--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:24:06 GMT 2020 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=500000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=1250 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=1250 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/8res/ML2337/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1020.31 -1023.69 2 -1020.34 -1024.25 -------------------------------------- TOTAL -1020.33 -1024.01 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 1502 samples from 2 runs. Each run produced 1001 samples of which 751 samples were included. Parameter summaries saved to file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897961 0.088107 0.336528 1.458723 0.874549 723.51 737.26 0.999 r(A<->C){all} 0.177430 0.020291 0.001861 0.442749 0.147405 40.75 80.69 1.000 r(A<->G){all} 0.169456 0.018934 0.000056 0.444973 0.130264 81.89 96.23 1.005 r(A<->T){all} 0.153573 0.018930 0.000102 0.431596 0.111431 73.15 95.75 1.002 r(C<->G){all} 0.179879 0.022807 0.000016 0.512567 0.142407 94.65 112.40 1.044 r(C<->T){all} 0.157635 0.019557 0.000031 0.441193 0.118653 35.93 95.76 1.000 r(G<->T){all} 0.162027 0.021368 0.000048 0.449776 0.124290 85.93 105.05 1.078 pi(A){all} 0.219317 0.000218 0.191478 0.247521 0.219980 687.63 696.03 0.999 pi(C){all} 0.310621 0.000269 0.279788 0.343838 0.310768 368.69 518.91 1.009 pi(G){all} 0.300497 0.000271 0.267598 0.330534 0.299981 610.69 620.23 1.002 pi(T){all} 0.169565 0.000186 0.140204 0.195587 0.170052 620.30 685.65 1.002 alpha{1,2} 0.421546 0.256443 0.000116 1.446486 0.239735 356.46 374.97 0.999 alpha{3} 0.470475 0.267064 0.000887 1.518705 0.291275 413.98 496.20 1.000 pinvar{all} 0.997986 0.000006 0.993052 0.999999 0.998820 546.11 598.76 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -991.473706 Model 2: PositiveSelection -991.473572 Model 0: one-ratio -991.473762 Model 3: discrete -991.473755 Model 7: beta -991.473572 Model 8: beta&w>1 -991.47371 Model 0 vs 1 1.1199999994460086E-4 Model 2 vs 1 2.6800000000548607E-4 Model 8 vs 7 2.75999999985288E-4
>C1 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C2 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C3 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C4 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C5 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C6 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=250 C1 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C2 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C3 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C4 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C5 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C6 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV ************************************************** C1 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C2 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C3 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C4 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C5 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C6 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI ************************************************** C1 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C2 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C3 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C4 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C5 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C6 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL ************************************************** C1 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C2 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C3 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C4 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C5 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C6 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ************************************************** C1 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C2 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C3 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C4 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C5 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C6 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN ************************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] set -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7500] Library Relaxation: Multi_proc [96] Relaxation Summary: [7500]--->[7500] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.802 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C2 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C3 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C4 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C5 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV C6 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV ************************************************** C1 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C2 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C3 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C4 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C5 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI C6 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI ************************************************** C1 