- 0:00:20
Average standard deviation of split frequencies: 0.023721
155500 -- (-598.355) [-597.498] (-596.583) (-595.470) * (-595.397) (-596.750) [-595.552] (-594.808) -- 0:00:19
156000 -- [-595.185] (-597.627) (-597.982) (-594.980) * (-595.306) (-597.872) (-597.760) [-594.833] -- 0:00:19
156500 -- (-601.263) [-597.367] (-595.434) (-595.078) * [-595.926] (-596.537) (-599.254) (-599.151) -- 0:00:19
157000 -- (-597.827) (-595.866) (-597.658) [-595.798] * (-596.935) (-597.189) [-596.447] (-598.732) -- 0:00:19
157500 -- (-595.038) (-599.428) (-596.207) [-597.533] * (-598.303) (-596.265) (-597.634) [-596.621] -- 0:00:19
158000 -- (-595.651) (-598.477) (-596.938) [-595.620] * (-600.146) (-600.911) [-597.587] (-595.346) -- 0:00:19
158500 -- [-594.910] (-599.638) (-599.195) (-597.250) * (-599.506) (-597.187) (-600.675) [-596.044] -- 0:00:21
159000 -- (-595.891) (-600.830) [-596.588] (-597.501) * [-594.830] (-596.512) (-597.341) (-596.692) -- 0:00:21
159500 -- (-602.053) (-595.039) [-598.199] (-595.240) * [-597.663] (-595.842) (-595.680) (-597.002) -- 0:00:21
160000 -- (-601.490) (-596.266) [-599.084] (-594.964) * (-596.633) [-598.879] (-596.117) (-596.238) -- 0:00:21
Average standard deviation of split frequencies: 0.024499
160500 -- [-595.562] (-596.387) (-597.369) (-594.949) * [-596.631] (-595.576) (-598.181) (-596.785) -- 0:00:21
161000 -- [-597.647] (-596.267) (-596.724) (-595.214) * (-597.251) (-599.001) (-599.175) [-598.758] -- 0:00:21
161500 -- (-596.197) (-596.145) (-598.402) [-594.925] * (-598.673) (-595.366) (-603.943) [-595.347] -- 0:00:20
162000 -- (-596.241) [-599.073] (-599.347) (-597.469) * (-595.813) (-595.759) (-600.001) [-594.827] -- 0:00:20
162500 -- (-597.362) [-596.676] (-601.877) (-596.017) * (-597.396) (-594.955) (-594.885) [-596.274] -- 0:00:20
163000 -- (-597.006) (-596.415) [-597.039] (-597.103) * (-599.568) [-596.063] (-597.152) (-596.190) -- 0:00:20
163500 -- (-595.762) (-596.777) [-596.188] (-597.771) * (-597.033) [-599.479] (-597.134) (-601.212) -- 0:00:20
164000 -- [-596.236] (-596.297) (-597.964) (-597.326) * (-596.572) (-599.317) (-596.223) [-596.151] -- 0:00:20
164500 -- (-600.760) (-596.971) (-595.902) [-597.167] * (-595.743) [-600.651] (-597.792) (-595.633) -- 0:00:20
165000 -- (-604.183) [-598.067] (-598.310) (-597.655) * (-595.645) [-599.825] (-600.819) (-597.251) -- 0:00:20
Average standard deviation of split frequencies: 0.022434
165500 -- (-600.418) (-599.203) (-602.768) [-599.160] * (-596.514) (-596.670) (-597.074) [-596.312] -- 0:00:20
166000 -- [-598.164] (-594.700) (-595.735) (-601.117) * (-598.331) (-596.274) (-596.429) [-595.484] -- 0:00:20
166500 -- (-597.074) [-595.029] (-597.624) (-601.906) * [-600.599] (-598.503) (-599.038) (-596.476) -- 0:00:20
167000 -- [-598.578] (-598.195) (-597.739) (-598.412) * (-597.123) (-597.156) (-595.602) [-595.781] -- 0:00:19
167500 -- [-600.823] (-596.084) (-597.032) (-596.707) * (-597.889) [-596.978] (-594.776) (-596.988) -- 0:00:19
168000 -- (-600.382) [-595.636] (-596.929) (-595.176) * (-597.657) (-595.731) (-595.750) [-596.474] -- 0:00:19
168500 -- (-599.978) [-595.865] (-595.623) (-595.484) * (-598.271) [-595.700] (-595.518) (-596.431) -- 0:00:19
169000 -- (-599.996) [-596.864] (-605.315) (-595.103) * (-601.669) [-596.014] (-595.858) (-596.242) -- 0:00:19
169500 -- (-596.582) [-595.970] (-601.890) (-594.997) * (-597.172) (-600.937) (-597.873) [-597.295] -- 0:00:19
170000 -- (-599.461) (-595.376) [-597.534] (-595.578) * (-598.842) (-598.494) [-597.623] (-598.067) -- 0:00:19
Average standard deviation of split frequencies: 0.020854
170500 -- (-599.933) (-595.484) [-596.615] (-595.462) * [-597.241] (-603.039) (-598.373) (-598.432) -- 0:00:19
171000 -- (-595.760) (-596.953) [-597.678] (-594.949) * (-599.366) (-602.354) [-599.684] (-595.561) -- 0:00:19
171500 -- (-596.110) [-595.620] (-596.514) (-596.364) * (-600.580) (-597.176) [-602.768] (-597.167) -- 0:00:19
172000 -- [-595.619] (-596.888) (-595.576) (-600.933) * (-598.636) (-596.030) [-599.028] (-599.024) -- 0:00:20
172500 -- (-598.483) (-598.709) [-595.239] (-601.714) * (-596.814) [-595.692] (-596.717) (-600.985) -- 0:00:20
173000 -- (-597.299) (-595.893) (-597.333) [-595.983] * (-601.637) (-595.933) [-595.109] (-595.676) -- 0:00:20
173500 -- (-600.154) (-598.966) [-597.889] (-598.811) * (-598.807) [-599.343] (-597.436) (-600.753) -- 0:00:20
174000 -- (-597.824) [-595.807] (-596.750) (-598.114) * (-596.698) (-595.702) [-596.876] (-596.597) -- 0:00:20
174500 -- [-595.994] (-595.682) (-597.772) (-597.616) * (-595.904) [-596.098] (-594.953) (-597.310) -- 0:00:20
175000 -- (-597.459) (-598.443) [-598.399] (-596.124) * (-595.693) [-597.057] (-595.822) (-596.007) -- 0:00:20
Average standard deviation of split frequencies: 0.022555
175500 -- (-595.110) [-597.681] (-596.980) (-595.256) * (-597.973) (-598.025) [-597.156] (-596.012) -- 0:00:20
176000 -- (-595.285) (-598.819) [-596.683] (-598.504) * (-598.161) (-598.227) (-600.064) [-595.047] -- 0:00:20
176500 -- (-596.480) (-602.261) (-599.320) [-596.636] * (-596.270) (-597.293) [-596.251] (-595.559) -- 0:00:20
177000 -- (-596.797) (-599.171) (-597.616) [-596.935] * [-596.772] (-596.191) (-597.331) (-598.479) -- 0:00:20
177500 -- (-597.961) (-601.862) (-595.675) [-596.546] * (-602.241) (-596.445) [-597.675] (-599.670) -- 0:00:19
178000 -- (-601.941) (-604.158) (-596.216) [-598.392] * (-595.579) [-596.058] (-595.569) (-599.071) -- 0:00:19
178500 -- [-594.815] (-598.246) (-596.361) (-597.733) * (-595.460) (-595.018) [-595.656] (-598.136) -- 0:00:19
179000 -- (-596.746) (-595.055) (-596.755) [-597.923] * (-596.797) (-596.329) (-597.131) [-596.797] -- 0:00:19
179500 -- (-596.053) [-595.503] (-597.582) (-595.953) * (-597.114) (-595.000) (-598.405) [-596.749] -- 0:00:19
180000 -- (-597.045) [-596.426] (-596.028) (-595.551) * (-597.158) (-595.370) (-597.897) [-595.777] -- 0:00:19
Average standard deviation of split frequencies: 0.021526
180500 -- (-597.908) [-596.701] (-597.280) (-595.268) * (-597.184) (-596.966) [-596.338] (-594.822) -- 0:00:19
181000 -- [-595.989] (-599.722) (-596.696) (-599.455) * (-595.071) [-597.797] (-596.267) (-595.111) -- 0:00:19
181500 -- [-596.085] (-599.008) (-596.401) (-598.311) * (-595.371) (-596.000) [-595.419] (-597.096) -- 0:00:19
182000 -- (-595.568) (-597.402) (-597.089) [-597.455] * [-595.247] (-601.796) (-598.147) (-598.777) -- 0:00:19
182500 -- (-596.134) [-600.737] (-598.180) (-596.645) * (-595.882) (-595.468) (-600.917) [-596.098] -- 0:00:19
183000 -- [-597.196] (-597.223) (-596.426) (-595.712) * (-596.898) (-599.457) (-596.993) [-595.493] -- 0:00:19
183500 -- (-596.468) (-595.571) [-595.275] (-596.926) * (-595.934) (-595.840) (-598.811) [-596.409] -- 0:00:18
184000 -- (-597.270) [-596.465] (-596.645) (-596.451) * [-599.892] (-596.127) (-597.655) (-595.410) -- 0:00:18
184500 -- (-595.050) (-596.128) (-598.221) [-596.138] * (-596.293) (-598.948) [-596.254] (-600.546) -- 0:00:18
185000 -- [-594.751] (-594.727) (-598.453) (-597.255) * (-597.953) (-598.203) [-596.965] (-596.819) -- 0:00:18
Average standard deviation of split frequencies: 0.022276
185500 -- [-597.354] (-595.206) (-595.442) (-596.758) * (-595.906) [-596.351] (-598.096) (-595.741) -- 0:00:18
186000 -- [-595.777] (-597.804) (-595.624) (-596.474) * [-595.046] (-602.864) (-597.436) (-600.485) -- 0:00:18
186500 -- (-598.470) (-596.048) [-596.863] (-598.895) * (-595.788) (-597.083) (-598.151) [-595.702] -- 0:00:18
187000 -- [-599.169] (-595.957) (-597.232) (-596.010) * (-597.539) (-596.880) [-596.212] (-596.652) -- 0:00:18
187500 -- (-597.535) (-598.309) [-596.446] (-598.413) * (-598.983) (-598.748) (-597.097) [-595.486] -- 0:00:18
188000 -- (-598.527) (-598.754) (-599.470) [-598.643] * (-597.573) (-599.320) (-600.725) [-597.521] -- 0:00:18
188500 -- (-598.374) (-596.283) (-597.595) [-596.750] * [-596.056] (-598.229) (-599.220) (-595.610) -- 0:00:18
189000 -- (-596.907) (-597.372) (-603.951) [-596.267] * (-597.158) (-598.954) (-598.411) [-596.816] -- 0:00:19
189500 -- (-595.840) (-595.557) (-600.691) [-595.829] * (-600.210) [-597.491] (-599.514) (-596.610) -- 0:00:19
190000 -- (-595.154) (-595.189) (-601.459) [-596.105] * (-598.929) [-602.005] (-596.832) (-598.178) -- 0:00:19
Average standard deviation of split frequencies: 0.021211
190500 -- (-600.234) [-597.115] (-601.549) (-594.948) * (-596.276) (-602.128) (-596.440) [-596.637] -- 0:00:19
191000 -- (-597.868) [-596.676] (-599.036) (-596.550) * (-597.767) (-594.990) [-597.782] (-595.843) -- 0:00:19
191500 -- (-597.161) (-595.913) [-597.344] (-595.103) * [-596.059] (-597.117) (-596.999) (-599.669) -- 0:00:19
192000 -- (-600.757) (-597.283) [-596.806] (-595.385) * [-597.641] (-598.553) (-595.163) (-596.247) -- 0:00:19
192500 -- (-598.601) (-598.068) [-599.327] (-596.507) * (-597.543) (-601.357) (-595.042) [-596.148] -- 0:00:19
193000 -- (-599.425) (-600.092) (-595.545) [-597.164] * (-596.402) (-599.735) [-597.169] (-598.219) -- 0:00:19
193500 -- (-596.490) (-597.455) (-598.346) [-595.403] * (-597.219) (-600.627) (-595.208) [-597.765] -- 0:00:19
194000 -- (-595.905) (-595.990) [-597.580] (-600.033) * (-596.023) (-595.429) (-594.973) [-595.676] -- 0:00:18
194500 -- (-598.813) (-597.174) (-596.813) [-599.913] * [-596.247] (-596.908) (-596.393) (-596.234) -- 0:00:18
195000 -- (-598.475) (-596.965) (-596.078) [-598.145] * (-600.133) (-598.508) (-596.636) [-594.992] -- 0:00:18
Average standard deviation of split frequencies: 0.020633
195500 -- (-598.419) [-598.934] (-595.375) (-596.500) * [-596.152] (-595.872) (-599.398) (-597.422) -- 0:00:18
196000 -- (-597.159) (-597.924) [-596.245] (-596.967) * (-596.297) [-599.526] (-596.864) (-595.342) -- 0:00:18
196500 -- (-598.263) [-595.622] (-597.992) (-596.274) * (-600.634) (-596.914) [-596.093] (-596.332) -- 0:00:18
197000 -- (-597.440) (-595.660) [-595.817] (-594.967) * (-598.432) (-605.171) [-597.006] (-596.030) -- 0:00:18
197500 -- [-599.334] (-597.162) (-598.845) (-596.075) * (-596.588) [-595.268] (-596.501) (-596.457) -- 0:00:18
198000 -- (-595.463) (-596.860) (-597.809) [-596.797] * (-598.074) (-599.493) (-600.495) [-598.726] -- 0:00:18
198500 -- (-596.881) (-596.231) [-594.706] (-596.274) * [-595.972] (-595.719) (-596.548) (-595.504) -- 0:00:18
199000 -- (-597.099) (-596.194) (-595.610) [-597.097] * (-597.732) (-597.519) (-596.417) [-595.477] -- 0:00:18
199500 -- (-596.397) (-595.292) [-597.374] (-596.051) * [-596.360] (-601.616) (-599.471) (-595.527) -- 0:00:18
200000 -- (-598.220) [-596.984] (-599.039) (-597.371) * (-595.671) (-600.372) (-597.946) [-595.807] -- 0:00:18
Average standard deviation of split frequencies: 0.020154
200500 -- (-597.087) (-601.949) (-596.023) [-596.233] * (-596.268) (-599.257) [-597.084] (-599.305) -- 0:00:17
201000 -- (-599.141) (-596.929) (-598.016) [-595.048] * (-598.022) (-598.480) [-597.197] (-596.754) -- 0:00:17
201500 -- [-594.801] (-596.692) (-597.798) (-597.487) * (-596.419) (-596.688) [-599.114] (-600.768) -- 0:00:17
202000 -- (-594.883) (-596.312) [-594.912] (-595.270) * (-598.193) (-596.691) [-595.020] (-596.474) -- 0:00:17
202500 -- (-595.771) (-596.434) (-598.428) [-595.372] * (-597.344) [-596.530] (-596.169) (-598.021) -- 0:00:17
203000 -- (-601.444) [-596.903] (-596.127) (-595.653) * (-596.097) (-596.415) [-594.894] (-595.410) -- 0:00:17
203500 -- (-596.025) [-597.607] (-595.477) (-602.678) * (-596.709) (-599.364) (-597.995) [-595.590] -- 0:00:17
204000 -- [-595.093] (-596.024) (-596.232) (-604.423) * (-596.340) [-594.911] (-596.874) (-597.459) -- 0:00:17
204500 -- (-595.554) (-595.355) (-599.765) [-604.344] * (-597.807) (-597.131) (-598.924) [-599.585] -- 0:00:17
205000 -- (-597.134) [-597.404] (-597.057) (-598.662) * [-599.154] (-596.059) (-597.247) (-600.413) -- 0:00:17
Average standard deviation of split frequencies: 0.017223
205500 -- (-595.786) (-599.759) [-596.291] (-595.676) * (-599.277) (-594.902) (-595.818) [-595.056] -- 0:00:18
206000 -- (-597.180) (-607.205) [-596.422] (-598.243) * (-595.386) (-595.588) (-601.303) [-598.247] -- 0:00:18
206500 -- (-596.193) (-597.956) [-595.375] (-600.817) * (-596.012) (-596.531) [-596.080] (-596.945) -- 0:00:18
207000 -- (-597.842) (-596.373) (-596.736) [-598.257] * (-601.125) (-596.482) [-597.538] (-596.500) -- 0:00:18
207500 -- (-599.089) (-600.126) (-597.011) [-598.009] * (-599.259) [-595.945] (-596.281) (-598.230) -- 0:00:18
208000 -- (-596.148) (-595.875) [-595.849] (-597.208) * [-595.118] (-598.867) (-598.664) (-597.841) -- 0:00:18
208500 -- [-596.293] (-595.386) (-596.203) (-595.494) * (-598.559) (-599.983) [-597.165] (-596.303) -- 0:00:18
209000 -- (-596.754) [-596.939] (-598.061) (-595.925) * (-595.048) (-597.825) [-595.057] (-604.583) -- 0:00:18
209500 -- (-598.772) [-595.738] (-595.789) (-597.012) * (-599.607) [-597.998] (-596.746) (-595.733) -- 0:00:18
210000 -- (-596.563) [-595.701] (-599.552) (-595.131) * (-598.558) (-596.865) [-596.630] (-607.087) -- 0:00:17
Average standard deviation of split frequencies: 0.017404
210500 -- (-597.335) (-600.711) (-599.698) [-595.528] * [-596.443] (-602.399) (-597.117) (-603.152) -- 0:00:17
211000 -- [-596.353] (-599.307) (-598.433) (-599.608) * [-594.929] (-598.333) (-600.201) (-603.428) -- 0:00:17
211500 -- [-596.849] (-596.616) (-596.259) (-598.220) * (-595.697) [-598.476] (-596.187) (-600.439) -- 0:00:17
212000 -- [-596.660] (-598.078) (-596.287) (-597.819) * (-596.122) [-597.174] (-596.173) (-595.792) -- 0:00:17
212500 -- [-596.344] (-596.917) (-594.996) (-595.299) * (-597.486) [-596.699] (-597.097) (-595.250) -- 0:00:17
213000 -- (-596.418) (-597.557) (-595.550) [-595.776] * (-601.519) (-596.523) [-598.191] (-597.369) -- 0:00:17
213500 -- (-595.796) (-600.417) [-595.413] (-596.965) * (-598.573) (-596.839) (-601.980) [-595.587] -- 0:00:17
214000 -- (-595.935) (-599.345) (-595.641) [-603.034] * [-597.981] (-597.362) (-597.283) (-599.389) -- 0:00:17
214500 -- (-596.697) (-599.653) [-595.713] (-597.183) * (-596.902) (-595.985) (-597.514) [-597.941] -- 0:00:17
215000 -- [-595.053] (-596.864) (-600.732) (-594.574) * [-600.079] (-603.284) (-598.131) (-598.633) -- 0:00:17
Average standard deviation of split frequencies: 0.015851
215500 -- [-598.762] (-595.108) (-601.347) (-597.810) * (-596.433) (-597.134) (-595.873) [-596.096] -- 0:00:17
216000 -- [-596.022] (-597.434) (-599.765) (-596.905) * (-596.459) (-601.701) [-596.469] (-596.332) -- 0:00:17
216500 -- [-595.748] (-596.990) (-597.588) (-596.428) * (-597.104) [-596.385] (-596.114) (-596.798) -- 0:00:17
217000 -- (-602.428) [-596.413] (-594.934) (-595.888) * [-595.063] (-597.986) (-598.381) (-598.229) -- 0:00:16
217500 -- (-597.718) [-595.174] (-595.572) (-597.194) * [-594.936] (-602.480) (-597.068) (-599.595) -- 0:00:16
218000 -- (-598.668) [-597.814] (-596.724) (-600.809) * [-595.693] (-598.081) (-595.587) (-596.701) -- 0:00:16