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C2 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C3 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C4 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C5 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL C6 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL ************************************************** C1 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C2 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C3 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C4 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C5 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP C6 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ************************************************** C1 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C2 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C3 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C4 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C5 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN C6 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN ************************************************** FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC C2 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC C3 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC C4 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC C5 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC C6 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC ************************************************** C1 TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG C2 TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG C3 TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG C4 TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG C5 TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG C6 TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG ************************************************** C1 GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG C2 GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG C3 GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG C4 GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG C5 GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG C6 GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG ************************************************** C1 CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA C2 CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA C3 CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA C4 CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA C5 CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA C6 CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA ************************************************** C1 AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT C2 AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT C3 AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT C4 AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT C5 AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT C6 AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT ************************************************** C1 CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC C2 CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC C3 CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC C4 CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC C5 CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC C6 CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC ************************************************** C1 GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT C2 GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT C3 GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT C4 GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT C5 GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT C6 GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT ************************************************** C1 TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT C2 TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT C3 TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT C4 TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT C5 TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT C6 TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT ************************************************** C1 TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG C2 TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG C3 TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG C4 TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG C5 TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG C6 TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG ************************************************** C1 AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA C2 AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA C3 AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA C4 AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA C5 AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA C6 AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA ************************************************** C1 CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA C2 CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA C3 CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA C4 CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA C5 CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA C6 CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA ************************************************** C1 CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC C2 CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC C3 CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC C4 CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC C5 CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC C6 CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC ************************************************** C1 GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA C2 GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA C3 GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA C4 GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA C5 GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA C6 GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA ************************************************** C1 AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA C2 AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA C3 AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA C4 AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA C5 AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA C6 AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA ************************************************** C1 AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT C2 AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT C3 AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT C4 AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT C5 AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT C6 AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT ************************************************** >C1 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >C2 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >C3 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >C4 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >C5 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >C6 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >C1 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C2 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C3 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C4 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C5 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >C6 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 750 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579857797 Setting output file names to "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1737527679 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 500000 Running Markov chain MCMC stamp = 5170077024 Seed = 1842916841 Swapseed = 1579857797 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1678.535960 -- -24.965149 Chain 2 -- -1678.535960 -- -24.965149 Chain 3 -- -1678.535960 -- -24.965149 Chain 4 -- -1678.535960 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1678.535960 -- -24.965149 Chain 2 -- -1678.535960 -- -24.965149 Chain 3 -- -1678.535960 -- -24.965149 Chain 4 -- -1678.535960 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (500000 generations requested): 0 -- [-1678.536] (-1678.536) (-1678.536) (-1678.536) * [-1678.536] (-1678.536) (-1678.536) (-1678.536) 500 -- (-1032.134) [-1028.227] (-1037.425) (-1038.013) * (-1030.161) (-1048.091) (-1033.627) [-1043.808] -- 0:00:00 1000 -- (-1031.371) (-1025.878) (-1028.944) [-1030.537] * [-1033.191] (-1041.200) (-1027.758) (-1044.828) -- 0:00:00 1500 -- [-1031.816] (-1032.205) (-1023.378) (-1030.103) * (-1033.173) (-1027.554) [-1025.967] (-1042.522) -- 0:00:00 2000 -- (-1033.770) (-1028.968) (-1029.489) [-1025.852] * (-1032.865) [-1030.707] (-1026.830) (-1034.991) -- 0:00:00 2500 -- (-1027.606) (-1033.180) [-1031.236] (-1027.651) * [-1024.283] (-1028.231) (-1036.085) (-1033.176) -- 0:00:00 3000 -- [-1028.487] (-1032.058) (-1032.214) (-1027.574) * (-1024.204) (-1026.879) (-1027.499) [-1024.668] -- 0:00:00 3500 -- (-1032.083) (-1036.877) [-1028.905] (-1034.484) * [-1028.045] (-1026.638) (-1036.164) (-1032.832) -- 0:00:00 4000 -- (-1026.392) (-1031.377) [-1029.349] (-1032.942) * (-1028.720) (-1028.909) [-1028.290] (-1029.814) -- 0:00:00 4500 -- (-1027.062) [-1027.629] (-1035.564) (-1031.490) * (-1036.863) [-1025.458] (-1032.697) (-1036.840) -- 0:00:00 5000 -- [-1028.692] (-1035.840) (-1029.316) (-1033.976) * (-1027.202) (-1025.029) (-1026.792) [-1028.300] -- 0:00:00 Average standard deviation of split frequencies: 0.075151 5500 -- [-1027.446] (-1036.761) (-1034.044) (-1030.111) * [-1028.109] (-1040.051) (-1027.622) (-1031.172) -- 0:00:00 6000 -- [-1026.350] (-1027.488) (-1030.689) (-1033.636) * (-1037.698) (-1037.558) (-1033.090) [-1032.131] -- 0:00:00 6500 -- (-1027.745) (-1026.539) [-1032.124] (-1029.518) * (-1026.033) [-1026.760] (-1033.072) (-1026.749) -- 0:00:00 7000 -- [-1027.415] (-1033.090) (-1029.610) (-1034.009) * [-1026.384] (-1037.398) (-1028.275) (-1033.251) -- 0:00:00 7500 -- (-1038.461) (-1027.564) [-1025.278] (-1032.126) * (-1034.163) (-1032.506) [-1028.987] (-1024.338) -- 0:00:00 8000 -- (-1036.022) [-1025.156] (-1033.291) (-1024.793) * (-1027.040) [-1029.650] (-1032.792) (-1028.263) -- 0:01:01 8500 -- (-1035.992) (-1030.484) (-1032.693) [-1030.475] * (-1030.003) (-1026.883) [-1032.333] (-1027.574) -- 