218500 -- [-599.511] (-597.208) (-596.695) (-596.547) * [-595.541] (-595.121) (-596.403) (-599.079) -- 0:00:16
219000 -- (-595.056) [-598.513] (-600.032) (-596.938) * (-594.864) (-594.641) [-595.859] (-597.090) -- 0:00:16
219500 -- (-597.793) (-598.038) (-598.495) [-596.688] * [-597.134] (-597.797) (-596.569) (-599.491) -- 0:00:16
220000 -- (-596.935) (-595.941) (-596.773) [-595.392] * (-595.643) (-596.130) (-595.737) [-600.254] -- 0:00:16
Average standard deviation of split frequencies: 0.018347
220500 -- (-596.652) [-595.438] (-598.877) (-596.568) * (-601.510) (-596.094) (-595.215) [-595.538] -- 0:00:16
221000 -- (-596.844) [-596.447] (-596.338) (-599.014) * (-600.677) [-595.844] (-598.405) (-595.048) -- 0:00:16
221500 -- (-598.827) [-599.659] (-598.044) (-596.120) * (-595.855) (-596.498) (-596.276) [-596.308] -- 0:00:16
222000 -- (-595.569) (-596.224) [-597.323] (-600.872) * (-596.079) [-595.993] (-594.907) (-595.490) -- 0:00:16
222500 -- (-599.723) (-595.700) (-596.100) [-597.708] * [-596.068] (-597.854) (-596.739) (-596.729) -- 0:00:17
223000 -- (-595.810) (-594.943) [-599.843] (-598.547) * (-595.853) [-598.500] (-598.437) (-598.199) -- 0:00:17
223500 -- (-595.304) [-600.998] (-594.889) (-598.956) * (-596.860) (-596.817) [-595.959] (-595.425) -- 0:00:17
224000 -- (-595.433) (-596.903) [-595.704] (-598.063) * (-597.333) [-596.057] (-596.108) (-599.828) -- 0:00:17
224500 -- (-596.328) (-596.694) [-594.992] (-595.743) * (-597.227) (-596.254) (-598.914) [-596.263] -- 0:00:17
225000 -- (-596.423) [-599.853] (-600.249) (-595.795) * (-595.096) (-597.096) [-599.989] (-596.418) -- 0:00:17
Average standard deviation of split frequencies: 0.018657
225500 -- (-596.093) (-598.459) (-595.973) [-595.619] * [-596.470] (-596.794) (-600.971) (-596.336) -- 0:00:17
226000 -- (-599.777) (-597.011) [-596.032] (-597.626) * (-596.860) (-597.344) (-600.424) [-595.848] -- 0:00:16
226500 -- (-595.015) [-596.620] (-600.131) (-598.613) * (-596.135) (-595.723) (-595.423) [-596.873] -- 0:00:16
227000 -- (-598.725) (-597.310) [-595.549] (-597.356) * (-599.518) [-596.427] (-596.047) (-594.655) -- 0:00:16
227500 -- [-598.888] (-595.677) (-595.807) (-600.224) * (-599.965) (-595.492) (-597.094) [-595.230] -- 0:00:16
228000 -- (-597.728) (-596.446) [-596.548] (-599.519) * (-601.689) (-599.179) [-598.349] (-595.724) -- 0:00:16
228500 -- (-601.668) [-595.721] (-597.053) (-598.432) * (-597.815) [-601.665] (-598.857) (-597.508) -- 0:00:16
229000 -- (-596.121) (-596.183) [-596.464] (-595.630) * [-597.256] (-602.210) (-596.432) (-595.955) -- 0:00:16
229500 -- (-598.911) (-596.728) (-606.326) [-595.147] * (-595.313) (-599.242) (-597.652) [-596.580] -- 0:00:16
230000 -- (-596.633) (-598.818) (-598.608) [-597.902] * (-597.401) [-596.546] (-595.448) (-596.822) -- 0:00:16
Average standard deviation of split frequencies: 0.019576
230500 -- (-595.770) (-595.062) (-595.990) [-597.443] * (-598.325) (-597.357) (-596.216) [-596.886] -- 0:00:16
231000 -- [-596.613] (-598.590) (-595.361) (-598.711) * (-599.664) [-598.288] (-595.153) (-597.186) -- 0:00:16
231500 -- (-594.780) [-595.006] (-598.875) (-599.362) * (-599.318) (-597.699) [-594.928] (-595.877) -- 0:00:16
232000 -- (-596.538) [-598.206] (-598.662) (-599.190) * (-597.436) (-596.208) [-594.959] (-595.742) -- 0:00:16
232500 -- (-597.308) (-598.302) (-600.404) [-598.610] * (-594.825) (-600.105) (-597.306) [-596.239] -- 0:00:16
233000 -- (-595.331) (-598.697) (-600.094) [-601.890] * (-596.550) (-595.836) [-597.022] (-595.652) -- 0:00:16
233500 -- (-599.971) [-600.573] (-599.820) (-598.752) * [-602.034] (-598.784) (-599.284) (-595.218) -- 0:00:15
234000 -- (-599.270) (-607.441) [-596.606] (-597.566) * (-596.984) (-597.834) (-600.673) [-596.885] -- 0:00:15
234500 -- (-595.767) (-598.713) [-597.552] (-596.051) * (-596.985) (-598.007) [-596.594] (-595.742) -- 0:00:15
235000 -- (-596.228) [-597.356] (-597.033) (-598.510) * (-597.415) [-597.713] (-596.481) (-598.578) -- 0:00:15
Average standard deviation of split frequencies: 0.020606
235500 -- (-597.981) (-598.172) [-595.948] (-597.908) * (-598.489) (-594.910) [-595.268] (-598.845) -- 0:00:15
236000 -- (-596.821) (-598.695) (-596.384) [-596.611] * [-598.383] (-597.896) (-598.594) (-597.059) -- 0:00:15
236500 -- (-595.791) (-610.041) (-597.564) [-597.004] * (-595.190) (-595.246) (-601.218) [-597.328] -- 0:00:15
237000 -- (-597.214) (-598.530) [-596.972] (-595.901) * (-597.614) (-599.008) (-598.329) [-596.372] -- 0:00:15
237500 -- [-597.285] (-598.964) (-596.942) (-595.585) * (-598.829) (-597.956) [-596.065] (-597.327) -- 0:00:15
238000 -- (-597.207) (-597.756) [-596.427] (-595.190) * (-595.695) [-595.614] (-595.620) (-597.508) -- 0:00:15
238500 -- (-602.012) (-595.674) [-595.530] (-597.714) * (-596.034) (-599.054) [-596.328] (-597.494) -- 0:00:15
239000 -- (-601.658) (-597.784) (-597.823) [-596.396] * (-597.760) (-599.856) (-594.850) [-598.201] -- 0:00:15
239500 -- [-596.624] (-597.060) (-596.853) (-595.624) * [-595.659] (-598.219) (-598.594) (-598.569) -- 0:00:16
240000 -- (-597.845) (-597.407) (-597.211) [-597.963] * (-598.127) (-599.168) (-595.933) [-596.124] -- 0:00:16
Average standard deviation of split frequencies: 0.019370
240500 -- (-598.671) (-598.296) (-596.632) [-596.448] * (-599.098) (-597.145) [-596.123] (-597.152) -- 0:00:16
241000 -- [-600.127] (-599.356) (-605.330) (-594.780) * [-595.144] (-594.797) (-597.150) (-597.179) -- 0:00:16
241500 -- (-598.201) (-596.350) (-597.138) [-595.878] * (-599.475) (-596.148) (-601.557) [-595.511] -- 0:00:16
242000 -- (-596.949) (-596.512) [-595.639] (-600.245) * (-597.219) [-595.872] (-601.184) (-595.097) -- 0:00:15
242500 -- [-595.816] (-598.630) (-596.299) (-596.226) * (-597.066) (-601.289) [-596.728] (-596.167) -- 0:00:15
243000 -- [-598.975] (-597.482) (-597.678) (-598.645) * (-598.076) (-600.374) (-596.126) [-598.662] -- 0:00:15
243500 -- (-598.411) [-600.266] (-598.246) (-599.723) * (-595.994) (-598.513) (-594.987) [-600.876] -- 0:00:15
244000 -- (-598.574) [-598.596] (-595.807) (-599.196) * [-596.705] (-599.703) (-594.954) (-599.898) -- 0:00:15
244500 -- (-595.552) [-597.664] (-598.402) (-595.233) * [-599.020] (-595.622) (-599.878) (-596.575) -- 0:00:15
245000 -- (-597.531) [-598.037] (-596.154) (-596.024) * (-595.932) (-598.162) (-595.241) [-594.907] -- 0:00:15
Average standard deviation of split frequencies: 0.020025
245500 -- (-600.838) (-596.026) (-598.136) [-597.049] * (-594.797) (-597.578) [-594.952] (-595.623) -- 0:00:15
246000 -- (-602.812) (-600.631) (-598.095) [-597.605] * (-596.451) (-595.417) [-596.834] (-595.195) -- 0:00:15
246500 -- (-597.653) [-597.515] (-595.112) (-598.709) * (-600.881) (-596.286) [-597.772] (-596.511) -- 0:00:15
247000 -- (-596.559) (-597.924) [-595.132] (-603.770) * (-596.849) [-596.956] (-597.749) (-596.944) -- 0:00:15
247500 -- (-597.677) [-594.731] (-596.279) (-597.046) * [-596.474] (-598.288) (-598.177) (-596.140) -- 0:00:15
248000 -- (-598.123) (-595.146) [-594.983] (-597.598) * (-595.048) (-596.528) [-597.918] (-595.863) -- 0:00:15
248500 -- [-597.774] (-595.528) (-595.867) (-596.751) * [-595.059] (-595.284) (-595.663) (-596.765) -- 0:00:15
249000 -- (-595.411) (-595.079) [-596.391] (-595.237) * (-596.630) (-597.278) [-596.428] (-596.068) -- 0:00:15
249500 -- (-595.160) (-597.602) (-602.230) [-600.873] * [-596.335] (-595.349) (-596.320) (-595.848) -- 0:00:15
250000 -- (-599.879) (-598.304) [-596.324] (-596.330) * (-596.973) [-597.719] (-596.797) (-596.217) -- 0:00:15
Average standard deviation of split frequencies: 0.019652
250500 -- (-597.347) (-599.684) [-598.158] (-596.391) * (-600.849) [-599.087] (-595.713) (-595.366) -- 0:00:14
251000 -- (-595.028) [-603.670] (-596.840) (-595.717) * (-603.162) [-596.561] (-599.290) (-597.294) -- 0:00:14
251500 -- (-596.498) (-597.579) (-595.970) [-596.154] * [-595.793] (-598.188) (-599.008) (-597.717) -- 0:00:14
252000 -- [-599.279] (-599.445) (-595.289) (-596.133) * [-598.095] (-598.989) (-596.180) (-596.124) -- 0:00:14
252500 -- (-597.313) [-599.443] (-597.283) (-599.547) * (-595.572) (-597.255) (-596.112) [-598.820] -- 0:00:14
253000 -- (-597.238) [-594.612] (-599.321) (-598.143) * [-595.484] (-597.993) (-596.289) (-598.942) -- 0:00:14
253500 -- (-595.211) (-595.006) (-599.267) [-596.139] * (-597.721) (-596.260) (-598.107) [-596.490] -- 0:00:14
254000 -- (-596.879) [-595.676] (-595.959) (-596.225) * (-596.153) (-597.548) (-600.050) [-596.419] -- 0:00:14
254500 -- [-597.427] (-595.024) (-597.548) (-597.095) * (-597.609) [-595.860] (-601.514) (-598.738) -- 0:00:14
255000 -- (-596.166) [-597.393] (-597.208) (-596.442) * (-594.776) [-595.447] (-600.429) (-596.395) -- 0:00:14
Average standard deviation of split frequencies: 0.019151
255500 -- (-596.055) [-596.789] (-603.074) (-595.851) * (-599.783) (-597.663) (-597.638) [-599.237] -- 0:00:14
256000 -- (-598.755) [-598.292] (-602.864) (-596.076) * (-594.845) (-596.289) (-596.909) [-598.936] -- 0:00:14
256500 -- (-599.640) (-596.232) [-596.140] (-597.568) * [-597.765] (-595.591) (-597.271) (-596.765) -- 0:00:15
257000 -- [-596.125] (-598.777) (-596.974) (-597.719) * [-596.147] (-597.298) (-596.544) (-598.771) -- 0:00:15
257500 -- (-596.786) (-599.152) [-598.660] (-598.959) * (-597.583) (-597.765) [-595.025] (-595.257) -- 0:00:15
258000 -- [-597.574] (-600.457) (-595.330) (-597.908) * (-600.452) (-594.935) [-598.833] (-595.513) -- 0:00:15
258500 -- (-597.728) (-600.400) [-597.738] (-596.486) * [-596.582] (-596.892) (-599.717) (-596.844) -- 0:00:14
259000 -- (-598.829) [-595.875] (-595.414) (-596.459) * (-597.758) [-595.056] (-596.649) (-595.430) -- 0:00:14
259500 -- (-597.755) (-596.235) (-597.519) [-596.527] * (-597.275) (-597.578) [-597.762] (-595.519) -- 0:00:14
260000 -- (-597.107) (-597.369) [-595.507] (-596.720) * (-599.205) (-596.587) (-603.350) [-598.706] -- 0:00:14
Average standard deviation of split frequencies: 0.018846
260500 -- [-596.035] (-596.601) (-599.355) (-595.554) * (-597.750) [-596.157] (-597.627) (-597.698) -- 0:00:14
261000 -- (-596.058) [-596.490] (-598.501) (-596.242) * (-596.936) (-597.279) [-595.571] (-596.693) -- 0:00:14
261500 -- (-595.423) (-596.730) [-596.619] (-596.420) * (-596.873) (-595.677) [-597.442] (-599.594) -- 0:00:14
262000 -- (-595.464) (-595.713) (-596.094) [-596.292] * [-597.951] (-598.577) (-595.451) (-597.088) -- 0:00:14
262500 -- (-594.551) (-597.144) (-597.710) [-598.089] * [-597.452] (-598.341) (-595.743) (-598.544) -- 0:00:14
263000 -- (-598.482) [-595.547] (-597.448) (-597.697) * (-595.869) (-599.382) [-596.610] (-598.323) -- 0:00:14
263500 -- (-596.247) (-597.923) (-595.966) [-595.448] * (-595.658) [-599.465] (-597.201) (-594.947) -- 0:00:14
264000 -- (-595.705) (-596.557) (-599.982) [-596.843] * [-597.089] (-596.608) (-595.586) (-596.047) -- 0:00:14
264500 -- (-594.712) (-600.217) (-597.654) [-595.943] * (-598.470) (-600.674) [-595.715] (-595.524) -- 0:00:14
265000 -- (-595.969) [-596.617] (-595.208) (-596.683) * (-599.557) [-597.652] (-595.728) (-599.543) -- 0:00:14
Average standard deviation of split frequencies: 0.018697
265500 -- (-595.183) (-596.660) [-596.626] (-595.828) * (-597.813) (-599.902) (-598.732) [-598.149] -- 0:00:14
266000 -- (-596.457) (-595.948) [-596.213] (-598.306) * (-595.585) (-597.420) (-596.797) [-597.933] -- 0:00:14
266500 -- [-596.617] (-594.799) (-597.395) (-596.781) * [-597.816] (-597.674) (-597.425) (-597.460) -- 0:00:14
267000 -- (-596.388) (-595.249) [-596.039] (-595.385) * (-597.663) (-595.465) (-596.492) [-596.000] -- 0:00:13
267500 -- (-598.706) (-596.053) (-597.429) [-597.067] * (-601.750) (-597.218) (-595.800) [-595.680] -- 0:00:13
268000 -- (-598.005) (-595.793) (-598.591) [-595.332] * (-595.736) [-595.444] (-594.828) (-597.598) -- 0:00:13
268500 -- (-596.631) (-596.229) [-595.599] (-597.937) * (-596.082) (-597.583) (-600.165) [-597.426] -- 0:00:13
269000 -- (-595.380) [-597.279] (-599.678) (-598.805) * [-595.671] (-598.109) (-597.395) (-595.475) -- 0:00:13
269500 -- (-597.052) (-598.356) (-601.145) [-595.950] * (-599.491) (-597.336) (-596.407) [-596.844] -- 0:00:13
270000 -- (-599.692) (-595.699) (-596.394) [-595.940] * (-599.247) (-599.673) (-597.653) [-597.657] -- 0:00:13
Average standard deviation of split frequencies: 0.017939
270500 -- (-597.379) (-596.243) [-595.946] (-596.229) * (-596.395) (-595.283) (-598.124) [-598.737] -- 0:00:13
271000 -- (-599.904) (-596.290) (-598.497) [-595.327] * (-595.459) (-595.230) (-599.653) [-597.216] -- 0:00:13
271500 -- [-597.960] (-595.104) (-598.802) (-596.330) * (-595.844) [-598.563] (-596.789) (-597.771) -- 0:00:13
272000 -- (-596.578) [-597.984] (-598.827) (-597.795) * (-594.938) (-602.762) (-600.980) [-596.137] -- 0:00:13
272500 -- [-594.987] (-595.924) (-598.593) (-600.586) * (-595.507) (-596.057) (-596.493) [-599.522] -- 0:00:13
273000 -- [-597.725] (-600.723) (-599.861) (-598.743) * (-598.865) (-598.092) (-597.058) [-595.816] -- 0:00:13
273500 -- (-595.119) (-598.458) [-595.656] (-600.203) * (-598.184) (-596.445) [-597.203] (-600.414) -- 0:00:14
274000 -- (-600.189) [-599.165] (-596.304) (-598.943) * (-598.691) (-597.317) [-596.836] (-598.249) -- 0:00:14
274500 -- (-599.130) (-598.606) [-597.633] (-596.469) * (-597.828) (-597.727) (-595.503) [-597.037] -- 0:00:13
275000 -- [-596.083] (-598.577) (-598.689) (-598.147) * (-599.531) (-596.646) [-595.239] (-599.685) -- 0:00:13
Average standard deviation of split frequencies: 0.016271
275500 -- [-596.845] (-594.987) (-602.509) (-596.303) * [-597.963] (-595.855) (-595.597) (-598.352) -- 0:00:13
276000 -- (-599.505) [-595.757] (-595.859) (-595.032) * (-597.375) (-596.576) (-597.571) [-596.624] -- 0:00:13
276500 -- [-596.541] (-595.406) (-599.428) (-598.015) * (-598.274) (-597.271) [-597.148] (-596.333) -- 0:00:13
277000 -- (-596.560) (-595.958) [-598.221] (-596.469) * (-597.870) [-595.497] (-595.875) (-595.073) -- 0:00:13
277500 -- (-603.836) (-596.408) [-599.636] (-597.839) * (-599.503) (-597.845) (-596.168) [-595.029] -- 0:00:13
278000 -- (-598.383) (-595.085) [-596.522] (-600.205) * (-596.314) [-595.503] (-597.433) (-596.225) -- 0:00:13
278500 -- (-596.489) [-595.171] (-596.092) (-596.771) * (-599.115) (-596.427) [-596.709] (-599.121) -- 0:00:13
279000 -- (-595.688) (-597.516) (-596.486) [-594.779] * (-597.129) (-599.391) [-596.376] (-597.788) -- 0:00:13
279500 -- (-595.891) [-595.904] (-599.477) (-597.026) * (-596.379) [-596.472] (-600.607) (-598.118) -- 0:00:13
280000 -- [-597.402] (-596.344) (-596.289) (-595.395) * (-600.704) (-597.982) [-603.770] (-597.257) -- 0:00:13
Average standard deviation of split frequencies: 0.014836
280500 -- [-595.871] (-600.006) (-597.406) (-596.355) * [-598.493] (-597.076) (-596.388) (-600.254) -- 0:00:13
281000 -- (-597.280) (-596.206) (-603.348) [-595.079] * (-600.778) (-596.136) [-599.177] (-600.131) -- 0:00:13
281500 -- (-601.663) (-598.133) [-600.070] (-595.699) * (-597.172) [-595.547] (-602.233) (-597.056) -- 0:00:13
282000 -- (-598.584) (-597.942) [-596.372] (-598.780) * (-597.078) (-598.919) [-597.469] (-596.979) -- 0:00:13
282500 -- (-598.020) (-595.244) [-595.979] (-597.415) * (-596.013) (-599.104) (-597.773) [-597.076] -- 0:00:13
283000 -- (-595.982) [-598.770] (-596.312) (-595.072) * (-597.003) (-599.582) [-596.841] (-595.593) -- 0:00:13
283500 -- [-596.271] (-595.311) (-597.140) (-597.705) * [-595.119] (-597.047) (-596.487) (-601.135) -- 0:00:12
284000 -- (-596.446) [-595.861] (-599.533) (-597.958) * [-594.989] (-596.984) (-597.537) (-597.126) -- 0:00:12
284500 -- (-599.113) (-596.077) [-603.482] (-598.360) * (-597.862) (-599.313) [-598.089] (-598.892) -- 0:00:12
285000 -- (-596.436) (-597.683) (-598.585) [-598.722] * [-597.716] (-601.382) (-599.729) (-597.142) -- 0:00:12
Average standard deviation of split frequencies: 0.016136
285500 -- (-596.662) (-596.616) (-595.650) [-597.512] * (-596.832) [-596.211] (-597.268) (-598.745) -- 0:00:12
286000 -- [-596.233] (-599.629) (-595.288) (-596.404) * [-599.440] (-596.230) (-597.259) (-596.806) -- 0:00:12
286500 -- (-597.205) (-597.272) (-595.575) [-596.539] * (-605.251) [-598.426] (-595.367) (-595.614) -- 0:00:12
287000 -- (-595.355) (-599.245) (-595.799) [-595.998] * (-595.027) (-597.909) [-595.621] (-598.391) -- 0:00:12
287500 -- [-596.852] (-596.797) (-597.107) (-595.336) * (-595.751) (-596.079) (-595.536) [-599.984] -- 0:00:12
288000 -- (-597.342) (-600.922) [-596.153] (-597.579) * [-594.934] (-595.136) (-596.629) (-595.569) -- 0:00:12
288500 -- (-602.068) [-595.593] (-597.118) (-595.879) * [-595.235] (-596.290) (-595.001) (-597.607) -- 0:00:12
289000 -- [-598.419] (-597.800) (-596.431) (-597.418) * (-596.703) [-597.239] (-600.721) (-596.196) -- 0:00:12
289500 -- (-601.955) [-597.783] (-597.481) (-594.995) * (-595.491) (-598.408) [-601.072] (-595.040) -- 0:00:12
290000 -- [-595.833] (-596.676) (-596.669) (-595.678) * (-596.607) [-598.729] (-597.014) (-598.922) -- 0:00:12
Average standard deviation of split frequencies: 0.015975
290500 -- [-595.764] (-596.394) (-596.303) (-597.234) * [-597.224] (-597.830) (-600.151) (-595.419) -- 0:00:12
291000 -- (-598.860) [-596.711] (-597.951) (-597.005) * (-595.777) [-596.520] (-602.318) (-595.595) -- 0:00:12
291500 -- (-596.376) (-599.236) (-596.684) [-596.947] * (-599.135) (-595.742) (-597.222) [-595.859] -- 0:00:12
292000 -- [-595.782] (-596.571) (-596.513) (-594.985) * (-602.329) (-595.441) (-596.493) [-595.926] -- 0:00:12
292500 -- (-598.941) (-595.930) [-596.230] (-596.564) * [-598.611] (-598.279) (-595.920) (-602.111) -- 0:00:12
293000 -- (-599.749) [-594.964] (-598.457) (-595.746) * (-596.393) [-595.684] (-597.941) (-597.931) -- 0:00:12
293500 -- (-597.682) (-598.248) (-595.707) [-596.151] * [-595.283] (-595.694) (-608.450) (-600.314) -- 0:00:12
294000 -- (-598.526) (-597.491) (-594.961) [-595.442] * (-598.393) (-595.606) (-600.633) [-595.293] -- 0:00:12
294500 -- (-594.694) (-597.970) [-596.052] (-600.282) * (-596.674) (-600.886) [-597.181] (-594.845) -- 0:00:12
295000 -- (-594.672) (-597.187) (-597.214) [-595.956] * (-597.588) (-599.938) (-601.454) [-596.051] -- 0:00:12
Average standard deviation of split frequencies: 0.016722
295500 -- (-595.404) (-596.041) (-597.116) [-595.021] * [-600.419] (-596.163) (-597.629) (-596.428) -- 0:00:12
296000 -- (-594.630) (-596.135) (-595.791) [-596.239] * (-602.794) (-595.705) [-595.613] (-595.522) -- 0:00:12
296500 -- [-600.266] (-596.511) (-597.758) (-597.042) * (-596.427) (-598.001) (-597.254) [-595.930] -- 0:00:12
297000 -- (-596.580) [-594.967] (-597.179) (-595.397) * [-599.635] (-599.777) (-599.395) (-596.741) -- 0:00:12
297500 -- (-599.838) (-595.374) [-595.468] (-594.764) * (-597.748) [-602.795] (-598.371) (-597.671) -- 0:00:12
298000 -- (-597.088) (-595.443) (-602.251) [-595.223] * (-597.094) (-597.539) (-598.319) [-599.372] -- 0:00:12
298500 -- (-597.838) (-597.285) (-598.574) [-596.690] * (-597.033) (-599.465) (-598.276) [-597.747] -- 0:00:12
299000 -- (-597.923) (-599.232) [-597.793] (-594.674) * (-599.386) (-595.386) (-597.432) [-595.781] -- 0:00:12
299500 -- [-599.146] (-596.616) (-596.943) (-598.114) * [-596.088] (-595.902) (-599.288) (-599.081) -- 0:00:12
300000 -- (-597.081) (-597.589) [-600.642] (-595.886) * [-598.188] (-596.185) (-596.617) (-596.264) -- 0:00:12
Average standard deviation of split frequencies: 0.016384
300500 -- (-598.923) [-597.621] (-597.524) (-595.584) * (-596.384) (-597.937) (-596.720) [-595.123] -- 0:00:11
301000 -- (-598.171) (-596.602) (-597.860) [-596.753] * (-595.783) [-595.517] (-596.669) (-596.987) -- 0:00:11
301500 -- (-595.468) (-600.917) (-598.614) [-595.011] * (-596.141) (-596.490) (-599.416) [-597.267] -- 0:00:11
302000 -- (-597.047) (-596.811) (-599.901) [-595.035] * (-598.565) (-595.988) (-597.363) [-597.317] -- 0:00:11
302500 -- (-599.183) [-595.202] (-599.099) (-598.202) * (-597.860) (-596.168) (-602.526) [-597.019] -- 0:00:11
303000 -- [-598.284] (-595.997) (-597.063) (-595.452) * (-597.516) (-596.716) (-598.059) [-599.295] -- 0:00:11
303500 -- [-597.611] (-596.653) (-596.739) (-596.451) * [-599.967] (-597.897) (-598.660) (-597.003) -- 0:00:11
304000 -- [-598.031] (-597.985) (-597.586) (-595.411) * (-596.389) (-595.439) (-597.584) [-595.650] -- 0:00:11
304500 -- (-598.623) [-597.016] (-597.122) (-594.729) * (-609.331) [-597.025] (-596.397) (-598.121) -- 0:00:11
305000 -- (-600.581) [-596.258] (-596.937) (-595.792) * (-595.202) (-596.734) [-595.388] (-598.913) -- 0:00:11
Average standard deviation of split frequencies: 0.016946
305500 -- [-597.707] (-597.065) (-596.464) (-596.297) * (-596.506) (-597.078) (-603.385) [-595.552] -- 0:00:11
306000 -- (-598.772) (-597.811) [-595.849] (-595.168) * [-596.644] (-598.246) (-599.462) (-598.699) -- 0:00:11
306500 -- [-599.332] (-600.507) (-597.040) (-595.797) * (-598.629) [-600.152] (-598.059) (-599.286) -- 0:00:11
307000 -- [-596.209] (-598.367) (-601.348) (-595.554) * (-599.889) [-600.696] (-599.826) (-597.335) -- 0:00:11
307500 -- (-596.578) (-595.793) [-599.713] (-596.636) * [-598.002] (-596.845) (-595.875) (-603.185) -- 0:00:11
308000 -- (-598.043) (-599.516) [-601.129] (-596.628) * (-595.598) (-595.630) [-598.187] (-599.033) -- 0:00:11
308500 -- [-596.252] (-596.299) (-596.128) (-596.860) * (-596.360) [-596.233] (-598.695) (-595.788) -- 0:00:11
309000 -- [-597.009] (-596.887) (-596.505) (-598.100) * (-597.073) (-599.152) [-597.762] (-596.106) -- 0:00:11
309500 -- (-596.507) [-601.127] (-599.589) (-597.411) * (-597.507) (-598.115) [-596.794] (-596.300) -- 0:00:11
310000 -- (-595.724) (-596.925) (-595.572) [-598.064] * (-600.615) (-597.291) (-595.462) [-600.367] -- 0:00:11
Average standard deviation of split frequencies: 0.016843
310500 -- [-596.862] (-595.280) (-596.461) (-596.119) * (-596.176) (-596.802) (-600.826) [-596.011] -- 0:00:11
311000 -- (-596.597) (-596.651) [-599.696] (-598.063) * [-594.722] (-596.318) (-597.430) (-597.815) -- 0:00:11
311500 -- (-598.319) (-598.082) [-599.145] (-596.626) * [-597.104] (-596.940) (-594.932) (-601.715) -- 0:00:11
312000 -- (-598.834) [-596.302] (-597.240) (-595.253) * [-595.900] (-598.254) (-595.471) (-598.884) -- 0:00:11
312500 -- (-594.714) [-594.733] (-600.294) (-596.316) * [-595.657] (-598.393) (-597.342) (-595.661) -- 0:00:11
313000 -- (-596.437) (-595.986) (-594.855) [-598.036] * (-595.838) (-595.174) [-595.336] (-598.499) -- 0:00:11
313500 -- (-595.321) (-601.140) [-597.753] (-598.385) * (-600.348) [-597.000] (-598.433) (-596.162) -- 0:00:11
314000 -- (-596.845) [-597.405] (-595.928) (-596.521) * (-596.123) (-604.849) (-599.847) [-596.360] -- 0:00:11
314500 -- (-596.226) (-596.693) [-597.295] (-596.085) * [-595.439] (-604.515) (-596.935) (-595.485) -- 0:00:11
315000 -- (-598.131) (-598.079) [-598.625] (-594.886) * (-600.595) [-599.915] (-597.472) (-596.374) -- 0:00:11
Average standard deviation of split frequencies: 0.016017
315500 -- [-596.209] (-595.548) (-597.225) (-602.336) * (-595.577) [-596.708] (-598.525) (-595.453) -- 0:00:11
316000 -- (-598.254) (-596.564) [-596.662] (-599.916) * (-597.452) [-595.543] (-596.677) (-597.393) -- 0:00:11
316500 -- (-598.584) (-596.984) (-602.098) [-597.357] * [-598.402] (-595.789) (-597.989) (-596.035) -- 0:00:11
317000 -- (-597.580) [-597.437] (-596.568) (-596.630) * (-598.572) (-596.105) (-595.316) [-597.011] -- 0:00:10
317500 -- (-596.478) [-595.294] (-597.180) (-598.467) * (-597.502) (-595.224) (-596.071) [-595.870] -- 0:00:10
318000 -- (-594.813) (-595.292) [-597.004] (-597.452) * [-597.745] (-596.819) (-595.953) (-598.638) -- 0:00:10
318500 -- [-595.852] (-596.059) (-598.235) (-599.443) * (-596.415) [-595.553] (-598.175) (-598.276) -- 0:00:10
319000 -- (-596.384) (-595.788) (-597.393) [-595.426] * [-597.077] (-596.842) (-594.978) (-598.270) -- 0:00:10
319500 -- (-595.437) (-598.061) [-595.506] (-596.929) * (-598.163) (-596.212) (-601.280) [-598.498] -- 0:00:10
320000 -- (-599.277) (-601.993) (-595.116) [-596.219] * (-597.310) (-597.401) (-605.444) [-597.459] -- 0:00:10
Average standard deviation of split frequencies: 0.015861
320500 -- [-598.062] (-596.656) (-597.367) (-595.594) * (-598.622) [-598.220] (-601.728) (-596.803) -- 0:00:10
321000 -- (-598.365) (-598.171) (-596.061) [-595.665] * (-595.148) (-595.632) (-596.545) [-596.136] -- 0:00:10
321500 -- (-598.783) [-597.005] (-596.064) (-595.469) * (-601.478) [-595.213] (-598.548) (-595.678) -- 0:00:10
322000 -- (-597.677) (-595.863) [-595.913] (-597.640) * [-601.106] (-596.567) (-596.691) (-598.648) -- 0:00:10
322500 -- (-596.144) [-598.222] (-597.161) (-596.002) * (-596.623) [-596.364] (-598.843) (-595.493) -- 0:00:10
323000 -- (-595.988) (-596.799) [-596.205] (-599.651) * (-596.358) (-596.198) (-601.657) [-595.740] -- 0:00:10
323500 -- (-595.722) (-595.559) (-600.970) [-596.151] * [-595.878] (-596.723) (-597.085) (-596.815) -- 0:00:10
324000 -- (-597.298) (-597.979) (-598.741) [-597.309] * [-596.154] (-598.775) (-597.096) (-598.654) -- 0:00:10
324500 -- (-596.770) [-596.840] (-597.333) (-597.768) * (-598.228) [-597.337] (-596.790) (-598.263) -- 0:00:10
325000 -- (-597.914) (-599.517) (-596.157) [-595.716] * (-602.596) (-596.928) (-596.435) [-597.926] -- 0:00:10
Average standard deviation of split frequencies: 0.014841
325500 -- (-597.330) (-599.310) [-595.831] (-596.985) * [-606.374] (-597.723) (-595.640) (-598.507) -- 0:00:10
326000 -- [-596.219] (-601.388) (-595.665) (-595.507) * (-599.134) (-596.598) [-595.013] (-596.787) -- 0:00:10
326500 -- (-599.129) (-597.319) (-595.371) [-595.666] * (-601.142) (-595.326) [-600.500] (-596.895) -- 0:00:10
327000 -- (-596.609) [-598.241] (-597.047) (-600.046) * (-595.004) (-601.544) (-598.424) [-596.459] -- 0:00:10
327500 -- (-596.632) (-599.968) (-598.255) [-594.567] * (-595.808) (-597.372) [-597.080] (-596.939) -- 0:00:10
328000 -- [-599.280] (-600.592) (-596.372) (-594.529) * (-595.833) [-595.460] (-598.255) (-596.757) -- 0:00:10
328500 -- (-600.614) (-595.261) [-597.212] (-596.765) * [-596.737] (-596.838) (-597.787) (-601.159) -- 0:00:10
329000 -- (-597.663) (-597.860) (-595.229) [-597.350] * [-597.114] (-599.856) (-599.159) (-598.849) -- 0:00:10
329500 -- (-596.882) (-597.171) (-596.981) [-597.199] * (-595.063) (-596.761) (-597.042) [-598.735] -- 0:00:10
330000 -- (-597.600) (-598.587) [-597.614] (-600.928) * (-595.357) [-597.525] (-596.221) (-598.421) -- 0:00:10
Average standard deviation of split frequencies: 0.014481
330500 -- [-595.556] (-599.879) (-601.587) (-595.319) * (-596.839) (-601.777) (-597.962) [-597.513] -- 0:00:10
331000 -- (-597.768) [-597.761] (-599.452) (-595.340) * [-597.250] (-601.052) (-597.191) (-597.996) -- 0:00:10
331500 -- (-603.239) (-597.884) [-596.182] (-596.674) * [-594.890] (-595.926) (-595.094) (-597.246) -- 0:00:10
332000 -- (-599.430) (-601.817) (-599.412) [-596.580] * (-601.809) [-598.125] (-596.207) (-595.343) -- 0:00:10
332500 -- (-598.913) (-599.529) (-595.955) [-594.983] * (-594.837) (-598.275) (-595.101) [-596.845] -- 0:00:10
333000 -- (-597.061) [-595.128] (-600.121) (-598.388) * (-598.541) [-597.680] (-596.453) (-596.680) -- 0:00:10
333500 -- [-596.415] (-596.899) (-600.246) (-598.267) * (-596.495) (-598.269) (-596.642) [-597.586] -- 0:00:09
334000 -- (-595.422) (-595.753) [-600.979] (-595.823) * (-598.060) (-597.792) (-595.417) [-596.110] -- 0:00:09
334500 -- (-595.645) [-597.537] (-597.715) (-596.327) * (-598.387) (-595.823) (-596.417) [-596.620] -- 0:00:09
335000 -- (-595.542) (-596.579) (-596.474) [-596.281] * (-604.477) [-598.258] (-595.829) (-598.797) -- 0:00:09
Average standard deviation of split frequencies: 0.014990
335500 -- (-595.604) [-595.236] (-595.907) (-598.096) * (-595.376) (-595.269) [-597.764] (-596.102) -- 0:00:09
336000 -- (-598.302) (-596.087) [-596.265] (-597.229) * (-599.335) (-596.877) [-596.576] (-595.384) -- 0:00:09
336500 -- (-595.026) (-597.219) [-595.970] (-596.518) * (-599.311) (-597.258) (-596.166) [-596.131] -- 0:00:09
337000 -- (-595.759) (-597.766) [-597.220] (-596.911) * (-596.551) (-597.196) (-599.011) [-597.666] -- 0:00:09
337500 -- (-595.309) (-600.285) [-595.656] (-597.464) * (-595.292) (-597.300) [-596.898] (-596.095) -- 0:00:09
338000 -- (-599.153) (-599.529) [-597.115] (-595.598) * (-597.589) (-594.989) [-595.750] (-598.703) -- 0:00:09
338500 -- (-598.339) (-597.128) (-596.495) [-600.093] * [-596.280] (-597.253) (-598.150) (-596.379) -- 0:00:09
339000 -- (-595.572) (-596.224) (-599.006) [-596.262] * (-595.882) (-595.674) (-595.243) [-594.812] -- 0:00:09
339500 -- [-597.849] (-597.153) (-600.435) (-596.435) * [-598.034] (-595.874) (-597.436) (-595.508) -- 0:00:09
340000 -- (-596.547) (-598.923) (-597.949) [-596.151] * (-597.109) (-595.739) (-598.060) [-596.559] -- 0:00:09
Average standard deviation of split frequencies: 0.015145
340500 -- [-599.346] (-595.678) (-597.315) (-597.059) * (-599.094) [-596.846] (-595.967) (-595.077) -- 0:00:09
341000 -- [-597.774] (-597.770) (-598.266) (-599.053) * (-598.679) (-595.340) [-595.364] (-595.511) -- 0:00:09
341500 -- (-602.321) [-597.108] (-597.984) (-596.365) * [-598.920] (-597.157) (-595.767) (-599.100) -- 0:00:09
342000 -- (-597.834) (-598.790) (-599.246) [-600.263] * (-598.586) (-596.848) (-600.487) [-597.572] -- 0:00:09
342500 -- [-597.064] (-601.531) (-598.414) (-602.302) * (-595.899) (-598.891) (-599.006) [-601.215] -- 0:00:09
343000 -- [-596.900] (-594.920) (-599.512) (-597.139) * (-596.021) (-598.003) (-599.864) [-598.836] -- 0:00:09
343500 -- (-597.009) (-596.552) (-595.294) [-595.425] * [-596.220] (-600.265) (-596.223) (-601.788) -- 0:00:09