0:00:57 9000 -- (-1036.053) (-1031.391) [-1029.203] (-1029.559) * (-1027.140) [-1028.181] (-1030.938) (-1033.519) -- 0:00:54 9500 -- [-1025.916] (-1020.797) (-1034.785) (-1035.788) * [-1026.859] (-1025.862) (-1031.261) (-1028.733) -- 0:00:51 10000 -- [-1027.097] (-1020.529) (-1033.412) (-1027.391) * (-1038.274) (-1027.475) (-1032.001) [-1031.087] -- 0:00:49 Average standard deviation of split frequencies: 0.086062 10500 -- [-1024.789] (-1019.299) (-1027.829) (-1038.858) * (-1034.053) (-1032.507) (-1028.652) [-1033.488] -- 0:00:46 11000 -- (-1032.167) [-1019.354] (-1027.372) (-1030.979) * (-1029.696) (-1029.421) [-1033.869] (-1027.111) -- 0:00:44 11500 -- (-1034.702) [-1019.074] (-1026.009) (-1034.536) * [-1026.562] (-1032.964) (-1027.224) (-1033.037) -- 0:00:42 12000 -- [-1033.260] (-1020.384) (-1031.168) (-1030.985) * (-1031.058) (-1029.446) (-1032.088) [-1029.642] -- 0:00:40 12500 -- [-1030.049] (-1023.010) (-1029.194) (-1042.544) * (-1030.625) (-1029.879) (-1024.208) [-1037.801] -- 0:00:39 13000 -- (-1031.820) [-1020.725] (-1034.748) (-1036.090) * (-1034.995) (-1026.808) [-1030.703] (-1026.786) -- 0:00:37 13500 -- [-1024.789] (-1023.421) (-1033.298) (-1036.031) * (-1035.972) [-1030.122] (-1025.918) (-1029.300) -- 0:00:36 14000 -- [-1028.669] (-1023.908) (-1035.533) (-1030.073) * (-1036.198) [-1029.050] (-1030.363) (-1030.984) -- 0:00:34 14500 -- [-1024.731] (-1031.804) (-1033.829) (-1036.942) * [-1030.812] (-1033.096) (-1028.212) (-1035.812) -- 0:00:33 15000 -- (-1031.022) (-1020.433) [-1031.320] (-1033.925) * [-1030.038] (-1035.660) (-1035.693) (-1031.178) -- 0:00:32 Average standard deviation of split frequencies: 0.053726 15500 -- (-1030.111) [-1022.352] (-1035.070) (-1025.024) * (-1035.965) [-1028.793] (-1034.017) (-1032.968) -- 0:00:31 16000 -- [-1031.736] (-1023.087) (-1029.146) (-1038.786) * (-1025.924) (-1030.861) [-1030.502] (-1031.432) -- 0:00:30 16500 -- [-1024.395] (-1027.533) (-1034.249) (-1019.282) * (-1031.860) [-1036.743] (-1028.377) (-1036.864) -- 0:00:29 17000 -- (-1032.870) (-1022.593) (-1031.252) [-1019.583] * (-1037.357) (-1035.019) [-1026.884] (-1034.209) -- 0:00:28 17500 -- (-1032.381) (-1021.068) (-1032.867) [-1021.577] * (-1027.566) [-1028.884] (-1027.166) (-1019.790) -- 0:00:27 18000 -- (-1035.007) (-1020.296) [-1028.428] (-1020.369) * (-1028.185) (-1034.186) (-1027.572) [-1020.185] -- 0:00:26 18500 -- (-1040.278) [-1020.391] (-1034.396) (-1019.406) * [-1027.286] (-1034.345) (-1025.821) (-1021.017) -- 0:00:26 19000 -- (-1023.907) [-1020.736] (-1028.438) (-1019.883) * (-1041.474) (-1024.149) (-1036.648) [-1020.738] -- 0:00:25 19500 -- (-1027.534) [-1020.276] (-1031.083) (-1020.476) * [-1027.357] (-1031.245) (-1025.693) (-1021.971) -- 0:00:24 20000 -- (-1036.317) (-1020.619) (-1028.587) [-1019.283] * (-1027.031) [-1035.429] (-1029.327) (-1023.052) -- 0:00:24 Average standard deviation of split frequencies: 0.058654 20500 -- (-1035.344) [-1020.544] (-1033.211) (-1019.597) * (-1035.817) [-1032.800] (-1030.660) (-1019.959) -- 0:00:23 21000 -- (-1033.821) [-1021.125] (-1025.883) (-1027.931) * (-1038.903) [-1033.896] (-1031.251) (-1021.642) -- 0:00:22 21500 -- (-1033.608) (-1021.492) (-1034.832) [-1019.521] * (-1021.408) (-1031.035) (-1035.642) [-1019.325] -- 0:00:22 22000 -- (-1031.431) [-1019.666] (-1025.288) (-1019.439) * (-1031.504) (-1029.641) [-1026.668] (-1019.411) -- 0:00:21 22500 -- (-1036.254) [-1020.555] (-1033.170) (-1019.430) * [-1026.773] (-1041.519) (-1032.607) (-1020.969) -- 0:00:21 23000 -- (-1029.789) [-1020.674] (-1029.801) (-1019.333) * (-1047.397) (-1036.392) [-1029.763] (-1020.513) -- 0:00:20 23500 -- (-1029.156) (-1023.055) (-1027.879) [-1020.470] * (-1032.362) [-1031.156] (-1032.091) (-1020.619) -- 0:00:40 24000 -- (-1031.617) (-1022.897) (-1028.129) [-1020.860] * (-1032.215) (-1029.889) [-1028.602] (-1021.228) -- 0:00:39 24500 -- (-1028.985) (-1023.725) [-1031.483] (-1021.198) * (-1027.961) [-1026.926] (-1035.947) (-1019.744) -- 0:00:38 25000 -- (-1035.298) [-1023.711] (-1029.719) (-1019.698) * (-1032.073) [-1029.665] (-1028.290) (-1019.144) -- 0:00:38 Average standard deviation of split frequencies: 0.044896 25500 -- (-1029.216) (-1018.949) [-1029.506] (-1022.066) * (-1035.286) (-1044.703) [-1026.403] (-1022.719) -- 0:00:37 26000 -- (-1035.184) (-1019.333) [-1029.919] (-1020.510) * (-1029.488) (-1026.828) (-1034.629) [-1020.681] -- 0:00:36 26500 -- [-1028.277] (-1019.310) (-1029.554) (-1020.989) * (-1030.594) (-1029.268) (-1027.443) [-1022.550] -- 0:00:35 27000 -- (-1031.508) [-1018.964] (-1024.541) (-1022.246) * [-1032.129] (-1026.513) (-1026.595) (-1021.232) -- 0:00:35 27500 -- (-1033.053) (-1020.261) (-1032.389) [-1025.745] * [-1025.240] (-1024.007) (-1030.040) (-1019.255) -- 0:00:34 28000 -- (-1032.701) (-1021.177) [-1027.766] (-1022.828) * (-1034.598) (-1022.714) [-1030.694] (-1019.366) -- 0:00:33 28500 -- (-1028.173) (-1022.345) [-1028.720] (-1021.358) * (-1033.166) [-1020.252] (-1034.133) (-1019.718) -- 0:00:33 29000 -- [-1029.730] (-1020.442) (-1032.763) (-1019.414) * (-1033.518) (-1021.270) [-1029.679] (-1019.216) -- 0:00:32 29500 -- [-1025.606] (-1024.562) (-1026.817) (-1023.549) * (-1031.947) (-1023.175) [-1025.015] (-1020.654) -- 0:00:31 30000 -- (-1027.059) [-1025.386] (-1027.981) (-1023.363) * (-1032.368) [-1022.172] (-1028.477) (-1019.492) -- 0:00:31 Average standard deviation of split frequencies: 0.044578 30500 -- (-1031.454) (-1022.606) [-1029.955] (-1026.706) * (-1027.695) (-1020.969) (-1027.376) [-1019.667] -- 0:00:30 31000 -- [-1023.566] (-1020.898) (-1029.097) (-1023.380) * [-1030.808] (-1021.283) (-1027.578) (-1020.337) -- 0:00:30 31500 -- [-1027.755] (-1021.881) (-1030.321) (-1020.812) * (-1031.245) (-1024.050) (-1034.666) [-1020.280] -- 0:00:29 32000 -- (-1035.340) (-1021.466) (-1030.617) [-1021.047] * (-1027.747) (-1025.013) (-1030.063) [-1021.906] -- 0:00:29 32500 -- (-1032.963) (-1020.134) (-1034.835) [-1020.887] * (-1030.056) [-1022.659] (-1032.500) (-1020.901) -- 0:00:28 33000 -- (-1036.532) [-1021.163] (-1031.468) (-1020.389) * [-1025.133] (-1020.976) (-1025.752) (-1024.485) -- 0:00:28 33500 -- (-1036.235) [-1020.750] (-1041.525) (-1022.163) * (-1031.661) (-1022.947) [-1027.891] (-1020.581) -- 0:00:27 34000 -- [-1025.242] (-1020.983) (-1033.341) (-1026.654) * [-1031.485] (-1025.420) (-1029.631) (-1021.596) -- 0:00:27 34500 -- [-1032.862] (-1022.113) (-1032.206) (-1021.203) * (-1030.965) (-1019.381) [-1027.834] (-1023.945) -- 0:00:26 35000 -- (-1029.734) (-1020.613) [-1027.975] (-1023.914) * (-1033.079) (-1024.136) [-1032.238] (-1024.231) -- 0:00:26 Average standard deviation of split frequencies: 0.044045 35500 -- (-1037.901) [-1020.342] (-1028.141) (-1019.827) * (-1027.434) [-1020.456] (-1030.174) (-1022.440) -- 0:00:26 36000 -- (-1026.259) (-1020.597) [-1030.262] (-1020.043) * (-1037.145) (-1024.553) [-1029.080] (-1023.134) -- 0:00:25 36500 -- [-1025.384] (-1022.760) (-1033.591) (-1019.529) * (-1035.026) (-1023.907) (-1027.125) [-1022.436] -- 0:00:25 37000 -- (-1023.887) (-1021.570) (-1024.546) [-1021.286] * [-1033.947] (-1024.177) (-1034.660) (-1023.523) -- 0:00:25 37500 -- (-1033.425) (-1022.505) [-1031.446] (-1022.694) * (-1029.409) (-1020.617) [-1027.546] (-1028.172) -- 0:00:24 38000 -- (-1028.947) (-1028.560) (-1027.049) [-1020.200] * [-1031.770] (-1019.925) (-1037.567) (-1021.877) -- 0:00:24 38500 -- (-1025.872) (-1022.263) (-1028.602) [-1019.527] * (-1036.375) [-1019.242] (-1034.559) (-1019.985) -- 0:00:35 39000 -- (-1028.693) [-1020.850] (-1028.756) (-1020.985) * (-1038.845) [-1023.414] (-1028.268) (-1019.938) -- 0:00:35 39500 -- (-1029.488) (-1019.821) [-1031.215] (-1020.240) * (-1024.998) (-1021.963) [-1034.183] (-1021.206) -- 0:00:34 40000 -- (-1038.651) (-1018.824) (-1029.749) [-1020.354] * [-1021.520] (-1022.857) (-1030.988) (-1023.713) -- 0:00:34 Average standard deviation of split frequencies: 0.035935 40500 -- (-1031.519) (-1019.130) [-1031.662] (-1020.353) * (-1021.239) [-1019.169] (-1034.859) (-1022.170) -- 0:00:34 41000 -- (-1035.952) (-1023.660) (-1036.512) [-1020.039] * [-1021.945] (-1020.314) (-1027.580) (-1025.526) -- 0:00:33 41500 -- [-1027.997] (-1022.903) (-1032.603) (-1020.972) * (-1021.464) [-1021.567] (-1044.340) (-1020.822) -- 0:00:33 42000 -- [-1028.775] (-1024.596) (-1031.030) (-1021.615) * (-1023.072) (-1018.702) [-1031.434] (-1020.960) -- 0:00:32 42500 -- (-1030.872) (-1023.568) [-1032.970] (-1025.881) * (-1020.696) (-1019.833) [-1029.861] (-1020.973) -- 0:00:32 43000 -- [-1028.696] (-1021.460) (-1030.905) (-1022.255) * (-1019.601) (-1023.562) [-1027.089] (-1021.528) -- 0:00:31 43500 -- (-1037.663) (-1022.948) [-1035.912] (-1020.696) * (-1019.969) [-1022.340] (-1035.644) (-1021.753) -- 0:00:31 44000 -- (-1033.814) (-1019.679) [-1030.182] (-1021.608) * (-1021.280) (-1022.735) [-1027.342] (-1021.249) -- 0:00:31 44500 -- (-1027.815) (-1020.138) [-1031.779] (-1022.523) * (-1020.548) (-1021.454) (-1041.215) [-1023.303] -- 0:00:30 45000 -- (-1036.419) (-1020.452) (-1034.377) [-1022.131] * (-1022.327) [-1019.422] (-1031.454) (-1023.778) -- 0:00:30 Average standard deviation of split frequencies: 0.024688 45500 -- (-1034.263) [-1019.301] (-1029.621) (-1020.575) * (-1019.268) (-1022.442) (-1027.212) [-1023.201] -- 0:00:29 46000 -- (-1024.873) [-1021.188] (-1031.644) (-1021.211) * (-1020.894) (-1021.102) [-1030.759] (-1022.290) -- 0:00:29 46500 -- (-1031.424) (-1019.339) [-1025.977] (-1021.279) * (-1019.810) (-1020.265) [-1036.636] (-1022.781) -- 0:00:29 47000 -- [-1028.553] (-1020.695) (-1031.252) (-1022.123) * (-1020.678) [-1023.417] (-1035.062) (-1021.556) -- 0:00:28 47500 -- [-1026.925] (-1020.216) (-1033.809) (-1022.521) * (-1024.030) (-1019.999) [-1032.581] (-1025.300) -- 0:00:28 48000 -- (-1034.592) (-1020.322) [-1033.661] (-1024.659) * [-1020.515] (-1020.132) (-1033.370) (-1019.777) -- 0:00:28 48500 -- (-1035.096) (-1022.751) [-1029.128] (-1019.141) * (-1021.273) (-1020.208) (-1031.161) [-1020.736] -- 0:00:27 49000 -- [-1026.028] (-1019.925) (-1028.105) (-1019.325) * (-1022.547) (-1021.395) [-1028.357] (-1022.103) -- 0:00:27 49500 -- (-1037.031) (-1020.267) [-1029.254] (-1019.895) * (-1022.867) [-1021.220] (-1029.795) (-1025.262) -- 0:00:27 50000 -- (-1027.180) [-1020.872] (-1028.375) (-1021.512) * [-1019.473] (-1024.432) (-1029.896) (-1020.028) -- 0:00:27 Average standard deviation of split frequencies: 0.024656 50500 -- [-1026.920] (-1024.602) (-1034.258) (-1021.152) * (-1019.808) (-1024.121) [-1030.373] (-1019.511) -- 0:00:26 51000 -- (-1030.130) (-1023.842) [-1035.674] (-1019.574) * (-1026.036) (-1022.281) (-1031.838) [-1019.661] -- 0:00:26 51500 -- (-1029.423) [-1021.479] (-1032.888) (-1019.816) * (-1021.807) [-1019.175] (-1037.312) (-1019.347) -- 0:00:26 52000 -- (-1028.557) (-1021.442) (-1031.088) [-1021.341] * (-1022.854) (-1019.267) [-1036.354] (-1021.880) -- 