344000 -- [-598.776] (-598.744) (-597.172) (-597.094) * [-597.576] (-596.307) (-598.105) (-599.206) -- 0:00:09
344500 -- (-596.322) (-595.796) (-597.415) [-597.505] * (-597.114) [-598.793] (-597.452) (-597.515) -- 0:00:09
345000 -- (-595.032) [-598.555] (-595.725) (-596.581) * [-596.815] (-596.716) (-596.520) (-597.070) -- 0:00:09
Average standard deviation of split frequencies: 0.015345
345500 -- (-595.823) [-594.598] (-596.920) (-596.131) * [-597.204] (-598.158) (-597.858) (-597.021) -- 0:00:09
346000 -- [-599.359] (-601.384) (-595.951) (-597.400) * [-596.405] (-596.371) (-595.943) (-598.363) -- 0:00:09
346500 -- (-598.398) (-596.309) (-598.151) [-597.218] * (-597.907) [-596.375] (-597.547) (-599.198) -- 0:00:09
347000 -- (-599.514) [-595.312] (-596.951) (-596.400) * [-595.159] (-595.766) (-599.380) (-595.584) -- 0:00:09
347500 -- [-600.369] (-601.314) (-597.641) (-598.068) * (-597.595) [-595.360] (-596.069) (-596.212) -- 0:00:09
348000 -- (-596.836) (-598.522) (-599.233) [-597.808] * (-596.888) (-596.015) (-598.235) [-596.559] -- 0:00:09
348500 -- [-597.684] (-595.767) (-597.687) (-597.021) * (-600.355) (-594.968) (-596.680) [-599.936] -- 0:00:09
349000 -- (-598.756) (-595.133) [-596.277] (-596.722) * (-604.618) (-596.641) [-596.392] (-598.699) -- 0:00:09
349500 -- (-598.868) (-600.322) [-596.089] (-601.760) * (-602.786) (-599.618) (-597.665) [-596.415] -- 0:00:09
350000 -- (-597.630) (-599.453) [-598.154] (-602.919) * (-596.899) [-596.020] (-597.537) (-599.742) -- 0:00:09
Average standard deviation of split frequencies: 0.015990
350500 -- (-595.290) (-599.295) (-602.777) [-597.055] * [-595.650] (-596.135) (-598.731) (-599.039) -- 0:00:08
351000 -- (-596.015) [-597.535] (-602.141) (-599.836) * [-597.250] (-595.690) (-598.012) (-596.892) -- 0:00:08
351500 -- (-595.514) [-595.331] (-604.328) (-596.910) * (-597.312) (-595.929) [-598.168] (-599.130) -- 0:00:08
352000 -- [-597.020] (-596.945) (-600.193) (-595.471) * (-598.008) [-595.471] (-598.268) (-607.669) -- 0:00:08
352500 -- [-597.356] (-595.292) (-596.418) (-599.208) * (-598.561) [-597.355] (-598.613) (-596.426) -- 0:00:08
353000 -- [-597.055] (-600.694) (-597.074) (-595.932) * (-596.541) [-598.393] (-597.897) (-599.213) -- 0:00:08
353500 -- [-600.049] (-596.062) (-598.075) (-596.057) * (-597.508) (-601.615) (-596.589) [-595.561] -- 0:00:08
354000 -- (-600.773) (-595.824) [-594.891] (-598.582) * (-596.140) [-595.150] (-595.291) (-595.373) -- 0:00:08
354500 -- (-599.696) (-596.237) [-594.679] (-596.206) * [-596.032] (-595.630) (-596.969) (-602.162) -- 0:00:08
355000 -- (-596.674) (-595.909) [-596.118] (-594.658) * (-595.610) (-596.860) (-598.425) [-596.213] -- 0:00:08
Average standard deviation of split frequencies: 0.015302
355500 -- (-595.474) (-596.878) (-595.185) [-599.629] * (-596.901) (-597.253) (-596.172) [-595.209] -- 0:00:08
356000 -- (-595.543) (-599.925) (-595.231) [-597.181] * (-599.096) (-595.630) (-601.176) [-597.484] -- 0:00:08
356500 -- (-595.682) (-596.419) (-595.819) [-594.685] * [-599.496] (-595.873) (-598.566) (-596.164) -- 0:00:08
357000 -- (-600.314) [-597.494] (-596.304) (-597.916) * (-596.137) (-598.889) [-598.362] (-596.069) -- 0:00:08
357500 -- (-595.418) [-595.717] (-595.452) (-597.515) * (-595.575) [-596.844] (-598.043) (-596.592) -- 0:00:08
358000 -- [-596.052] (-595.312) (-595.080) (-596.135) * (-599.547) (-597.543) [-595.906] (-597.239) -- 0:00:08
358500 -- (-596.776) [-595.896] (-595.304) (-595.748) * [-598.653] (-598.961) (-601.405) (-595.252) -- 0:00:08
359000 -- (-597.876) [-600.847] (-597.965) (-594.960) * (-597.760) (-599.957) (-595.359) [-595.122] -- 0:00:08
359500 -- (-599.183) (-597.350) (-595.700) [-595.435] * (-595.664) (-597.471) [-596.381] (-594.987) -- 0:00:08
360000 -- (-601.199) (-596.321) [-596.587] (-596.255) * (-595.365) (-599.533) [-598.498] (-595.778) -- 0:00:08
Average standard deviation of split frequencies: 0.014668
360500 -- (-598.689) [-596.696] (-596.532) (-599.671) * [-597.848] (-603.845) (-597.340) (-595.569) -- 0:00:08
361000 -- [-597.105] (-597.635) (-598.308) (-597.265) * [-598.241] (-600.042) (-595.413) (-602.376) -- 0:00:08
361500 -- (-597.086) (-602.860) [-598.382] (-598.206) * (-599.742) (-599.121) [-596.091] (-597.486) -- 0:00:08
362000 -- (-597.092) (-599.656) [-602.349] (-596.042) * (-595.629) [-603.107] (-597.550) (-600.706) -- 0:00:08
362500 -- [-595.655] (-598.458) (-598.142) (-597.541) * (-601.887) (-598.440) [-596.724] (-598.223) -- 0:00:08
363000 -- (-596.937) [-596.520] (-594.943) (-600.827) * (-598.696) (-596.568) (-598.943) [-596.581] -- 0:00:08
363500 -- [-595.297] (-598.678) (-596.478) (-600.168) * [-598.403] (-595.070) (-596.706) (-598.533) -- 0:00:08
364000 -- (-599.226) [-598.332] (-598.144) (-602.699) * [-595.824] (-597.574) (-596.143) (-595.676) -- 0:00:08
364500 -- (-594.977) (-595.992) (-598.596) [-600.602] * (-597.922) (-595.643) [-596.009] (-600.153) -- 0:00:08
365000 -- (-596.495) [-595.611] (-594.545) (-596.972) * [-594.735] (-597.151) (-595.732) (-595.632) -- 0:00:08
Average standard deviation of split frequencies: 0.014812
365500 -- (-599.734) (-599.046) (-597.683) [-595.689] * [-596.178] (-596.193) (-597.125) (-596.519) -- 0:00:08
366000 -- (-595.829) (-597.933) [-595.686] (-595.945) * (-597.526) (-594.992) [-594.923] (-597.047) -- 0:00:08
366500 -- (-595.925) [-600.216] (-595.861) (-595.847) * [-599.343] (-596.028) (-596.469) (-598.406) -- 0:00:08
367000 -- (-595.529) (-598.319) (-597.224) [-599.294] * (-598.706) (-596.351) (-596.725) [-601.049] -- 0:00:07
367500 -- (-595.963) (-596.954) [-596.859] (-598.719) * (-596.506) [-598.322] (-597.909) (-603.276) -- 0:00:07
368000 -- (-599.885) [-595.888] (-598.593) (-595.472) * [-598.843] (-596.050) (-594.862) (-596.567) -- 0:00:07
368500 -- (-596.539) (-597.210) [-597.200] (-598.569) * [-596.180] (-597.403) (-594.709) (-599.065) -- 0:00:07
369000 -- (-595.842) (-600.125) (-597.397) [-598.766] * [-598.386] (-597.045) (-595.655) (-599.403) -- 0:00:07
369500 -- (-598.383) (-600.364) (-595.446) [-595.650] * [-596.443] (-596.898) (-596.489) (-602.783) -- 0:00:07
370000 -- (-598.211) [-597.681] (-597.085) (-596.221) * (-596.883) [-596.795] (-597.925) (-595.749) -- 0:00:07
Average standard deviation of split frequencies: 0.015403
370500 -- [-598.048] (-596.963) (-596.615) (-596.112) * (-595.128) (-597.070) [-598.404] (-600.153) -- 0:00:07
371000 -- (-597.784) (-596.837) [-597.669] (-596.831) * (-596.750) [-597.047] (-596.240) (-598.796) -- 0:00:07
371500 -- (-599.092) (-596.269) [-595.413] (-596.745) * [-595.609] (-600.156) (-596.143) (-602.765) -- 0:00:07
372000 -- (-597.949) (-596.164) [-596.430] (-596.375) * (-597.419) (-599.093) [-597.512] (-597.582) -- 0:00:07
372500 -- (-595.919) (-598.263) (-596.758) [-596.845] * (-595.638) (-598.588) (-597.751) [-596.976] -- 0:00:07
373000 -- (-595.600) [-595.335] (-596.569) (-596.144) * (-604.766) [-595.268] (-595.723) (-598.648) -- 0:00:07
373500 -- (-595.352) (-596.689) [-596.690] (-596.075) * (-596.896) (-596.599) [-598.249] (-596.130) -- 0:00:07
374000 -- (-595.504) [-594.861] (-597.587) (-596.364) * [-595.703] (-596.221) (-596.120) (-599.207) -- 0:00:07
374500 -- (-595.683) [-596.158] (-596.354) (-598.813) * [-597.278] (-597.457) (-596.347) (-598.332) -- 0:00:07
375000 -- (-595.562) [-595.239] (-596.945) (-596.718) * (-595.927) (-600.856) [-598.433] (-595.127) -- 0:00:07
Average standard deviation of split frequencies: 0.014557
375500 -- (-597.699) (-596.342) [-595.525] (-598.909) * (-596.283) (-596.251) [-596.000] (-596.693) -- 0:00:07
376000 -- [-599.487] (-596.789) (-599.854) (-603.998) * [-595.410] (-594.994) (-596.805) (-595.885) -- 0:00:07
376500 -- (-598.987) (-595.514) (-595.423) [-595.794] * (-595.777) (-595.904) [-594.956] (-595.733) -- 0:00:07
377000 -- (-597.570) (-596.187) (-595.937) [-606.408] * (-595.402) (-597.721) (-596.918) [-597.223] -- 0:00:07
377500 -- (-597.300) (-595.040) [-598.711] (-597.215) * (-608.550) (-597.215) [-598.334] (-596.867) -- 0:00:07
378000 -- (-603.183) (-595.964) (-596.666) [-595.291] * (-597.840) (-596.193) (-596.584) [-594.798] -- 0:00:07
378500 -- (-600.585) (-596.203) [-595.450] (-595.771) * (-598.044) (-599.739) [-596.332] (-597.146) -- 0:00:07
379000 -- (-596.572) (-599.885) (-599.045) [-595.510] * (-602.495) (-596.467) [-599.318] (-597.642) -- 0:00:07
379500 -- (-595.270) [-596.353] (-599.527) (-596.055) * [-596.737] (-596.010) (-599.271) (-595.411) -- 0:00:07
380000 -- [-596.457] (-598.262) (-602.784) (-595.665) * (-599.817) [-597.960] (-599.017) (-596.520) -- 0:00:07
Average standard deviation of split frequencies: 0.014078
380500 -- (-597.644) (-598.916) (-596.105) [-596.455] * (-595.526) (-598.582) (-596.140) [-596.533] -- 0:00:07
381000 -- (-598.303) (-597.118) (-595.846) [-598.596] * (-596.200) (-596.382) (-596.168) [-595.028] -- 0:00:07
381500 -- (-598.286) [-595.834] (-599.025) (-596.539) * (-603.717) (-597.701) [-594.859] (-594.876) -- 0:00:07
382000 -- [-597.626] (-598.010) (-599.930) (-595.622) * (-597.695) [-595.888] (-603.338) (-596.280) -- 0:00:07
382500 -- (-596.939) [-595.029] (-595.001) (-596.125) * [-596.150] (-595.400) (-599.323) (-595.971) -- 0:00:07
383000 -- (-598.524) [-594.734] (-598.373) (-596.764) * (-596.285) (-595.430) (-600.377) [-594.762] -- 0:00:07
383500 -- (-594.837) (-594.816) (-595.330) [-596.594] * (-598.219) (-597.594) (-599.275) [-594.973] -- 0:00:06
384000 -- (-595.349) [-596.476] (-596.271) (-597.343) * (-596.824) (-595.988) [-595.249] (-595.103) -- 0:00:06
384500 -- (-597.785) (-597.550) (-596.267) [-595.778] * [-596.666] (-597.467) (-595.229) (-598.844) -- 0:00:06
385000 -- (-597.536) [-597.845] (-596.061) (-598.233) * (-595.655) [-595.311] (-596.663) (-600.823) -- 0:00:06
Average standard deviation of split frequencies: 0.014141
385500 -- (-596.316) (-598.249) (-594.810) [-597.687] * [-595.127] (-595.207) (-597.438) (-600.489) -- 0:00:06
386000 -- [-596.327] (-596.746) (-598.389) (-597.285) * (-595.104) (-597.751) (-598.012) [-597.796] -- 0:00:06
386500 -- (-595.496) (-598.902) [-595.395] (-598.771) * [-595.464] (-597.041) (-597.414) (-597.898) -- 0:00:06
387000 -- [-595.632] (-600.178) (-595.419) (-594.956) * [-595.058] (-596.351) (-599.094) (-601.727) -- 0:00:06
387500 -- [-597.259] (-596.004) (-595.500) (-595.161) * (-598.930) (-598.443) [-598.868] (-596.232) -- 0:00:06
388000 -- [-595.943] (-595.365) (-595.231) (-598.691) * (-600.686) (-598.954) (-598.004) [-595.653] -- 0:00:06
388500 -- (-595.248) (-596.190) (-596.734) [-597.701] * [-597.650] (-596.648) (-596.149) (-595.151) -- 0:00:06
389000 -- (-594.909) [-596.005] (-599.529) (-599.001) * (-599.000) (-597.695) [-597.137] (-597.551) -- 0:00:06
389500 -- (-601.055) (-598.252) [-598.739] (-595.303) * [-595.983] (-596.533) (-595.866) (-597.972) -- 0:00:06
390000 -- [-604.247] (-606.159) (-595.851) (-596.562) * (-599.773) [-598.236] (-598.618) (-598.758) -- 0:00:06
Average standard deviation of split frequencies: 0.014353
390500 -- [-598.622] (-597.936) (-597.032) (-597.024) * [-594.823] (-596.101) (-601.548) (-598.051) -- 0:00:06
391000 -- (-596.852) (-595.417) (-596.864) [-596.004] * (-594.830) (-596.768) [-596.984] (-600.386) -- 0:00:06
391500 -- (-599.384) [-597.066] (-599.608) (-596.320) * (-596.533) [-599.839] (-599.369) (-596.840) -- 0:00:06
392000 -- (-597.707) [-594.929] (-596.125) (-596.896) * [-595.379] (-597.066) (-596.262) (-595.232) -- 0:00:06
392500 -- [-596.831] (-596.100) (-596.716) (-603.055) * (-597.357) (-595.974) [-595.971] (-599.903) -- 0:00:06
393000 -- (-595.902) (-600.322) (-599.729) [-594.688] * (-599.507) (-598.037) (-597.931) [-597.012] -- 0:00:06
393500 -- (-599.149) (-596.810) [-595.400] (-598.152) * (-594.770) (-599.717) [-596.959] (-595.015) -- 0:00:06
394000 -- [-596.323] (-596.540) (-597.916) (-598.167) * (-596.240) (-598.098) (-595.937) [-595.865] -- 0:00:06
394500 -- [-596.017] (-596.515) (-597.454) (-598.512) * [-599.634] (-598.185) (-594.992) (-597.672) -- 0:00:06
395000 -- (-596.375) (-597.069) [-596.148] (-597.247) * (-596.069) (-597.853) [-595.540] (-598.939) -- 0:00:06
Average standard deviation of split frequencies: 0.015413
395500 -- (-596.652) (-600.271) (-598.131) [-596.705] * [-595.247] (-596.820) (-595.275) (-595.756) -- 0:00:06
396000 -- [-596.808] (-604.199) (-597.284) (-599.473) * (-596.499) (-596.157) (-599.390) [-595.272] -- 0:00:06
396500 -- [-599.332] (-603.534) (-599.606) (-602.332) * (-595.460) (-597.495) (-595.715) [-599.716] -- 0:00:06
397000 -- (-599.427) [-597.789] (-596.189) (-599.984) * (-599.404) [-594.895] (-595.369) (-595.732) -- 0:00:06
397500 -- (-599.772) [-597.341] (-595.447) (-598.103) * (-597.909) (-596.768) (-595.658) [-595.768] -- 0:00:06
398000 -- (-597.200) (-598.481) [-600.420] (-599.101) * [-598.216] (-595.766) (-598.139) (-599.583) -- 0:00:06
398500 -- (-599.968) (-600.083) [-597.689] (-598.421) * [-598.257] (-595.144) (-598.293) (-595.219) -- 0:00:06
399000 -- (-596.977) (-595.091) (-598.466) [-599.247] * (-599.336) (-597.757) (-596.433) [-598.592] -- 0:00:06
399500 -- [-597.124] (-596.135) (-600.215) (-595.590) * (-599.101) (-597.156) (-595.492) [-602.262] -- 0:00:06
400000 -- [-597.426] (-598.815) (-596.337) (-595.925) * (-596.116) [-600.679] (-596.028) (-597.479) -- 0:00:06
Average standard deviation of split frequencies: 0.016224
400500 -- [-600.394] (-598.875) (-600.121) (-598.345) * (-595.692) (-597.577) (-596.286) [-595.569] -- 0:00:05
401000 -- (-596.479) (-596.331) (-596.030) [-596.477] * (-596.744) (-596.638) [-595.311] (-599.365) -- 0:00:05
401500 -- [-595.513] (-595.262) (-595.552) (-598.393) * [-595.182] (-597.893) (-598.669) (-596.665) -- 0:00:05
402000 -- (-595.512) (-595.244) [-596.218] (-598.072) * [-595.330] (-596.908) (-600.264) (-596.049) -- 0:00:05
402500 -- (-597.379) (-595.997) [-597.073] (-597.003) * [-595.023] (-595.603) (-598.464) (-599.406) -- 0:00:05
403000 -- (-597.205) [-596.326] (-598.127) (-599.489) * (-595.993) [-594.920] (-600.488) (-598.085) -- 0:00:05
403500 -- [-596.628] (-594.810) (-596.348) (-595.988) * (-594.684) (-596.130) (-598.256) [-602.470] -- 0:00:05
404000 -- (-598.667) (-599.183) [-595.760] (-596.836) * (-596.451) [-601.054] (-595.878) (-598.935) -- 0:00:05
404500 -- [-595.165] (-595.865) (-602.071) (-597.019) * (-598.221) (-598.249) [-597.676] (-597.227) -- 0:00:05
405000 -- [-595.110] (-595.051) (-604.900) (-595.627) * [-594.964] (-599.129) (-596.113) (-598.238) -- 0:00:05
Average standard deviation of split frequencies: 0.016378
405500 -- (-596.815) [-596.505] (-599.279) (-596.393) * [-597.778] (-597.620) (-595.056) (-597.103) -- 0:00:05
406000 -- (-596.925) (-598.145) [-598.928] (-602.416) * (-597.496) (-597.082) (-595.730) [-596.771] -- 0:00:05
406500 -- (-595.555) [-596.293] (-599.057) (-602.943) * [-596.674] (-598.848) (-594.833) (-598.795) -- 0:00:05
407000 -- (-595.144) [-598.325] (-597.658) (-596.478) * [-599.729] (-598.991) (-596.462) (-599.924) -- 0:00:05
407500 -- [-597.529] (-597.272) (-600.315) (-595.853) * (-603.098) (-602.836) [-596.257] (-599.367) -- 0:00:05
408000 -- (-596.952) (-601.646) (-602.426) [-598.744] * (-600.987) (-596.084) [-598.848] (-597.473) -- 0:00:05
408500 -- [-598.105] (-600.931) (-597.181) (-597.323) * (-597.393) (-596.617) (-596.435) [-596.819] -- 0:00:05
409000 -- [-597.519] (-603.251) (-597.115) (-595.166) * [-595.838] (-595.234) (-597.885) (-595.802) -- 0:00:05
409500 -- (-598.897) (-595.902) (-597.470) [-601.166] * (-597.945) (-595.210) [-595.232] (-598.543) -- 0:00:05
410000 -- (-598.745) [-596.242] (-595.961) (-597.542) * (-602.069) (-595.425) [-598.346] (-599.446) -- 0:00:05
Average standard deviation of split frequencies: 0.015769
410500 -- (-598.936) (-594.688) (-596.026) [-595.427] * (-597.085) (-594.709) (-599.475) [-596.428] -- 0:00:05
411000 -- (-596.020) (-595.175) (-595.778) [-598.655] * [-599.410] (-596.805) (-601.639) (-595.902) -- 0:00:05
411500 -- (-596.372) [-597.831] (-603.958) (-596.739) * (-597.361) (-599.619) [-597.628] (-596.892) -- 0:00:05
412000 -- (-595.722) (-598.645) (-596.589) [-596.518] * (-595.351) (-600.860) (-600.821) [-595.159] -- 0:00:05
412500 -- (-595.813) [-596.978] (-597.563) (-595.395) * (-595.605) (-599.982) (-598.905) [-595.569] -- 0:00:05
413000 -- (-597.443) (-598.207) [-596.913] (-596.690) * (-594.948) (-596.114) (-598.667) [-596.335] -- 0:00:05
413500 -- (-596.746) (-596.938) [-596.896] (-597.914) * (-595.933) (-598.397) [-597.208] (-597.839) -- 0:00:05
414000 -- [-596.130] (-597.377) (-597.664) (-598.985) * [-601.553] (-596.806) (-600.436) (-599.381) -- 0:00:05
414500 -- [-594.778] (-599.411) (-596.357) (-597.638) * [-595.965] (-598.365) (-598.514) (-597.742) -- 0:00:05
415000 -- [-596.534] (-597.866) (-599.672) (-598.789) * (-598.085) [-599.490] (-596.832) (-600.217) -- 0:00:05
Average standard deviation of split frequencies: 0.015686
415500 -- [-598.917] (-596.052) (-595.537) (-598.641) * (-596.594) (-598.976) [-597.422] (-597.073) -- 0:00:05
416000 -- (-599.260) (-594.771) [-598.108] (-596.653) * (-601.763) (-595.407) [-597.788] (-600.024) -- 0:00:05
416500 -- (-596.417) (-599.642) [-596.263] (-595.302) * (-595.064) [-596.070] (-597.818) (-599.171) -- 0:00:05
417000 -- (-597.662) [-596.255] (-601.063) (-596.731) * (-596.081) (-596.565) [-596.401] (-595.959) -- 0:00:04
417500 -- (-598.260) (-596.743) [-596.351] (-595.580) * (-596.497) [-596.939] (-595.901) (-595.475) -- 0:00:04
418000 -- (-598.413) (-596.848) [-598.125] (-595.738) * (-595.806) (-600.056) [-595.341] (-596.900) -- 0:00:04
418500 -- [-597.090] (-599.341) (-597.332) (-595.008) * (-596.744) (-600.516) [-595.624] (-595.722) -- 0:00:04
419000 -- (-597.661) (-599.648) (-598.028) [-595.352] * (-595.928) (-594.998) [-596.510] (-597.137) -- 0:00:04
419500 -- (-595.514) (-596.722) (-598.017) [-595.524] * (-595.904) (-597.008) (-597.941) [-595.173] -- 0:00:04
420000 -- (-596.832) (-596.933) [-597.501] (-596.806) * (-595.435) (-596.581) (-599.873) [-595.883] -- 0:00:04
Average standard deviation of split frequencies: 0.015016
420500 -- (-595.622) (-601.565) [-596.921] (-596.088) * (-596.296) [-598.701] (-596.738) (-596.942) -- 0:00:04
421000 -- (-596.627) (-597.912) [-595.335] (-595.570) * (-599.104) (-599.998) (-596.882) [-595.492] -- 0:00:04
421500 -- (-595.601) (-600.049) (-594.961) [-596.404] * (-597.224) [-598.810] (-597.413) (-599.862) -- 0:00:04
422000 -- [-595.532] (-598.962) (-595.821) (-598.827) * (-595.196) (-595.837) [-597.125] (-596.425) -- 0:00:04
422500 -- (-595.474) (-596.588) (-595.143) [-596.846] * (-597.586) (-598.684) [-596.848] (-596.085) -- 0:00:04
423000 -- [-595.294] (-598.630) (-595.834) (-595.426) * (-599.129) (-597.469) [-597.207] (-596.745) -- 0:00:04
423500 -- (-596.219) (-596.506) [-596.698] (-596.653) * (-598.230) [-597.015] (-598.213) (-598.274) -- 0:00:04
424000 -- [-597.074] (-597.608) (-595.164) (-598.951) * (-599.401) [-598.021] (-596.363) (-599.184) -- 0:00:04
424500 -- (-597.469) (-596.234) [-595.038] (-600.955) * (-595.491) (-600.773) [-595.884] (-600.451) -- 0:00:04
425000 -- (-598.497) (-596.273) [-597.188] (-598.164) * (-595.611) (-597.170) (-595.891) [-596.288] -- 0:00:04
Average standard deviation of split frequencies: 0.015216
425500 -- (-609.288) [-596.186] (-597.005) (-596.414) * (-595.909) (-596.719) [-596.139] (-596.674) -- 0:00:04
426000 -- (-595.039) [-594.743] (-598.285) (-599.383) * (-598.425) [-599.958] (-595.742) (-596.096) -- 0:00:04
426500 -- (-595.039) [-596.434] (-601.985) (-597.316) * (-595.028) (-595.201) [-597.932] (-599.465) -- 0:00:04
427000 -- (-595.202) [-596.164] (-600.364) (-602.996) * (-597.937) (-597.568) [-595.140] (-596.043) -- 0:00:04
427500 -- (-598.357) [-596.303] (-599.760) (-597.118) * (-597.287) [-597.070] (-595.576) (-596.820) -- 0:00:04
428000 -- [-595.942] (-597.086) (-597.990) (-595.134) * (-597.948) (-595.824) [-598.937] (-601.708) -- 0:00:04
428500 -- (-598.142) [-596.454] (-597.189) (-597.533) * (-596.549) [-596.481] (-600.553) (-597.952) -- 0:00:04
429000 -- (-595.782) [-595.751] (-596.077) (-596.814) * [-596.432] (-596.560) (-597.383) (-597.146) -- 0:00:04
429500 -- (-597.091) [-599.240] (-601.193) (-595.586) * [-597.236] (-600.369) (-595.574) (-598.006) -- 0:00:04
430000 -- [-597.530] (-602.575) (-597.175) (-599.159) * (-595.391) (-597.886) [-596.566] (-600.359) -- 0:00:04
Average standard deviation of split frequencies: 0.014921
430500 -- (-599.198) (-601.452) (-596.004) [-598.821] * (-598.377) (-597.827) (-597.246) [-597.843] -- 0:00:04
431000 -- [-597.154] (-596.620) (-599.388) (-596.808) * [-596.704] (-597.649) (-597.452) (-597.565) -- 0:00:04
431500 -- (-595.746) (-598.749) [-595.594] (-595.828) * (-598.192) (-595.649) (-596.381) [-598.212] -- 0:00:04
432000 -- (-597.415) (-595.676) (-596.172) [-596.788] * (-600.258) (-596.498) (-597.630) [-597.231] -- 0:00:04
432500 -- [-596.884] (-598.176) (-596.375) (-598.106) * (-597.267) [-596.094] (-596.019) (-597.069) -- 0:00:04
433000 -- (-597.703) (-596.826) (-598.770) [-596.454] * (-597.254) (-600.127) (-596.400) [-596.208] -- 0:00:04
433500 -- (-597.681) (-596.429) [-596.695] (-596.525) * [-597.944] (-599.132) (-597.256) (-595.538) -- 0:00:03
434000 -- (-597.610) [-596.806] (-597.443) (-595.676) * [-597.079] (-599.031) (-598.953) (-595.543) -- 0:00:03
434500 -- (-595.163) (-595.690) (-596.492) [-596.666] * (-596.473) (-596.786) (-602.174) [-596.595] -- 0:00:03
435000 -- (-595.619) (-596.578) (-597.232) [-595.598] * (-596.767) (-596.773) [-596.688] (-599.869) -- 0:00:03
Average standard deviation of split frequencies: 0.014416
435500 -- (-597.160) [-595.253] (-597.875) (-600.812) * (-595.485) (-596.451) [-595.127] (-602.288) -- 0:00:03
436000 -- (-595.817) (-595.529) (-596.971) [-596.811] * (-598.019) (-596.595) [-597.262] (-607.860) -- 0:00:03
436500 -- [-596.000] (-596.424) (-595.665) (-597.762) * (-600.078) (-596.105) [-595.960] (-599.333) -- 0:00:03
437000 -- (-594.955) [-598.270] (-595.980) (-595.677) * (-601.977) [-596.281] (-595.021) (-597.108) -- 0:00:03
437500 -- (-595.242) (-596.788) [-595.222] (-596.592) * [-597.390] (-598.116) (-596.939) (-601.056) -- 0:00:03
438000 -- (-596.392) [-597.409] (-599.807) (-595.268) * (-597.099) (-597.624) [-596.716] (-597.783) -- 0:00:03
438500 -- [-596.052] (-598.388) (-595.982) (-595.644) * (-597.694) (-597.151) [-595.188] (-597.814) -- 0:00:03
439000 -- (-595.103) (-597.255) [-596.797] (-600.165) * [-596.060] (-596.336) (-597.676) (-595.440) -- 0:00:03
439500 -- [-595.093] (-595.799) (-594.921) (-600.820) * (-596.673) (-594.536) (-599.095) [-599.261] -- 0:00:03
440000 -- (-596.756) (-598.608) [-596.668] (-597.270) * (-595.161) (-595.730) [-598.585] (-594.917) -- 0:00:03
Average standard deviation of split frequencies: 0.013794
440500 -- [-596.505] (-595.744) (-595.613) (-599.643) * (-603.082) (-596.471) [-597.474] (-596.877) -- 0:00:03
441000 -- (-596.113) [-599.746] (-596.470) (-595.970) * [-597.630] (-598.388) (-597.582) (-599.620) -- 0:00:03
441500 -- (-597.927) (-598.912) (-595.007) [-595.284] * (-596.104) [-596.532] (-598.123) (-596.173) -- 0:00:03
442000 -- (-596.331) [-600.423] (-598.273) (-597.370) * [-596.491] (-596.109) (-595.836) (-596.861) -- 0:00:03
442500 -- (-597.994) (-597.530) (-597.347) [-595.864] * (-595.073) (-597.586) [-595.104] (-598.700) -- 0:00:03
443000 -- (-599.609) (-596.027) [-597.390] (-595.530) * [-595.307] (-596.238) (-595.933) (-597.537) -- 0:00:03
443500 -- (-596.414) [-596.815] (-596.117) (-596.022) * (-597.542) (-599.589) [-599.380] (-596.960) -- 0:00:03
444000 -- (-596.027) (-597.281) (-601.165) [-596.018] * (-598.099) (-598.956) (-597.428) [-595.935] -- 0:00:03
444500 -- (-601.918) (-598.959) (-597.600) [-595.727] * (-595.720) (-600.170) [-595.655] (-596.012) -- 0:00:03
445000 -- (-597.888) [-606.018] (-597.486) (-597.539) * (-597.305) [-597.078] (-595.926) (-595.956) -- 0:00:03
Average standard deviation of split frequencies: 0.013073
445500 -- [-596.496] (-603.668) (-595.925) (-597.338) * [-595.806] (-596.829) (-596.586) (-595.579) -- 0:00:03
446000 -- (-596.944) (-598.848) (-598.692) [-598.924] * [-597.178] (-596.214) (-595.066) (-595.736) -- 0:00:03
446500 -- (-595.128) (-598.893) [-597.971] (-596.633) * (-596.900) (-596.406) [-595.402] (-595.438) -- 0:00:03
447000 -- (-595.915) (-595.681) (-598.093) [-596.658] * (-597.118) (-594.727) (-597.209) [-597.035] -- 0:00:03
447500 -- (-597.279) (-600.283) (-600.054) [-597.608] * (-597.535) (-595.294) [-596.746] (-598.368) -- 0:00:03
448000 -- (-595.664) (-595.808) (-595.776) [-596.633] * (-598.157) (-595.680) [-598.088] (-599.609) -- 0:00:03
448500 -- [-595.915] (-597.348) (-596.580) (-599.554) * (-596.718) (-595.977) (-601.383) [-596.005] -- 0:00:03
449000 -- [-595.581] (-595.782) (-597.758) (-600.806) * (-597.810) [-597.083] (-598.424) (-596.491) -- 0:00:03
449500 -- (-599.469) (-595.062) [-602.925] (-600.943) * (-596.317) (-598.774) (-599.666) [-599.334] -- 0:00:03
450000 -- (-600.321) (-598.561) (-600.743) [-595.296] * (-596.356) (-595.782) (-597.890) [-595.145] -- 0:00:03
Average standard deviation of split frequencies: 0.014296
450500 -- (-596.839) (-596.386) [-597.565] (-595.536) * (-595.021) (-595.115) (-595.122) [-596.159] -- 0:00:02
451000 -- (-596.832) (-598.299) [-596.076] (-599.599) * [-596.471] (-598.685) (-594.657) (-597.013) -- 0:00:02
451500 -- (-600.466) (-597.500) (-598.358) [-597.093] * (-597.825) (-596.813) (-595.517) [-597.165] -- 0:00:02
452000 -- (-596.704) [-597.384] (-598.772) (-595.019) * [-595.615] (-597.396) (-597.315) (-596.191) -- 0:00:02
452500 -- (-598.055) (-594.803) (-598.471) [-595.902] * (-599.578) [-599.940] (-595.742) (-596.250) -- 0:00:02
453000 -- (-597.652) (-597.412) (-599.029) [-595.476] * (-597.948) (-603.713) [-597.360] (-600.064) -- 0:00:02
453500 -- (-596.843) [-595.586] (-598.749) (-602.508) * (-597.331) [-595.987] (-597.908) (-596.807) -- 0:00:02
454000 -- [-596.880] (-595.103) (-597.154) (-595.010) * (-599.842) [-597.834] (-595.877) (-597.713) -- 0:00:02
454500 -- (-596.400) (-597.793) (-602.111) [-594.560] * (-599.498) [-596.376] (-595.704) (-598.409) -- 0:00:02
455000 -- (-595.413) (-600.280) [-596.648] (-598.084) * (-597.391) [-596.813] (-597.878) (-598.662) -- 0:00:02
Average standard deviation of split frequencies: 0.013929
455500 -- [-594.926] (-597.253) (-602.050) (-598.714) * (-600.387) (-597.315) [-596.092] (-597.031) -- 0:00:02
456000 -- [-595.146] (-596.386) (-595.948) (-596.964) * [-599.461] (-597.482) (-600.524) (-597.483) -- 0:00:02
456500 -- (-597.429) [-600.674] (-597.042) (-595.691) * (-600.726) [-596.244] (-595.864) (-596.460) -- 0:00:02
457000 -- (-598.020) (-597.431) [-600.257] (-596.766) * (-601.208) [-596.145] (-598.082) (-596.910) -- 0:00:02
457500 -- (-602.984) (-598.114) (-597.635) [-598.723] * (-600.713) [-597.087] (-598.374) (-598.837) -- 0:00:02
458000 -- (-598.403) (-595.970) [-600.940] (-596.676) * (-600.676) [-594.757] (-595.289) (-596.861) -- 0:00:02
458500 -- (-602.913) (-598.288) [-596.501] (-600.758) * (-597.091) (-596.915) [-596.440] (-596.680) -- 0:00:02
459000 -- [-595.853] (-598.489) (-603.341) (-596.273) * (-596.939) (-597.027) [-596.530] (-598.295) -- 0:00:02
459500 -- (-595.315) (-599.100) [-597.963] (-596.677) * (-598.671) (-596.500) (-598.822) [-596.143] -- 0:00:02
460000 -- [-595.729] (-596.028) (-596.713) (-595.965) * (-597.308) (-597.485) [-595.063] (-601.227) -- 0:00:02
Average standard deviation of split frequencies: 0.013842
460500 -- (-595.081) [-600.154] (-598.243) (-596.122) * (-596.859) (-597.336) [-595.542] (-596.699) -- 0:00:02
461000 -- (-597.071) [-599.983] (-596.916) (-603.761) * (-595.175) (-599.256) [-597.034] (-597.356) -- 0:00:02
461500 -- [-595.592] (-596.367) (-596.538) (-602.658) * (-596.689) [-595.342] (-596.937) (-598.186) -- 0:00:02
462000 -- (-598.432) [-598.078] (-595.903) (-596.300) * (-600.429) (-597.310) (-598.354) [-596.748] -- 0:00:02
462500 -- (-596.083) (-597.451) (-595.534) [-595.609] * (-597.678) (-595.590) [-599.078] (-595.777) -- 0:00:02
463000 -- (-597.116) (-602.048) (-598.872) [-595.538] * (-597.632) [-595.008] (-604.319) (-595.013) -- 0:00:02
463500 -- (-597.206) (-599.594) [-595.229] (-596.695) * [-597.935] (-596.288) (-599.571) (-596.295) -- 0:00:02
464000 -- [-597.968] (-597.501) (-595.722) (-596.229) * [-597.082] (-598.113) (-597.624) (-595.578) -- 0:00:02
464500 -- (-599.407) (-598.510) [-597.575] (-602.414) * [-600.950] (-597.194) (-595.495) (-596.721) -- 0:00:02
465000 -- (-598.098) [-595.220] (-597.472) (-596.227) * (-597.421) (-595.602) [-594.896] (-599.475) -- 0:00:02
Average standard deviation of split frequencies: 0.014375
465500 -- (-596.524) [-597.779] (-598.256) (-598.634) * (-597.461) (-597.884) [-595.198] (-596.496) -- 0:00:02
466000 -- (-597.335) (-596.827) (-597.544) [-600.906] * (-597.530) (-594.973) (-597.341) [-596.248] -- 0:00:02
466500 -- (-597.957) [-596.231] (-595.344) (-602.502) * (-596.971) [-595.316] (-599.373) (-596.276) -- 0:00:02
467000 -- [-598.256] (-597.638) (-597.897) (-599.730) * [-601.174] (-596.805) (-595.429) (-595.825) -- 0:00:01
467500 -- (-600.532) (-594.813) (-595.921) [-598.783] * (-595.640) (-595.221) (-598.107) [-600.905] -- 0:00:01
468000 -- (-595.748) [-596.109] (-595.915) (-595.482) * (-599.688) [-594.813] (-597.933) (-600.484) -- 0:00:01
468500 -- [-595.877] (-596.728) (-596.600) (-594.975) * (-596.729) (-595.716) (-599.866) [-596.312] -- 0:00:01
469000 -- (-598.135) (-596.633) (-597.102) [-595.915] * (-599.586) [-596.214] (-597.610) (-598.438) -- 0:00:01
469500 -- (-597.451) [-597.862] (-597.618) (-598.647) * (-599.471) (-595.395) (-597.186) [-598.437] -- 0:00:01