0:00:25 52500 -- (-1035.744) (-1020.958) [-1029.709] (-1019.771) * [-1023.982] (-1019.325) (-1038.842) (-1022.370) -- 0:00:25 53000 -- (-1027.326) [-1023.153] (-1031.169) (-1022.057) * [-1025.449] (-1020.780) (-1043.007) (-1023.035) -- 0:00:25 53500 -- (-1028.608) [-1022.064] (-1024.547) (-1023.113) * [-1026.545] (-1021.477) (-1033.301) (-1021.172) -- 0:00:33 54000 -- [-1024.749] (-1022.106) (-1021.892) (-1020.381) * (-1019.563) [-1020.780] (-1021.437) (-1020.087) -- 0:00:33 54500 -- (-1035.905) (-1023.901) [-1023.741] (-1022.463) * (-1020.775) (-1020.646) (-1023.491) [-1020.273] -- 0:00:32 55000 -- (-1028.211) (-1020.183) [-1021.318] (-1023.538) * [-1019.743] (-1020.627) (-1024.327) (-1022.299) -- 0:00:32 Average standard deviation of split frequencies: 0.021887 55500 -- (-1028.253) (-1021.637) [-1020.105] (-1021.506) * [-1023.853] (-1021.850) (-1020.780) (-1020.215) -- 0:00:32 56000 -- (-1030.312) (-1020.567) [-1020.003] (-1019.971) * [-1021.815] (-1020.690) (-1020.895) (-1022.762) -- 0:00:31 56500 -- (-1025.440) [-1021.861] (-1021.885) (-1023.668) * [-1026.480] (-1023.416) (-1020.699) (-1022.866) -- 0:00:31 57000 -- (-1033.956) (-1020.450) [-1026.264] (-1024.471) * (-1020.019) (-1021.428) (-1020.629) [-1021.692] -- 0:00:31 57500 -- [-1029.293] (-1020.941) (-1026.851) (-1023.327) * [-1019.329] (-1020.537) (-1021.414) (-1023.812) -- 0:00:30 58000 -- [-1030.104] (-1023.071) (-1021.229) (-1021.697) * [-1023.651] (-1020.816) (-1029.604) (-1021.051) -- 0:00:30 58500 -- (-1023.135) [-1020.799] (-1021.232) (-1022.655) * [-1020.814] (-1019.445) (-1019.880) (-1024.226) -- 0:00:30 59000 -- (-1019.282) [-1020.964] (-1021.167) (-1022.193) * (-1018.849) (-1020.767) [-1021.344] (-1020.161) -- 0:00:29 59500 -- (-1020.919) [-1021.877] (-1020.538) (-1021.717) * (-1019.467) (-1021.368) (-1020.847) [-1021.462] -- 0:00:29 60000 -- (-1021.523) (-1026.412) (-1019.683) [-1022.818] * (-1019.832) [-1023.486] (-1020.056) (-1021.307) -- 0:00:29 Average standard deviation of split frequencies: 0.018131 60500 -- (-1024.921) [-1022.838] (-1022.246) (-1021.902) * [-1019.570] (-1023.522) (-1021.634) (-1022.027) -- 0:00:29 61000 -- [-1020.780] (-1024.436) (-1026.507) (-1020.459) * [-1021.890] (-1022.695) (-1020.128) (-1020.198) -- 0:00:28 61500 -- [-1020.057] (-1019.276) (-1021.856) (-1022.827) * [-1022.796] (-1019.213) (-1019.877) (-1020.458) -- 0:00:28 62000 -- (-1020.293) (-1024.660) (-1019.997) [-1020.098] * [-1021.549] (-1018.886) (-1020.672) (-1024.209) -- 0:00:28 62500 -- [-1021.090] (-1026.831) (-1020.057) (-1020.976) * (-1021.453) [-1018.895] (-1020.779) (-1024.864) -- 0:00:28 63000 -- (-1020.714) [-1022.458] (-1023.578) (-1021.973) * [-1019.827] (-1022.935) (-1020.049) (-1021.969) -- 0:00:27 63500 -- (-1020.248) (-1024.534) [-1024.257] (-1022.235) * [-1019.013] (-1023.733) (-1019.832) (-1022.136) -- 0:00:27 64000 -- [-1019.685] (-1022.556) (-1024.247) (-1025.149) * (-1019.795) [-1021.326] (-1020.928) (-1019.052) -- 0:00:27 64500 -- (-1018.804) [-1021.070] (-1023.321) (-1022.003) * [-1019.367] (-1023.720) (-1022.864) (-1021.800) -- 0:00:27 65000 -- [-1020.656] (-1019.855) (-1022.305) (-1019.978) * (-1019.032) (-1020.293) (-1022.666) [-1020.406] -- 0:00:26 Average standard deviation of split frequencies: 0.021427 65500 -- [-1019.885] (-1020.182) (-1022.741) (-1020.801) * [-1019.918] (-1020.121) (-1022.086) (-1019.422) -- 0:00:26 66000 -- (-1020.345) (-1019.365) [-1020.508] (-1024.313) * [-1021.188] (-1020.523) (-1024.003) (-1020.820) -- 0:00:26 66500 -- (-1020.160) [-1019.444] (-1019.610) (-1021.413) * [-1022.789] (-1020.037) (-1021.953) (-1020.161) -- 0:00:26 67000 -- (-1019.429) (-1019.482) (-1022.025) [-1023.444] * [-1020.992] (-1022.394) (-1022.077) (-1023.269) -- 0:00:25 67500 -- (-1020.516) (-1023.703) [-1019.844] (-1020.938) * [-1019.654] (-1019.556) (-1027.303) (-1021.954) -- 0:00:25 68000 -- (-1020.844) [-1023.401] (-1021.841) (-1019.879) * [-1021.995] (-1019.861) (-1020.452) (-1022.208) -- 0:00:25 68500 -- [-1019.725] (-1020.064) (-1024.738) (-1021.672) * (-1020.505) (-1021.287) (-1021.581) [-1022.189] -- 0:00:25 69000 -- (-1019.842) (-1019.459) [-1020.826] (-1020.404) * (-1020.634) (-1023.292) (-1020.463) [-1021.543] -- 0:00:24 69500 -- (-1020.125) (-1019.359) (-1021.993) [-1020.456] * (-1024.201) (-1019.320) (-1021.929) [-1022.009] -- 0:00:24 70000 -- (-1020.717) (-1021.634) (-1025.951) [-1019.099] * (-1020.268) (-1018.829) [-1019.853] (-1025.480) -- 0:00:30 Average standard deviation of split frequencies: 0.026683 70500 -- [-1019.634] (-1022.005) (-1024.529) (-1022.277) * (-1021.327) (-1018.829) (-1020.749) [-1019.948] -- 0:00:30 71000 -- [-1019.166] (-1020.599) (-1020.999) (-1023.586) * (-1024.158) [-1019.207] (-1020.523) (-1020.089) -- 0:00:30 71500 -- (-1019.385) [-1023.252] (-1022.047) (-1021.801) * [-1023.595] (-1024.312) (-1021.228) (-1020.125) -- 0:00:29 72000 -- (-1022.369) (-1020.849) (-1022.551) [-1020.511] * (-1021.950) [-1024.043] (-1021.738) (-1019.470) -- 0:00:29 72500 -- (-1020.709) (-1020.223) (-1024.116) [-1020.728] * [-1022.474] (-1020.900) (-1020.143) (-1019.593) -- 0:00:29 73000 -- (-1020.222) [-1020.641] (-1023.753) (-1022.790) * (-1020.179) [-1022.487] (-1019.157) (-1019.662) -- 0:00:29 73500 -- [-1021.573] (-1019.968) (-1019.615) (-1024.438) * [-1023.142] (-1023.699) (-1021.363) (-1020.630) -- 0:00:29 74000 -- (-1023.278) [-1020.224] (-1023.228) (-1026.240) * (-1020.233) [-1020.380] (-1020.101) (-1020.851) -- 