470000 -- (-598.347) [-595.873] (-598.480) (-600.947) * (-596.990) [-595.656] (-596.306) (-598.659) -- 0:00:01
Average standard deviation of split frequencies: 0.014338
470500 -- [-595.582] (-594.960) (-595.937) (-596.597) * (-599.208) (-598.596) [-595.408] (-598.410) -- 0:00:01
471000 -- (-595.995) (-595.186) [-595.845] (-595.998) * (-595.433) (-597.243) [-597.086] (-600.046) -- 0:00:01
471500 -- (-597.387) (-596.645) [-595.652] (-595.766) * (-598.704) (-595.650) [-594.968] (-595.606) -- 0:00:01
472000 -- (-596.823) (-599.564) (-599.741) [-596.039] * (-601.489) [-595.093] (-595.625) (-594.704) -- 0:00:01
472500 -- [-597.373] (-596.304) (-596.419) (-596.814) * (-598.624) (-595.129) [-596.815] (-596.021) -- 0:00:01
473000 -- (-597.686) (-599.274) (-603.227) [-595.751] * (-595.626) (-595.566) (-597.211) [-596.540] -- 0:00:01
473500 -- (-597.107) [-598.956] (-598.807) (-595.755) * (-599.075) [-595.279] (-596.470) (-597.985) -- 0:00:01
474000 -- (-595.898) [-595.809] (-597.169) (-596.556) * (-595.024) (-596.498) (-595.390) [-598.365] -- 0:00:01
474500 -- (-596.445) (-598.391) [-596.340] (-596.612) * (-596.368) (-595.850) [-596.326] (-602.404) -- 0:00:01
475000 -- (-600.842) (-595.730) (-599.842) [-598.117] * (-595.989) (-598.468) (-595.559) [-597.299] -- 0:00:01
Average standard deviation of split frequencies: 0.014125
475500 -- (-596.733) [-602.009] (-597.130) (-596.335) * (-596.555) (-595.333) [-598.236] (-597.740) -- 0:00:01
476000 -- (-597.397) [-597.117] (-595.364) (-600.410) * (-599.097) [-596.052] (-598.039) (-595.993) -- 0:00:01
476500 -- (-598.599) [-597.161] (-596.192) (-595.760) * (-595.703) [-595.837] (-598.002) (-596.268) -- 0:00:01
477000 -- (-596.539) [-598.839] (-597.836) (-597.124) * (-596.103) (-598.496) [-597.521] (-598.141) -- 0:00:01
477500 -- (-598.042) [-597.579] (-597.190) (-596.430) * (-595.355) (-595.109) (-598.631) [-596.673] -- 0:00:01
478000 -- (-595.698) (-596.623) [-597.400] (-596.806) * (-597.317) (-596.366) (-599.619) [-597.052] -- 0:00:01
478500 -- [-597.513] (-595.240) (-597.046) (-597.908) * (-598.085) [-599.095] (-600.393) (-596.316) -- 0:00:01
479000 -- (-597.334) (-596.252) [-595.990] (-597.671) * (-601.444) (-600.592) (-598.909) [-596.815] -- 0:00:01
479500 -- [-599.244] (-595.256) (-596.507) (-598.969) * (-601.872) [-600.121] (-595.417) (-597.985) -- 0:00:01
480000 -- (-597.633) (-600.922) (-597.967) [-596.348] * (-598.163) (-595.776) [-595.508] (-594.816) -- 0:00:01
Average standard deviation of split frequencies: 0.013627
480500 -- (-596.364) (-597.159) [-596.197] (-595.636) * (-599.511) (-597.739) (-599.087) [-597.111] -- 0:00:01
481000 -- (-595.530) (-602.163) [-596.215] (-597.883) * [-598.107] (-599.007) (-601.451) (-599.162) -- 0:00:01
481500 -- [-597.390] (-595.974) (-596.558) (-595.800) * (-598.820) (-600.435) (-603.407) [-600.002] -- 0:00:01
482000 -- (-596.518) [-596.117] (-599.120) (-596.323) * [-598.677] (-600.428) (-597.296) (-599.156) -- 0:00:01
482500 -- (-597.118) [-598.040] (-598.031) (-597.949) * (-596.536) (-598.008) (-597.353) [-596.130] -- 0:00:01
483000 -- [-598.354] (-595.669) (-598.368) (-599.553) * (-600.191) (-600.712) [-597.919] (-599.589) -- 0:00:01
483500 -- (-597.642) (-595.148) (-597.829) [-596.428] * [-595.846] (-596.130) (-596.300) (-603.866) -- 0:00:00
484000 -- (-600.217) [-596.543] (-599.665) (-597.491) * [-595.849] (-596.743) (-595.702) (-597.646) -- 0:00:00
484500 -- (-600.556) (-597.666) (-596.898) [-597.943] * (-599.665) (-598.036) [-597.903] (-598.868) -- 0:00:00
485000 -- (-605.894) [-598.041] (-594.922) (-600.739) * [-598.190] (-600.874) (-597.983) (-599.459) -- 0:00:00
Average standard deviation of split frequencies: 0.013477
485500 -- (-596.747) (-596.851) (-596.411) [-597.582] * (-601.039) (-597.487) [-597.062] (-597.298) -- 0:00:00
486000 -- (-596.464) (-597.513) (-597.435) [-594.883] * (-597.486) [-595.676] (-601.907) (-598.782) -- 0:00:00
486500 -- (-595.318) (-601.598) (-600.636) [-594.900] * (-595.824) (-595.568) (-597.436) [-595.813] -- 0:00:00
487000 -- (-596.432) (-607.916) (-598.528) [-595.475] * (-599.252) (-597.037) (-596.014) [-597.254] -- 0:00:00
487500 -- (-599.391) (-599.326) [-598.229] (-597.612) * [-595.440] (-598.097) (-595.260) (-598.093) -- 0:00:00
488000 -- (-596.610) [-599.237] (-600.376) (-595.186) * (-595.381) (-600.567) (-597.596) [-595.080] -- 0:00:00
488500 -- [-596.386] (-598.453) (-597.145) (-596.206) * (-595.744) (-595.319) [-595.646] (-595.068) -- 0:00:00
489000 -- (-598.086) (-596.971) (-602.816) [-596.152] * (-596.090) (-600.594) (-604.151) [-599.116] -- 0:00:00
489500 -- [-597.724] (-603.326) (-598.802) (-598.280) * [-596.033] (-599.672) (-603.155) (-596.046) -- 0:00:00
490000 -- [-597.118] (-597.400) (-595.959) (-600.052) * (-596.295) [-598.182] (-596.096) (-595.411) -- 0:00:00
Average standard deviation of split frequencies: 0.013653
490500 -- (-595.895) (-596.532) [-597.648] (-601.327) * (-594.722) [-596.009] (-598.866) (-598.207) -- 0:00:00
491000 -- (-598.210) (-595.503) [-598.059] (-596.143) * [-598.002] (-596.821) (-594.873) (-598.397) -- 0:00:00
491500 -- (-596.821) (-595.928) (-595.665) [-596.138] * (-599.418) [-596.533] (-596.847) (-595.766) -- 0:00:00
492000 -- (-597.178) (-595.720) (-598.657) [-596.216] * (-598.137) (-603.350) (-595.375) [-594.902] -- 0:00:00
492500 -- (-596.966) [-596.630] (-595.780) (-596.422) * (-600.053) (-595.827) (-595.445) [-595.528] -- 0:00:00
493000 -- (-598.297) (-597.790) (-596.519) [-597.944] * [-598.268] (-597.728) (-597.344) (-595.875) -- 0:00:00
493500 -- (-598.409) (-599.619) (-597.153) [-597.408] * (-596.545) (-597.168) (-596.884) [-597.175] -- 0:00:00
494000 -- (-597.282) (-597.208) [-595.650] (-596.332) * (-595.279) (-597.226) [-595.660] (-601.010) -- 0:00:00
494500 -- (-596.452) [-597.844] (-600.093) (-596.049) * (-596.701) (-599.926) [-596.766] (-599.273) -- 0:00:00
495000 -- [-596.917] (-597.110) (-600.301) (-598.945) * (-599.486) (-596.660) [-595.392] (-596.867) -- 0:00:00
Average standard deviation of split frequencies: 0.013456
495500 -- (-595.418) (-598.214) (-598.226) [-598.601] * (-595.319) (-600.579) (-598.607) [-596.123] -- 0:00:00
496000 -- (-597.416) (-595.523) [-597.080] (-596.043) * [-599.814] (-599.231) (-595.961) (-595.861) -- 0:00:00
496500 -- (-595.305) [-599.930] (-597.053) (-596.952) * [-599.569] (-602.522) (-596.639) (-596.656) -- 0:00:00
497000 -- (-596.403) (-600.250) [-595.631] (-596.113) * (-598.920) (-597.469) [-595.563] (-597.876) -- 0:00:00
497500 -- (-596.303) (-596.621) (-600.630) [-597.504] * (-596.002) (-601.528) (-595.082) [-596.500] -- 0:00:00
498000 -- (-596.642) [-597.545] (-601.796) (-601.200) * (-596.726) (-599.776) (-595.891) [-599.142] -- 0:00:00
498500 -- (-605.209) (-599.103) [-595.590] (-598.908) * [-595.182] (-597.663) (-596.533) (-597.515) -- 0:00:00
499000 -- (-597.671) (-598.276) [-596.705] (-594.869) * (-598.621) [-600.290] (-598.589) (-600.302) -- 0:00:00
499500 -- (-601.868) (-595.958) (-596.745) [-596.339] * [-598.973] (-598.338) (-596.699) (-596.911) -- 0:00:00
500000 -- [-598.572] (-598.481) (-598.516) (-596.762) * (-598.676) (-599.928) [-595.843] (-597.643) -- 0:00:00
Average standard deviation of split frequencies: 0.013430
Analysis completed in 30 seconds
Analysis used 29.92 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -594.50
Likelihood of best state for "cold" chain of run 2 was -594.50
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
80.0 % ( 80 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
37.9 % ( 36 %) Dirichlet(Pi{all})
40.3 % ( 40 %) Slider(Pi{all})
88.4 % ( 76 %) Multiplier(Alpha{1,2})
88.1 % ( 84 %) Multiplier(Alpha{3})
22.6 % ( 28 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 82 %) ParsSPR(Tau{all},V{all})
30.8 % ( 20 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
35.2 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.2 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.9 % ( 29 %) Dirichlet(Pi{all})
39.3 % ( 24 %) Slider(Pi{all})
88.2 % ( 82 %) Multiplier(Alpha{1,2})
87.9 % ( 80 %) Multiplier(Alpha{3})
22.3 % ( 17 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.8 % ( 88 %) ParsSPR(Tau{all},V{all})
30.6 % ( 25 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
35.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83250 0.82 0.67
3 | 83505 83401 0.84
4 | 83386 83163 83295
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83322 0.82 0.67
3 | 83363 83463 0.84
4 | 83573 83454 82825
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -595.61
| 2 |
| |
| 1 12 |
| 2 1 1 2 |
|2 1 2 1 1 11 2 1 1 |
| 22 2 1222 22 1 21 1 12 2 2 |
| 1 1 2 1 1 2 1 1 1 121 12 1 |
| 2 1 11 1 2 2 * 2 2 21 2 2 2 2 2 1 |
| 1 1 2 112 222 2 2 1* 1 22 2 2 1|
|1 1 2 1 12 11 1 2 2 2 12|
| 1 1 1 1 |
| 2 2 1 2 2 1 1 |
| 2 2 |
| 1 |
| 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -598.40
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -596.23 -600.65
2 -596.19 -600.29
--------------------------------------
TOTAL -596.21 -600.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889164 0.091286 0.355571 1.483168 0.857933 546.36 621.12 1.000
r(A<->C){all} 0.167915 0.018904 0.000019 0.426497 0.136796 38.95 80.71 1.000
r(A<->G){all} 0.158349 0.017101 0.000100 0.413039 0.126857 34.53 105.50 1.001
r(A<->T){all} 0.161860 0.019524 0.000121 0.437717 0.126476 39.52 81.99 0.999
r(C<->G){all} 0.162326 0.020246 0.000109 0.455923 0.122942 46.36 76.49 0.999
r(C<->T){all} 0.180802 0.020469 0.000681 0.464706 0.141402 66.68 72.51 1.000
r(G<->T){all} 0.168749 0.019825 0.000113 0.465463 0.133746 60.62 80.77 0.999
pi(A){all} 0.225901 0.000399 0.187579 0.265320 0.225244 644.68 696.73 1.000
pi(C){all} 0.238156 0.000391 0.200462 0.275523 0.238093 641.44 696.22 0.999
pi(G){all} 0.334114 0.000469 0.294082 0.377732 0.333901 615.09 661.00 1.000
pi(T){all} 0.201829 0.000368 0.165622 0.238908 0.201419 541.26 571.19 1.000
alpha{1,2} 0.420462 0.214331 0.000256 1.313220 0.254164 380.55 448.93 1.000
alpha{3} 0.454315 0.222031 0.000503 1.416407 0.303629 398.74 428.73 1.001
pinvar{all} 0.996136 0.000024 0.986595 0.999997 0.997810 507.04 586.56 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ....**
9 -- .***.*
10 -- .*..*.
11 -- ..**..
12 -- .*.***
13 -- .**...
14 -- .**.**
15 -- .*...*
16 -- .****.
17 -- .*.*..
18 -- ..*.*.
19 -- ..****
20 -- ...*.*
21 -- ...**.
22 -- .*..**
23 -- .***..
24 -- ..**.*
25 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 257 0.171105 0.008474 0.165113 0.177097 2
8 225 0.149800 0.021656 0.134487 0.165113 2
9 225 0.149800 0.006591 0.145140 0.154461 2
10 225 0.149800 0.000942 0.149134 0.150466 2
11 223 0.148469 0.006591 0.143808 0.153129 2
12 221 0.147137 0.008474 0.141145 0.153129 2
13 219 0.145806 0.027305 0.126498 0.165113 2
14 218 0.145140 0.009416 0.138482 0.151798 2
15 211 0.140479 0.006591 0.135819 0.145140 2
16 211 0.140479 0.000942 0.139814 0.141145 2
17 206 0.137150 0.018831 0.123835 0.150466 2
18 201 0.133822 0.025422 0.115846 0.151798 2
19 200 0.133156 0.030130 0.111851 0.154461 2
20 195 0.129827 0.004708 0.126498 0.133156 2
21 192 0.127830 0.020714 0.113182 0.142477 2
22 148 0.098535 0.009416 0.091877 0.105193 2
23 147 0.097870 0.017890 0.085220 0.110519 2
24 145 0.096538 0.014123 0.086551 0.106525 2
25 140 0.093209 0.016948 0.081225 0.105193 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096213 0.009764 0.000088 0.285706 0.066882 1.000 2
length{all}[2] 0.096630 0.009329 0.000070 0.290576 0.066386 1.000 2
length{all}[3] 0.102826 0.011041 0.000041 0.314996 0.069740 1.001 2
length{all}[4] 0.100359 0.009376 0.000070 0.299697 0.072296 1.001 2
length{all}[5] 0.096862 0.008960 0.000022 0.295070 0.067821 0.999 2
length{all}[6] 0.099270 0.009127 0.000005 0.292303 0.070334 1.000 2
length{all}[7] 0.091664 0.007350 0.000124 0.250774 0.070086 0.998 2
length{all}[8] 0.094277 0.008490 0.000274 0.269760 0.062858 1.009 2
length{all}[9] 0.095719 0.008761 0.000044 0.245429 0.065497 1.011 2
length{all}[10] 0.096766 0.008577 0.000325 0.265825 0.067464 1.000 2
length{all}[11] 0.109235 0.014403 0.000142 0.347127 0.072072 1.000 2
length{all}[12] 0.089068 0.009172 0.000731 0.287552 0.059634 0.997 2
length{all}[13] 0.085132 0.007455 0.000491 0.253119 0.059880 0.998 2
length{all}[14] 0.106836 0.011178 0.001091 0.292373 0.075756 1.065 2
length{all}[15] 0.101342 0.010630 0.000787 0.320222 0.070411 1.033 2
length{all}[16] 0.108023 0.012616 0.000827 0.313311 0.070062 1.002 2
length{all}[17] 0.100411 0.012633 0.000509 0.325418 0.065725 1.009 2
length{all}[18] 0.099865 0.011302 0.000165 0.300955 0.064950 1.006 2
length{all}[19] 0.093761 0.009773 0.000164 0.306794 0.062948 0.998 2
length{all}[20] 0.098777 0.009700 0.000017 0.281542 0.071514 0.995 2
length{all}[21] 0.103215 0.012611 0.000344 0.305614 0.074143 1.004 2
length{all}[22] 0.100042 0.008612 0.000047 0.289182 0.072679 0.994 2
length{all}[23] 0.108855 0.011690 0.001024 0.318255 0.080487 0.993 2
length{all}[24] 0.076730 0.005060 0.000416 0.215123 0.062480 1.003 2
length{all}[25] 0.108559 0.010331 0.000413 0.318395 0.084095 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.013430
Maximum standard deviation of split frequencies = 0.030130
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.005
Maximum PSRF for parameter values = 1.065
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 435
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 145 / 145 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 145 / 145 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.020034 0.030366 0.086145 0.073965 0.025062 0.038631 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -607.879495
Iterating by ming2
Initial: fx= 607.879495
x= 0.02003 0.03037 0.08615 0.07397 0.02506 0.03863 0.30000 1.30000
1 h-m-p 0.0000 0.0001 347.9562 ++ 590.858077 m 0.0001 13 | 1/8
2 h-m-p 0.0160 8.0000 26.6208 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 318.5244 ++ 587.278851 m 0.0000 46 | 2/8
4 h-m-p 0.0160 8.0000 24.1767 -------------.. | 2/8
5 h-m-p 0.0000 0.0000 284.8193 ++ 584.257062 m 0.0000 79 | 3/8
6 h-m-p 0.0160 8.0000 19.3809 -------------.. | 3/8
7 h-m-p 0.0000 0.0001 246.4883 ++ 580.724033 m 0.0001 112 | 4/8
8 h-m-p 0.0160 8.0000 14.4834 -------------.. | 4/8
9 h-m-p 0.0000 0.0003 201.0434 +++ 570.582651 m 0.0003 146 | 5/8
10 h-m-p 0.0160 8.0000 10.5810 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 142.9442 ++ 568.815081 m 0.0001 179 | 6/8
12 h-m-p 0.7263 8.0000 0.0000 ++ 568.815081 m 8.0000 190 | 6/8
13 h-m-p 0.2166 8.0000 0.0001 +++ 568.815081 m 8.0000 204 | 6/8
14 h-m-p 0.0160 8.0000 0.0622 +++C 568.815081 0 1.0406 220 | 6/8
15 h-m-p 1.6000 8.0000 0.0020 Y 568.815081 0 0.9329 233 | 6/8
16 h-m-p 1.6000 8.0000 0.0002 C 568.815081 0 0.4103 246 | 6/8
17 h-m-p 1.6000 8.0000 0.0000 ------C 568.815081 0 0.0001 265
Out..
lnL = -568.815081
266 lfun, 266 eigenQcodon, 1596 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042184 0.045025 0.029677 0.063209 0.080683 0.010599 0.332922 0.793743 0.225953
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.148775
np = 9
lnL0 = -606.491595
Iterating by ming2
Initial: fx= 606.491595
x= 0.04218 0.04502 0.02968 0.06321 0.08068 0.01060 0.33292 0.79374 0.22595
1 h-m-p 0.0000 0.0001 328.6921 ++ 597.971643 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0005 183.2986 ++ 584.605254 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0000 1210.7886 ++ 577.926271 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 186.7141 ++ 576.543972 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 9294.7773 ++ 572.307718 m 0.0000 62 | 5/9
6 h-m-p 0.0012 0.0059 6.5786 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 200.1366 ++ 571.223275 m 0.0000 95 | 6/9
8 h-m-p 0.0045 1.1163 0.8431 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 142.0370 ++ 568.815118 m 0.0001 132 | 7/9
10 h-m-p 0.9520 8.0000 0.0000 ++ 568.815118 m 8.0000 144 | 6/9
11 h-m-p 0.3604 8.0000 0.0001 +++ 568.815118 m 8.0000 159 | 6/9
12 h-m-p 0.0021 0.0103 0.0860 -------Y 568.815118 0 0.0000 181 | 6/9
13 h-m-p 0.0160 8.0000 0.0026 +++++ 568.815117 m 8.0000 199 | 6/9
14 h-m-p 0.0571 2.6883 0.3641 +++ 568.815085 m 2.6883 215 | 7/9
15 h-m-p 0.8281 8.0000 0.0147 ++ 568.815083 m 8.0000 230 | 7/9
16 h-m-p 0.1073 1.4837 1.0962 ++ 568.815062 m 1.4837 244 | 7/9
17 h-m-p 0.0000 0.0000 0.9074
h-m-p: 0.00000000e+00 0.00000000e+00 9.07424200e-01 568.815062
.. | 7/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 568.815062 m 8.0000 270 | 7/9
19 h-m-p 0.0160 8.0000 0.1112 -------C 568.815062 0 0.0000 291 | 7/9
20 h-m-p 0.0160 8.0000 0.0001 +++++ 568.815062 m 8.0000 308 | 7/9
21 h-m-p 0.0160 8.0000 0.8314 +++++ 568.815043 m 8.0000 325 | 7/9
22 h-m-p 1.6000 8.0000 1.0738 ++ 568.815038 m 8.0000 339 | 7/9
23 h-m-p 1.6000 8.0000 5.1714 ++ 568.815033 m 8.0000 351 | 7/9
24 h-m-p 1.6000 8.0000 5.4415 ++ 568.815033 m 8.0000 363 | 7/9
25 h-m-p 1.6000 8.0000 20.0492 ++ 568.815032 m 8.0000 375 | 7/9
26 h-m-p 1.6000 8.0000 0.0000 Y 568.815032 0 1.6000 387 | 7/9
27 h-m-p 0.0160 8.0000 0.0000 -C 568.815032 0 0.0014 402
Out..
lnL = -568.815032
403 lfun, 1209 eigenQcodon, 4836 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098283 0.036539 0.022501 0.032345 0.073833 0.098710 262.576039 1.127525 0.504638 0.436749 1.298334
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.076194
np = 11
lnL0 = -618.064975
Iterating by ming2
Initial: fx= 618.064975
x= 0.09828 0.03654 0.02250 0.03235 0.07383 0.09871 262.57604 1.12752 0.50464 0.43675 1.29833
1 h-m-p 0.0000 0.0002 322.7810 +++ 600.380853 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0008 105.1149 ++ 592.625865 m 0.0008 31 | 2/11
3 h-m-p 0.0000 0.0000 1911.2277 ++ 590.185223 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0001 2658.9851 ++ 574.460951 m 0.0001 59 | 4/11
5 h-m-p 0.0000 0.0000 2493.5934 ++ 571.223497 m 0.0000 73 | 5/11
6 h-m-p 0.0309 8.0000 1.1508 --------------.. | 5/11
7 h-m-p 0.0000 0.0001 197.7901 ++ 568.860307 m 0.0001 113 | 6/11
8 h-m-p 0.0160 8.0000 1.1668 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 142.0458 ++ 568.815053 m 0.0000 152 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 --N 568.815053 0 0.0003 168 | 6/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 568.815053 m 8.0000 189 | 6/11
12 h-m-p 0.0015 0.0074 0.0692 --------N 568.815053 0 0.0000 216 | 6/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 568.815053 m 8.0000 238 | 6/11
14 h-m-p 0.0018 0.8833 0.9602 +++++ 568.815041 m 0.8833 260 | 6/11
15 h-m-p -0.0000 -0.0000 0.5581
h-m-p: -0.00000000e+00 -0.00000000e+00 5.58139726e-01 568.815041
.. | 6/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 568.815041 m 8.0000 298 | 6/11
17 h-m-p 0.0021 1.0540 0.5486 +++++ 568.815030 m 1.0540 320 | 7/11
18 h-m-p 1.0445 8.0000 0.2738 ++ 568.815020 m 8.0000 339 | 7/11
19 h-m-p 1.0622 8.0000 2.0622 Y 568.815017 0 1.0622 357 | 7/11
20 h-m-p 1.6000 8.0000 0.4577 C 568.815017 0 2.2029 371 | 7/11
21 h-m-p 1.6000 8.0000 0.1110 Y 568.815017 0 1.1078 389 | 7/11
22 h-m-p 1.6000 8.0000 0.0020 ++ 568.815017 m 8.0000 407 | 7/11
23 h-m-p 0.2974 8.0000 0.0527 +Y 568.815017 0 2.2689 426 | 7/11
24 h-m-p 1.6000 8.0000 0.0007 ++ 568.815017 m 8.0000 444 | 7/11
25 h-m-p 0.0059 2.9623 43.2342 +++++ 568.814992 m 2.9623 465 | 7/11
26 h-m-p -0.0000 -0.0000 0.1363
h-m-p: -0.00000000e+00 -0.00000000e+00 1.36271494e-01 568.814992
.. | 7/11
27 h-m-p 0.0160 8.0000 0.0000 C 568.814992 0 0.0040 494 | 7/11
28 h-m-p 0.0160 8.0000 0.0000 -N 568.814992 0 0.0010 513
Out..
lnL = -568.814992
514 lfun, 2056 eigenQcodon, 9252 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -568.811762 S = -568.811660 -0.000039
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:05
did 20 / 47 patterns 0:05
did 30 / 47 patterns 0:05
did 40 / 47 patterns 0:05
did 47 / 47 patterns 0:05
Time used: 0:05
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010695 0.040048 0.079517 0.059277 0.104347 0.057037 262.563250 0.778209 0.085573 0.620806 1.306984 2.232077
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 0.055137
np = 12
lnL0 = -615.584295
Iterating by ming2
Initial: fx= 615.584295
x= 0.01070 0.04005 0.07952 0.05928 0.10435 0.05704 262.56325 0.77821 0.08557 0.62081 1.30698 2.23208
1 h-m-p 0.0000 0.0001 311.8519 ++ 607.552494 m 0.0001 17 | 1/12
2 h-m-p 0.0003 0.0051 77.5762 +++ 580.553624 m 0.0051 33 | 2/12
3 h-m-p 0.0000 0.0000 108117.2724 ++ 573.810349 m 0.0000 48 | 3/12
4 h-m-p 0.0001 0.0003 162.8912 ++ 573.243791 m 0.0003 63 | 4/12
5 h-m-p 0.0000 0.0000 865245.2237 ++ 571.997704 m 0.0000 78 | 5/12
6 h-m-p 0.0006 0.0028 12.2872 -----------.. | 5/12
7 h-m-p 0.0000 0.0000 194.1706 ++ 570.411734 m 0.0000 117 | 6/12
8 h-m-p 0.0160 8.0000 1.3379 -------------.. | 6/12
9 h-m-p 0.0000 0.0001 138.6155 ++ 568.815035 m 0.0001 158 | 7/12
10 h-m-p 0.0385 8.0000 0.0000 ++++ 568.815035 m 8.0000 175 | 7/12
11 h-m-p 0.0160 8.0000 0.0402 +++++ 568.815030 m 8.0000 198 | 7/12
12 h-m-p 0.2366 8.0000 1.3600 +++ 568.815002 m 8.0000 219 | 7/12
13 h-m-p 1.6000 8.0000 0.5753 ++ 568.814999 m 8.0000 234 | 7/12
14 h-m-p 0.9283 7.6630 4.9578 ++ 568.814994 m 7.6630 254 | 7/12
15 h-m-p -0.0000 -0.0000 4.2274
h-m-p: -8.41319787e-17 -4.20659894e-16 4.22742609e+00 568.814994
.. | 7/12
16 h-m-p 0.0160 8.0000 0.0000 Y 568.814994 0 0.0160 281 | 7/12
17 h-m-p 0.0655 8.0000 0.0000 --------Y 568.814994 0 0.0000 309
Out..
lnL = -568.814994
310 lfun, 1240 eigenQcodon, 5580 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028797 0.106095 0.086708 0.088445 0.050760 0.084251 262.549469 0.911353 1.440358
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.113119
np = 9
lnL0 = -628.792055
Iterating by ming2
Initial: fx= 628.792055
x= 0.02880 0.10609 0.08671 0.08845 0.05076 0.08425 262.54947 0.91135 1.44036
1 h-m-p 0.0000 0.0002 313.8047 +++ 606.795334 m 0.0002 15 | 1/9
2 h-m-p 0.0029 0.0420 21.8231 +YCYCYC 606.760750 5 0.0199 35 | 1/9
3 h-m-p 0.0005 0.0027 181.2193 YC 606.760583 1 0.0001 48 | 1/9
4 h-m-p 1.0700 8.0000 0.0133 ----------------.. | 1/9
5 h-m-p 0.0000 0.0003 291.9405 +++ 578.386706 m 0.0003 95 | 2/9
6 h-m-p 0.0104 0.0874 8.0664 -------------.. | 2/9
7 h-m-p 0.0000 0.0001 279.2375 ++ 570.410786 m 0.0001 130 | 3/9
8 h-m-p 0.0055 0.4795 4.4714 ------------.. | 3/9
9 h-m-p 0.0000 0.0000 246.9224 ++ 569.989020 m 0.0000 164 | 4/9
10 h-m-p 0.0014 0.6786 5.2448 -----------.. | 4/9
11 h-m-p 0.0000 0.0000 201.6809 ++ 569.791387 m 0.0000 197 | 5/9
12 h-m-p 0.0018 0.8884 4.1235 ------------.. | 5/9
13 h-m-p 0.0000 0.0000 142.3773 ++ 568.815081 m 0.0000 231 | 6/9
14 h-m-p 0.3928 8.0000 0.0000 +++ 568.815081 m 8.0000 244 | 6/9
15 h-m-p 0.0324 8.0000 0.0005 ----C 568.815081 0 0.0000 263
Out..
lnL = -568.815081
264 lfun, 2904 eigenQcodon, 15840 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021596 0.044875 0.089621 0.077557 0.093163 0.089298 262.549494 0.900000 0.465628 1.639010 1.241612
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.123964
np = 11
lnL0 = -622.924035
Iterating by ming2
Initial: fx= 622.924035
x= 0.02160 0.04487 0.08962 0.07756 0.09316 0.08930 262.54949 0.90000 0.46563 1.63901 1.24161
1 h-m-p 0.0000 0.0002 294.5052 +++ 607.492342 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0008 157.6841 ++ 591.583019 m 0.0008 31 | 2/11
3 h-m-p 0.0000 0.0001 1033.7601 ++ 573.963828 m 0.0001 45 | 3/11
4 h-m-p 0.0026 0.0128 26.5165 ++ 569.898061 m 0.0128 59 | 4/11
5 h-m-p 0.0000 0.0000 12974.0081 ++ 569.746629 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 231349.7513 ++ 569.031175 m 0.0000 87 | 5/11
7 h-m-p 0.0014 0.0072 153.3870 -----------.. | 5/11
8 h-m-p 0.0000 0.0000 140.9727 ++ 568.815032 m 0.0000 124 | 6/11
9 h-m-p 0.0001 0.0006 0.0000 Y 568.815032 0 0.0001 138
Out..
lnL = -568.815032
139 lfun, 1668 eigenQcodon, 9174 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -568.820532 S = -568.812694 -0.003436
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:13
did 20 / 47 patterns 0:13
did 30 / 47 patterns 0:14
did 40 / 47 patterns 0:14
did 47 / 47 patterns 0:14
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=145
NC_011896_1_WP_010908838_1_2491_MLBR_RS11865 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
NC_002677_1_NP_302518_1_1390_ML2332 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP
**************************************************
NC_011896_1_WP_010908838_1_2491_MLBR_RS11865 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
NC_002677_1_NP_302518_1_1390_ML2332 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135 GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG
**************************************************
NC_011896_1_WP_010908838_1_2491_MLBR_RS11865 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
NC_002677_1_NP_302518_1_1390_ML2332 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135 SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
*********************************************
>NC_011896_1_WP_010908838_1_2491_MLBR_RS11865 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC >NC_002677_1_NP_302518_1_1390_ML2332 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC >NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC >NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC >NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC >NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135 ATGGGACCGGTGAGCGCAGTCAGCACAATCTTGGTCAATGTTGAGCCCGT AGCCACGCTTGCTGCGGTAGCGGACTATCAGAAGATGCGCCCGAAAATTT TATCACCGCAGTATAACGAGTATCAGGTGGTGCAGGGCGGTCAAGGGCCG GGCACCGTCGTGAAGTGGAAGTTGCAGGTCACCAGATCACGTGTTCGCGA TGTGCAGGTCAACGTTGATGTCGCTGGCCACACCGTCATTGAGAAGGATG CGAACTCGTCGATGGTAACTAGCTGGACGGTTGCTCCTGCGGGACCGGGA TCCAGCGTGACGATGAAGACGGCCTGGACCGGTGCGGGCGGTGTCAAAGG CTTTTTTGAAAAGACCTTTGCGCCGCTGGGGCTTAAGAAGATCCAGGCCG AGGTGTTAGCTAACCTGAAGAACGAGCTGGAGCGC
>NC_011896_1_WP_010908838_1_2491_MLBR_RS11865 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER >NC_002677_1_NP_302518_1_1390_ML2332 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER >NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER >NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER >NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER >NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135 MGPVSAVSTILVNVEPVATLAAVADYQKMRPKILSPQYNEYQVVQGGQGP GTVVKWKLQVTRSRVRDVQVNVDVAGHTVIEKDANSSMVTSWTVAPAGPG SSVTMKTAWTGAGGVKGFFEKTFAPLGLKKIQAEVLANLKNELER
#NEXUS
[ID: 5153264239]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908838_1_2491_MLBR_RS11865
NC_002677_1_NP_302518_1_1390_ML2332
NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340
NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100
NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800
NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908838_1_2491_MLBR_RS11865,
2 NC_002677_1_NP_302518_1_1390_ML2332,
3 NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340,
4 NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100,
5 NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800,
6 NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06688222,2:0.06638601,3:0.06974013,4:0.07229628,5:0.06782053,6:0.07033421);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06688222,2:0.06638601,3:0.06974013,4:0.07229628,5:0.06782053,6:0.07033421);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -596.23 -600.65
2 -596.19 -600.29
--------------------------------------
TOTAL -596.21 -600.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2332/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889164 0.091286 0.355571 1.483168 0.857933 546.36 621.12 1.000
r(A<->C){all} 0.167915 0.018904 0.000019 0.426497 0.136796 38.95 80.71 1.000
r(A<->G){all} 0.158349 0.017101 0.000100 0.413039 0.126857 34.53 105.50 1.001
r(A<->T){all} 0.161860 0.019524 0.000121 0.437717 0.126476 39.52 81.99 0.999
r(C<->G){all} 0.162326 0.020246 0.000109 0.455923 0.122942 46.36 76.49 0.999
r(C<->T){all} 0.180802 0.020469 0.000681 0.464706 0.141402 66.68 72.51 1.000
r(G<->T){all} 0.168749 0.019825 0.000113 0.465463 0.133746 60.62 80.77 0.999
pi(A){all} 0.225901 0.000399 0.187579 0.265320 0.225244 644.68 696.73 1.000
pi(C){all} 0.238156 0.000391 0.200462 0.275523 0.238093 641.44 696.22 0.999
pi(G){all} 0.334114 0.000469 0.294082 0.377732 0.333901 615.09 661.00 1.000
pi(T){all} 0.201829 0.000368 0.165622 0.238908 0.201419 541.26 571.19 1.000
alpha{1,2} 0.420462 0.214331 0.000256 1.313220 0.254164 380.55 448.93 1.000
alpha{3} 0.454315 0.222031 0.000503 1.416407 0.303629 398.74 428.73 1.001
pinvar{all} 0.996136 0.000024 0.986595 0.999997 0.997810 507.04 586.56 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2332/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 145
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 6 6 6 6 6 6 | CAG 7 7 7 7 7 7 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 5 5 5 5 5 5 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 4 4 4 4 4 4 | AAG 9 9 9 9 9 9 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 4 4 4 4 4 4 | Asp GAT 3 3 3 3 3 3 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 3 3 3 3 3 3 | GAC 1 1 1 1 1 1 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 1 1 1 1 1 1 | GGA 3 3 3 3 3 3
GTG 7 7 7 7 7 7 | GCG 6 6 6 6 6 6 | GAG 6 6 6 6 6 6 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908838_1_2491_MLBR_RS11865
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
#2: NC_002677_1_NP_302518_1_1390_ML2332
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
#3: NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
#4: NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
#5: NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
#6: NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 0 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 6 | CGC 18
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 18 | CCG 36 | CAG 42 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 30 | AAC 30 | AGC 24
ATA 0 | ACA 6 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 24 | ACG 24 | AAG 54 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 24 | Asp D GAT 18 | Gly G GGT 18
GTC 48 | GCC 18 | GAC 6 | GGC 30
GTA 18 | GCA 6 | Glu E GAA 6 | GGA 18
GTG 42 | GCG 36 | GAG 36 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12414 C:0.17931 A:0.28276 G:0.41379
position 2: T:0.28966 C:0.26207 A:0.27586 G:0.17241