0:00:28 74500 -- (-1021.406) (-1020.629) (-1024.227) [-1020.794] * (-1024.797) (-1021.575) (-1020.808) [-1020.847] -- 0:00:28 75000 -- (-1022.569) (-1021.017) (-1021.496) [-1021.092] * [-1023.658] (-1020.583) (-1019.837) (-1020.749) -- 0:00:28 Average standard deviation of split frequencies: 0.025697 75500 -- (-1019.961) (-1021.513) (-1020.534) [-1022.188] * [-1022.686] (-1019.686) (-1019.276) (-1021.194) -- 0:00:28 76000 -- (-1021.752) (-1020.870) (-1023.139) [-1023.390] * (-1022.593) [-1022.474] (-1019.276) (-1020.418) -- 0:00:27 76500 -- [-1020.633] (-1020.870) (-1025.444) (-1020.360) * (-1023.396) (-1019.673) (-1019.169) [-1022.871] -- 0:00:27 77000 -- (-1019.529) [-1023.651] (-1026.081) (-1024.489) * [-1022.213] (-1019.791) (-1020.674) (-1022.884) -- 0:00:27 77500 -- [-1020.198] (-1027.341) (-1025.434) (-1023.088) * (-1021.850) [-1023.846] (-1020.480) (-1020.030) -- 0:00:27 78000 -- [-1021.441] (-1021.345) (-1024.894) (-1020.564) * (-1019.735) (-1022.134) [-1018.840] (-1023.875) -- 0:00:27 78500 -- (-1019.772) [-1021.617] (-1020.118) (-1025.808) * (-1020.381) (-1021.119) (-1022.734) [-1020.513] -- 0:00:26 79000 -- (-1020.937) [-1021.195] (-1021.586) (-1024.017) * [-1019.954] (-1023.549) (-1020.330) (-1020.315) -- 0:00:26 79500 -- [-1022.011] (-1023.263) (-1021.146) (-1023.758) * [-1020.627] (-1023.448) (-1021.653) (-1022.909) -- 0:00:26 80000 -- (-1020.037) (-1022.652) [-1019.551] (-1027.910) * (-1022.260) (-1021.827) [-1020.587] (-1022.744) -- 0:00:26 Average standard deviation of split frequencies: 0.031265 80500 -- (-1021.131) [-1021.171] (-1019.803) (-1021.415) * [-1019.409] (-1021.599) (-1020.822) (-1021.683) -- 0:00:26 81000 -- (-1022.360) (-1023.057) (-1020.704) [-1023.058] * (-1019.616) (-1021.130) (-1021.363) [-1024.221] -- 0:00:25 81500 -- (-1021.853) (-1023.333) (-1021.520) [-1021.200] * (-1019.114) (-1020.716) (-1020.596) [-1020.728] -- 0:00:25 82000 -- (-1019.926) [-1020.871] (-1025.188) (-1020.839) * [-1019.506] (-1020.432) (-1022.674) (-1021.104) -- 0:00:25 82500 -- (-1021.500) [-1021.102] (-1019.679) (-1020.764) * (-1020.173) (-1020.929) (-1021.525) [-1019.442] -- 0:00:25 83000 -- [-1019.942] (-1020.340) (-1019.635) (-1023.138) * (-1020.150) [-1019.886] (-1019.092) (-1019.262) -- 0:00:25 83500 -- (-1021.600) (-1020.053) (-1022.924) [-1019.315] * (-1020.423) (-1020.482) (-1020.152) [-1024.116] -- 0:00:24 84000 -- (-1024.910) (-1020.495) [-1021.832] (-1019.089) * [-1020.923] (-1023.222) (-1020.015) (-1020.018) -- 0:00:24 84500 -- (-1025.234) (-1021.471) (-1020.639) [-1019.406] * (-1021.275) (-1023.283) [-1021.039] (-1028.463) -- 0:00:24 85000 -- (-1024.567) (-1021.635) (-1019.820) [-1020.164] * (-1020.835) (-1022.382) [-1024.480] (-1021.226) -- 0:00:24 Average standard deviation of split frequencies: 0.030801 85500 -- (-1023.270) (-1021.000) (-1022.898) [-1020.636] * (-1023.039) (-1019.949) [-1019.831] (-1020.792) -- 0:00:24 86000 -- [-1019.813] (-1021.943) (-1018.737) (-1022.469) * (-1020.537) [-1020.024] (-1019.159) (-1019.552) -- 0:00:28 86500 -- [-1020.622] (-1019.333) (-1022.174) (-1019.514) * (-1023.299) [-1020.362] (-1024.448) (-1020.287) -- 0:00:28 87000 -- (-1020.823) (-1021.490) (-1024.733) [-1019.253] * (-1021.807) (-1023.162) (-1023.084) [-1019.466] -- 0:00:28 87500 -- (-1022.192) (-1022.787) [-1023.153] (-1021.421) * (-1019.952) (-1020.929) [-1022.885] (-1022.352) -- 0:00:28 88000 -- [-1019.607] (-1021.029) (-1022.123) (-1021.341) * (-1020.376) (-1021.234) [-1023.637] (-1020.057) -- 0:00:28 88500 -- [-1019.683] (-1026.098) (-1022.881) (-1020.128) * (-1021.108) (-1021.706) (-1021.521) [-1021.231] -- 0:00:27 89000 -- (-1022.442) (-1019.524) (-1021.436) [-1020.295] * (-1020.429) (-1019.278) (-1023.123) [-1020.412] -- 0:00:27 89500 -- (-1022.562) (-1019.232) [-1021.686] (-1020.051) * [-1019.681] (-1023.225) (-1022.531) (-1020.649) -- 0:00:27 90000 -- (-1021.134) (-1021.677) [-1021.569] (-1019.849) * (-1020.071) (-1021.137) [-1020.610] (-1020.166) -- 0:00:27 Average standard deviation of split frequencies: 0.026776 90500 -- (-1021.882) (-1021.548) (-1021.169) [-1022.202] * [-1019.559] (-1020.225) (-1025.596) (-1020.074) -- 0:00:27 91000 -- (-1027.896) [-1020.715] (-1021.343) (-1022.166) * (-1019.732) (-1021.635) (-1023.168) [-1019.889] -- 0:00:26 91500 -- (-1025.863) (-1020.893) [-1026.382] (-1020.387) * [-1019.545] (-1023.516) (-1020.858) (-1020.894) -- 0:00:26 92000 -- (-1022.781) [-1023.190] (-1021.799) (-1020.262) * (-1022.616) (-1023.764) [-1020.421] (-1020.837) -- 0:00:26 92500 -- (-1025.233) [-1021.260] (-1022.460) (-1019.399) * (-1025.906) [-1022.149] (-1021.090) (-1022.394) -- 0:00:26 93000 -- (-1023.042) (-1019.554) (-1020.621) [-1019.960] * (-1025.800) (-1021.080) [-1022.862] (-1021.818) -- 0:00:26 93500 -- (-1024.892) [-1020.907] (-1019.783) (-1020.280) * (-1026.375) (-1019.538) [-1020.133] (-1022.563) -- 0:00:26 94000 -- (-1020.394) (-1022.488) (-1020.229) [-1020.995] * (-1025.121) [-1020.797] (-1023.825) (-1021.933) -- 0:00:25 94500 -- (-1019.634) (-1023.118) (-1021.500) [-1019.611] * (-1022.606) (-1022.581) [-1020.852] (-1023.334) -- 0:00:25 95000 -- [-1020.371] (-1021.063) (-1021.339) (-1020.070) * (-1020.540) (-1020.648) [-1023.715] (-1020.137) -- 0:00:25 Average standard deviation of split frequencies: 0.027137 95500 -- (-1019.459) (-1020.386) (-1021.173) [-1022.428] * (-1021.070) [-1019.933] (-1022.737) (-1020.992) -- 