position 3: T:0.19310 C:0.26897 A:0.11724 G:0.42069
Average T:0.20230 C:0.23678 A:0.22529 G:0.33563
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -568.815081 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.332922 1.241612
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908838_1_2491_MLBR_RS11865: 0.000004, NC_002677_1_NP_302518_1_1390_ML2332: 0.000004, NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340: 0.000004, NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100: 0.000004, NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800: 0.000004, NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.33292
omega (dN/dS) = 1.24161
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 341.4 93.6 1.2416 0.0000 0.0000 0.0 0.0
7..2 0.000 341.4 93.6 1.2416 0.0000 0.0000 0.0 0.0
7..3 0.000 341.4 93.6 1.2416 0.0000 0.0000 0.0 0.0
7..4 0.000 341.4 93.6 1.2416 0.0000 0.0000 0.0 0.0
7..5 0.000 341.4 93.6 1.2416 0.0000 0.0000 0.0 0.0
7..6 0.000 341.4 93.6 1.2416 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -568.815032 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.576039 0.999990 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908838_1_2491_MLBR_RS11865: 0.000004, NC_002677_1_NP_302518_1_1390_ML2332: 0.000004, NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340: 0.000004, NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100: 0.000004, NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800: 0.000004, NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.57604
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 319.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 319.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 319.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 319.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 319.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 319.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -568.814992 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.563250 0.000000 0.000000 1.000000 80.100226
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908838_1_2491_MLBR_RS11865: 0.000004, NC_002677_1_NP_302518_1_1390_ML2332: 0.000004, NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340: 0.000004, NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100: 0.000004, NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800: 0.000004, NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.56325
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 80.10023
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 319.4 115.6 80.1002 0.0000 0.0000 0.0 0.0
7..2 0.000 319.4 115.6 80.1002 0.0000 0.0000 0.0 0.0
7..3 0.000 319.4 115.6 80.1002 0.0000 0.0000 0.0 0.0
7..4 0.000 319.4 115.6 80.1002 0.0000 0.0000 0.0 0.0
7..5 0.000 319.4 115.6 80.1002 0.0000 0.0000 0.0 0.0
7..6 0.000 319.4 115.6 80.1002 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908838_1_2491_MLBR_RS11865)
Pr(w>1) post mean +- SE for w
1 M 1.000** 80.100
2 G 1.000** 80.100
3 P 1.000** 80.100
4 V 1.000** 80.100
5 S 1.000** 80.100
6 A 1.000** 80.100
7 V 1.000** 80.100
8 S 1.000** 80.100
9 T 1.000** 80.100
10 I 1.000** 80.100
11 L 1.000** 80.100
12 V 1.000** 80.100
13 N 1.000** 80.100
14 V 1.000** 80.100
15 E 1.000** 80.100
16 P 1.000** 80.100
17 V 1.000** 80.100
18 A 1.000** 80.100
19 T 1.000** 80.100
20 L 1.000** 80.100
21 A 1.000** 80.100
22 A 1.000** 80.100
23 V 1.000** 80.100
24 A 1.000** 80.100
25 D 1.000** 80.100
26 Y 1.000** 80.100
27 Q 1.000** 80.100
28 K 1.000** 80.100
29 M 1.000** 80.100
30 R 1.000** 80.100
31 P 1.000** 80.100
32 K 1.000** 80.100
33 I 1.000** 80.100
34 L 1.000** 80.100
35 S 1.000** 80.100
36 P 1.000** 80.100
37 Q 1.000** 80.100
38 Y 1.000** 80.100
39 N 1.000** 80.100
40 E 1.000** 80.100
41 Y 1.000** 80.100
42 Q 1.000** 80.100
43 V 1.000** 80.100
44 V 1.000** 80.100
45 Q 1.000** 80.100
46 G 1.000** 80.100
47 G 1.000** 80.100
48 Q 1.000** 80.100
49 G 1.000** 80.100
50 P 1.000** 80.100
51 G 1.000** 80.100
52 T 1.000** 80.100
53 V 1.000** 80.100
54 V 1.000** 80.100
55 K 1.000** 80.100
56 W 1.000** 80.100
57 K 1.000** 80.100
58 L 1.000** 80.100
59 Q 1.000** 80.100
60 V 1.000** 80.100
61 T 1.000** 80.100
62 R 1.000** 80.100
63 S 1.000** 80.100
64 R 1.000** 80.100
65 V 1.000** 80.100
66 R 1.000** 80.100
67 D 1.000** 80.100
68 V 1.000** 80.100
69 Q 1.000** 80.100
70 V 1.000** 80.100
71 N 1.000** 80.100
72 V 1.000** 80.100
73 D 1.000** 80.100
74 V 1.000** 80.100
75 A 1.000** 80.100
76 G 1.000** 80.100
77 H 1.000** 80.100
78 T 1.000** 80.100
79 V 1.000** 80.100
80 I 1.000** 80.100
81 E 1.000** 80.100
82 K 1.000** 80.100
83 D 1.000** 80.100
84 A 1.000** 80.100
85 N 1.000** 80.100
86 S 1.000** 80.100
87 S 1.000** 80.100
88 M 1.000** 80.100
89 V 1.000** 80.100
90 T 1.000** 80.100
91 S 1.000** 80.100
92 W 1.000** 80.100
93 T 1.000** 80.100
94 V 1.000** 80.100
95 A 1.000** 80.100
96 P 1.000** 80.100
97 A 1.000** 80.100
98 G 1.000** 80.100
99 P 1.000** 80.100
100 G 1.000** 80.100
101 S 1.000** 80.100
102 S 1.000** 80.100
103 V 1.000** 80.100
104 T 1.000** 80.100
105 M 1.000** 80.100
106 K 1.000** 80.100
107 T 1.000** 80.100
108 A 1.000** 80.100
109 W 1.000** 80.100
110 T 1.000** 80.100
111 G 1.000** 80.100
112 A 1.000** 80.100
113 G 1.000** 80.100
114 G 1.000** 80.100
115 V 1.000** 80.100
116 K 1.000** 80.100
117 G 1.000** 80.100
118 F 1.000** 80.100
119 F 1.000** 80.100
120 E 1.000** 80.100
121 K 1.000** 80.100
122 T 1.000** 80.100
123 F 1.000** 80.100
124 A 1.000** 80.100
125 P 1.000** 80.100
126 L 1.000** 80.100
127 G 1.000** 80.100
128 L 1.000** 80.100
129 K 1.000** 80.100
130 K 1.000** 80.100
131 I 1.000** 80.100
132 Q 1.000** 80.100
133 A 1.000** 80.100
134 E 1.000** 80.100
135 V 1.000** 80.100
136 L 1.000** 80.100
137 A 1.000** 80.100
138 N 1.000** 80.100
139 L 1.000** 80.100
140 K 1.000** 80.100
141 N 1.000** 80.100
142 E 1.000** 80.100
143 L 1.000** 80.100
144 E 1.000** 80.100
145 R 1.000** 80.100
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908838_1_2491_MLBR_RS11865)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -568.814994 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.549469 0.000000 0.000000 0.000001 0.000001 20.117400
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908838_1_2491_MLBR_RS11865: 0.000004, NC_002677_1_NP_302518_1_1390_ML2332: 0.000004, NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340: 0.000004, NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100: 0.000004, NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800: 0.000004, NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.54947
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 0.00000 20.11740
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 319.4 115.6 20.1174 0.0000 0.0000 0.0 0.0
7..2 0.000 319.4 115.6 20.1174 0.0000 0.0000 0.0 0.0
7..3 0.000 319.4 115.6 20.1174 0.0000 0.0000 0.0 0.0
7..4 0.000 319.4 115.6 20.1174 0.0000 0.0000 0.0 0.0
7..5 0.000 319.4 115.6 20.1174 0.0000 0.0000 0.0 0.0
7..6 0.000 319.4 115.6 20.1174 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908838_1_2491_MLBR_RS11865)
Pr(w>1) post mean +- SE for w
1 M 1.000** 20.117
2 G 1.000** 20.117
3 P 1.000** 20.117
4 V 1.000** 20.117
5 S 1.000** 20.117
6 A 1.000** 20.117
7 V 1.000** 20.117
8 S 1.000** 20.117
9 T 1.000** 20.117
10 I 1.000** 20.117
11 L 1.000** 20.117
12 V 1.000** 20.117
13 N 1.000** 20.117
14 V 1.000** 20.117
15 E 1.000** 20.117
16 P 1.000** 20.117
17 V 1.000** 20.117
18 A 1.000** 20.117
19 T 1.000** 20.117
20 L 1.000** 20.117
21 A 1.000** 20.117
22 A 1.000** 20.117
23 V 1.000** 20.117
24 A 1.000** 20.117
25 D 1.000** 20.117
26 Y 1.000** 20.117
27 Q 1.000** 20.117
28 K 1.000** 20.117
29 M 1.000** 20.117
30 R 1.000** 20.117
31 P 1.000** 20.117
32 K 1.000** 20.117
33 I 1.000** 20.117
34 L 1.000** 20.117
35 S 1.000** 20.117
36 P 1.000** 20.117
37 Q 1.000** 20.117
38 Y 1.000** 20.117
39 N 1.000** 20.117
40 E 1.000** 20.117
41 Y 1.000** 20.117
42 Q 1.000** 20.117
43 V 1.000** 20.117
44 V 1.000** 20.117
45 Q 1.000** 20.117
46 G 1.000** 20.117
47 G 1.000** 20.117
48 Q 1.000** 20.117
49 G 1.000** 20.117
50 P 1.000** 20.117
51 G 1.000** 20.117
52 T 1.000** 20.117
53 V 1.000** 20.117
54 V 1.000** 20.117
55 K 1.000** 20.117
56 W 1.000** 20.117
57 K 1.000** 20.117
58 L 1.000** 20.117
59 Q 1.000** 20.117
60 V 1.000** 20.117
61 T 1.000** 20.117
62 R 1.000** 20.117
63 S 1.000** 20.117
64 R 1.000** 20.117
65 V 1.000** 20.117
66 R 1.000** 20.117
67 D 1.000** 20.117
68 V 1.000** 20.117
69 Q 1.000** 20.117
70 V 1.000** 20.117
71 N 1.000** 20.117
72 V 1.000** 20.117
73 D 1.000** 20.117
74 V 1.000** 20.117
75 A 1.000** 20.117
76 G 1.000** 20.117
77 H 1.000** 20.117
78 T 1.000** 20.117
79 V 1.000** 20.117
80 I 1.000** 20.117
81 E 1.000** 20.117
82 K 1.000** 20.117
83 D 1.000** 20.117
84 A 1.000** 20.117
85 N 1.000** 20.117
86 S 1.000** 20.117
87 S 1.000** 20.117
88 M 1.000** 20.117
89 V 1.000** 20.117
90 T 1.000** 20.117
91 S 1.000** 20.117
92 W 1.000** 20.117
93 T 1.000** 20.117
94 V 1.000** 20.117
95 A 1.000** 20.117
96 P 1.000** 20.117
97 A 1.000** 20.117
98 G 1.000** 20.117
99 P 1.000** 20.117
100 G 1.000** 20.117
101 S 1.000** 20.117
102 S 1.000** 20.117
103 V 1.000** 20.117
104 T 1.000** 20.117
105 M 1.000** 20.117
106 K 1.000** 20.117
107 T 1.000** 20.117
108 A 1.000** 20.117
109 W 1.000** 20.117
110 T 1.000** 20.117
111 G 1.000** 20.117
112 A 1.000** 20.117
113 G 1.000** 20.117
114 G 1.000** 20.117
115 V 1.000** 20.117
116 K 1.000** 20.117
117 G 1.000** 20.117
118 F 1.000** 20.117
119 F 1.000** 20.117
120 E 1.000** 20.117
121 K 1.000** 20.117
122 T 1.000** 20.117
123 F 1.000** 20.117
124 A 1.000** 20.117
125 P 1.000** 20.117
126 L 1.000** 20.117
127 G 1.000** 20.117
128 L 1.000** 20.117
129 K 1.000** 20.117
130 K 1.000** 20.117
131 I 1.000** 20.117
132 Q 1.000** 20.117
133 A 1.000** 20.117
134 E 1.000** 20.117
135 V 1.000** 20.117
136 L 1.000** 20.117
137 A 1.000** 20.117
138 N 1.000** 20.117
139 L 1.000** 20.117
140 K 1.000** 20.117
141 N 1.000** 20.117
142 E 1.000** 20.117
143 L 1.000** 20.117
144 E 1.000** 20.117
145 R 1.000** 20.117
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -568.815081 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.549494 0.467996 1.376359
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908838_1_2491_MLBR_RS11865: 0.000004, NC_002677_1_NP_302518_1_1390_ML2332: 0.000004, NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340: 0.000004, NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100: 0.000004, NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800: 0.000004, NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.54949
Parameters in M7 (beta):
p = 0.46800 q = 1.37636
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00113 0.01181 0.03540 0.07338 0.12738 0.19957 0.29310 0.41320 0.57010 0.79305
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 319.4 115.6 0.2518 0.0000 0.0000 0.0 0.0
7..2 0.000 319.4 115.6 0.2518 0.0000 0.0000 0.0 0.0
7..3 0.000 319.4 115.6 0.2518 0.0000 0.0000 0.0 0.0
7..4 0.000 319.4 115.6 0.2518 0.0000 0.0000 0.0 0.0
7..5 0.000 319.4 115.6 0.2518 0.0000 0.0000 0.0 0.0
7..6 0.000 319.4 115.6 0.2518 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -568.815032 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 262.549505 0.411402 0.005000 1.712165 1.703447
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908838_1_2491_MLBR_RS11865: 0.000004, NC_002677_1_NP_302518_1_1390_ML2332: 0.000004, NZ_LVXE01000002_1_WP_010908838_1_771_A3216_RS01340: 0.000004, NZ_LYPH01000022_1_WP_010908838_1_861_A8144_RS04100: 0.000004, NZ_CP029543_1_WP_010908838_1_2513_DIJ64_RS12800: 0.000004, NZ_AP014567_1_WP_010908838_1_2580_JK2ML_RS13135: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 262.54951
Parameters in M8 (beta&w>1):
p0 = 0.41140 p = 0.00500 q = 1.71216
(p1 = 0.58860) w = 1.70345
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04114 0.04114 0.04114 0.04114 0.04114 0.04114 0.04114 0.04114 0.04114 0.04114 0.58860
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.70345
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 319.4 115.6 1.0026 0.0000 0.0000 0.0 0.0
7..2 0.000 319.4 115.6 1.0026 0.0000 0.0000 0.0 0.0
7..3 0.000 319.4 115.6 1.0026 0.0000 0.0000 0.0 0.0
7..4 0.000 319.4 115.6 1.0026 0.0000 0.0000 0.0 0.0
7..5 0.000 319.4 115.6 1.0026 0.0000 0.0000 0.0 0.0
7..6 0.000 319.4 115.6 1.0026 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908838_1_2491_MLBR_RS11865)
Pr(w>1) post mean +- SE for w
1 M 0.589 1.003
2 G 0.589 1.003
3 P 0.589 1.003
4 V 0.589 1.003
5 S 0.589 1.003
6 A 0.589 1.003
7 V 0.589 1.003
8 S 0.589 1.003
9 T 0.589 1.003
10 I 0.589 1.003
11 L 0.589 1.003
12 V 0.589 1.003
13 N 0.589 1.003
14 V 0.589 1.003
15 E 0.589 1.003
16 P 0.589 1.003
17 V 0.589 1.003
18 A 0.589 1.003
19 T 0.589 1.003
20 L 0.589 1.003
21 A 0.589 1.003
22 A 0.589 1.003
23 V 0.589 1.003
24 A 0.589 1.003
25 D 0.589 1.003
26 Y 0.589 1.003
27 Q 0.589 1.003
28 K 0.589 1.003
29 M 0.589 1.003
30 R 0.589 1.003
31 P 0.589 1.003
32 K 0.589 1.003
33 I 0.589 1.003
34 L 0.589 1.003
35 S 0.589 1.003
36 P 0.589 1.003
37 Q 0.589 1.003
38 Y 0.589 1.003
39 N 0.589 1.003
40 E 0.589 1.003
41 Y 0.589 1.003
42 Q 0.589 1.003
43 V 0.589 1.003
44 V 0.589 1.003
45 Q 0.589 1.003
46 G 0.589 1.003
47 G 0.589 1.003
48 Q 0.589 1.003
49 G 0.589 1.003
50 P 0.589 1.003
51 G 0.589 1.003
52 T 0.589 1.003
53 V 0.589 1.003
54 V 0.589 1.003
55 K 0.589 1.003
56 W 0.589 1.003
57 K 0.589 1.003
58 L 0.589 1.003
59 Q 0.589 1.003
60 V 0.589 1.003
61 T 0.589 1.003
62 R 0.589 1.003
63 S 0.589 1.003
64 R 0.589 1.003
65 V 0.589 1.003
66 R 0.589 1.003
67 D 0.589 1.003
68 V 0.589 1.003
69 Q 0.589 1.003
70 V 0.589 1.003
71 N 0.589 1.003
72 V 0.589 1.003
73 D 0.589 1.003
74 V 0.589 1.003
75 A 0.589 1.003
76 G 0.589 1.003
77 H 0.589 1.003
78 T 0.589 1.003
79 V 0.589 1.003
80 I 0.589 1.003
81 E 0.589 1.003
82 K 0.589 1.003
83 D 0.589 1.003
84 A 0.589 1.003
85 N 0.589 1.003
86 S 0.589 1.003
87 S 0.589 1.003
88 M 0.589 1.003
89 V 0.589 1.003
90 T 0.589 1.003
91 S 0.589 1.003
92 W 0.589 1.003
93 T 0.589 1.003
94 V 0.589 1.003
95 A 0.589 1.003
96 P 0.589 1.003
97 A 0.589 1.003
98 G 0.589 1.003
99 P 0.589 1.003
100 G 0.589 1.003
101 S 0.589 1.003
102 S 0.589 1.003
103 V 0.589 1.003
104 T 0.589 1.003
105 M 0.589 1.003
106 K 0.589 1.003
107 T 0.589 1.003
108 A 0.589 1.003
109 W 0.589 1.003
110 T 0.589 1.003
111 G 0.589 1.003
112 A 0.589 1.003
113 G 0.589 1.003
114 G 0.589 1.003
115 V 0.589 1.003
116 K 0.589 1.003
117 G 0.589 1.003
118 F 0.589 1.003
119 F 0.589 1.003
120 E 0.589 1.003
121 K 0.589 1.003
122 T 0.589 1.003
123 F 0.589 1.003
124 A 0.589 1.003
125 P 0.589 1.003
126 L 0.589 1.003
127 G 0.589 1.003
128 L 0.589 1.003
129 K 0.589 1.003
130 K 0.589 1.003
131 I 0.589 1.003
132 Q 0.589 1.003
133 A 0.589 1.003
134 E 0.589 1.003
135 V 0.589 1.003
136 L 0.589 1.003
137 A 0.589 1.003
138 N 0.589 1.003
139 L 0.589 1.003
140 K 0.589 1.003
141 N 0.589 1.003
142 E 0.589 1.003
143 L 0.589 1.003
144 E 0.589 1.003
145 R 0.589 1.003
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908838_1_2491_MLBR_RS11865)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Time used: 0:14
Model 1: NearlyNeutral -568.815032 Model 2: PositiveSelection -568.814992 Model 0: one-ratio -568.815081 Model 3: discrete -568.814994 Model 7: beta -568.815081 Model 8: beta&w>1 -568.815032 Model 0 vs 1 9.799999997994746E-5 Model 2 vs 1 8.000000002539309E-5 Model 8 vs 7 9.799999997994746E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