0:00:25 96000 -- (-1019.023) [-1020.130] (-1024.333) (-1022.490) * (-1019.393) (-1020.601) [-1021.241] (-1020.411) -- 0:00:25 96500 -- (-1019.719) [-1021.765] (-1023.678) (-1020.674) * (-1019.593) [-1022.190] (-1021.892) (-1021.033) -- 0:00:25 97000 -- (-1020.894) (-1021.268) (-1023.621) [-1021.472] * (-1020.764) [-1022.975] (-1020.486) (-1020.409) -- 0:00:24 97500 -- (-1021.105) (-1019.929) (-1026.027) [-1020.471] * [-1019.677] (-1025.189) (-1019.984) (-1022.953) -- 0:00:24 98000 -- (-1021.385) (-1019.706) [-1021.933] (-1021.339) * [-1019.188] (-1026.786) (-1021.798) (-1022.957) -- 0:00:24 98500 -- (-1025.098) (-1020.116) [-1020.131] (-1020.714) * (-1019.979) (-1022.743) (-1021.115) [-1024.415] -- 0:00:24 99000 -- (-1024.982) (-1024.372) [-1019.729] (-1019.832) * (-1019.305) (-1020.145) [-1019.726] (-1021.491) -- 0:00:24 99500 -- (-1019.779) (-1022.979) [-1022.453] (-1023.197) * [-1019.314] (-1021.149) (-1020.584) (-1021.415) -- 0:00:24 100000 -- (-1020.884) [-1023.369] (-1021.497) (-1022.956) * [-1019.711] (-1023.621) (-1019.818) (-1024.414) -- 0:00:24 Average standard deviation of split frequencies: 0.028343 100500 -- (-1020.169) (-1021.730) (-1024.885) [-1019.842] * (-1020.137) (-1024.463) [-1019.275] (-1018.987) -- 0:00:23 101000 -- (-1025.455) (-1021.247) (-1022.117) [-1021.858] * (-1019.398) (-1022.233) [-1021.113] (-1018.957) -- 0:00:23 101500 -- (-1028.814) (-1021.129) [-1022.659] (-1021.706) * (-1021.086) [-1020.184] (-1019.799) (-1020.403) -- 0:00:27 102000 -- [-1019.109] (-1019.986) (-1023.706) (-1023.571) * (-1021.025) (-1020.082) [-1020.169] (-1020.967) -- 0:00:27 102500 -- (-1019.244) (-1021.668) (-1024.615) [-1019.982] * (-1022.380) (-1019.995) (-1021.864) [-1018.999] -- 0:00:27 103000 -- [-1021.603] (-1023.322) (-1023.029) (-1020.554) * [-1018.888] (-1021.289) (-1019.521) (-1018.974) -- 0:00:26 103500 -- (-1022.101) [-1023.996] (-1020.693) (-1020.248) * (-1019.817) [-1020.897] (-1021.872) (-1020.499) -- 0:00:26 104000 -- (-1023.327) [-1020.598] (-1020.220) (-1020.569) * (-1019.723) (-1019.759) (-1019.731) [-1020.287] -- 0:00:26 104500 -- (-1021.146) [-1023.295] (-1022.766) (-1022.385) * (-1019.557) [-1020.064] (-1024.596) (-1019.577) -- 0:00:26 105000 -- (-1022.075) [-1021.195] (-1020.892) (-1025.244) * [-1020.753] (-1026.133) (-1021.851) (-1019.896) -- 0:00:26 Average standard deviation of split frequencies: 0.026917 105500 -- (-1020.175) (-1025.472) (-1021.480) [-1021.945] * (-1023.674) [-1020.269] (-1021.743) (-1021.731) -- 0:00:26 106000 -- [-1020.213] (-1024.936) (-1020.905) (-1021.369) * (-1019.463) (-1020.803) (-1019.907) [-1019.528] -- 0:00:26 106500 -- (-1020.502) (-1023.338) [-1020.152] (-1021.678) * (-1023.245) (-1022.160) [-1019.930] (-1022.111) -- 0:00:25 107000 -- (-1019.813) (-1021.859) (-1020.494) [-1021.198] * (-1022.614) (-1027.431) [-1020.630] (-1026.053) -- 0:00:25 107500 -- (-1021.154) (-1019.949) (-1022.510) [-1020.918] * (-1022.216) (-1021.173) [-1019.971] (-1022.105) -- 0:00:25 108000 -- (-1019.777) (-1020.007) [-1021.335] (-1020.776) * (-1022.216) (-1022.610) (-1021.844) [-1021.671] -- 0:00:25 108500 -- [-1020.667] (-1024.553) (-1020.134) (-1021.565) * [-1019.619] (-1021.302) (-1019.568) (-1019.845) -- 0:00:25 109000 -- (-1025.388) (-1022.773) [-1020.787] (-1023.034) * (-1021.431) (-1024.365) [-1019.492] (-1022.370) -- 0:00:25 109500 -- (-1022.278) [-1020.952] (-1020.510) (-1023.375) * (-1021.889) (-1021.061) (-1024.958) [-1022.755] -- 0:00:24 110000 -- (-1021.122) (-1026.011) [-1020.752] (-1021.334) * (-1021.406) (-1021.791) (-1020.662) [-1020.772] -- 0:00:24 Average standard deviation of split frequencies: 0.026455 110500 -- (-1023.108) (-1022.584) (-1021.298) [-1022.953] * [-1019.760] (-1020.963) (-1019.509) (-1023.241) -- 0:00:24 111000 -- (-1024.423) (-1020.022) (-1020.932) [-1024.439] * [-1023.598] (-1020.817) (-1019.566) (-1031.852) -- 0:00:24 111500 -- (-1023.299) (-1020.783) (-1022.375) [-1026.799] * (-1024.101) (-1021.183) [-1018.978] (-1025.726) -- 0:00:24 112000 -- [-1022.346] (-1021.261) (-1023.835) (-1025.752) * (-1021.659) (-1021.037) (-1019.647) [-1020.571] -- 0:00:24 112500 -- [-1019.283] (-1021.197) (-1024.239) (-1025.747) * (-1024.538) [-1021.608] (-1019.566) (-1020.840) -- 0:00:24 113000 -- [-1019.578] (-1022.874) (-1020.778) (-1026.631) * (-1019.583) (-1021.043) [-1019.807] (-1021.489) -- 0:00:23 113500 -- [-1021.668] (-1019.838) (-1019.369) (-1029.909) * (-1020.274) (-1019.594) (-1020.998) [-1022.046] -- 0:00:23 114000 -- (-1021.783) (-1021.477) [-1020.463] (-1023.915) * (-1021.561) (-1019.428) [-1019.052] (-1021.294) -- 0:00:23 114500 -- (-1023.461) (-1020.470) (-1020.426) [-1023.082] * (-1020.465) [-1019.529] (-1021.708) (-1019.145) -- 0:00:23 115000 -- (-1021.919) [-1021.268] (-1021.351) (-1025.056) * (-1020.349) (-1020.311) [-1021.552] (-1023.598) -- 0:00:23 Average standard deviation of split frequencies: 0.023955 115500 -- (-1022.616) (-1024.256) [-1021.089] (-1024.727) * (-1019.916) (-1020.811) (-1023.013) [-1021.962] -- 0:00:23 116000 -- (-1022.471) (-1024.019) [-1020.873] (-1026.348) * (-1020.356) (-1019.563) [-1022.118] (-1020.537) -- 0:00:23 116500 -- (-1024.238) (-1020.145) [-1020.851] (-1021.917) * (-1020.412) (-1019.110) [-1020.175] (-1020.183) -- 0:00:26 117000 -- (-1023.943) (-1021.878) (-1020.062) [-1021.553] * (-1019.729) [-1019.110] (-1019.946) (-1021.665) -- 0:00:26 117500 -- [-1022.940] (-1023.371) (-1020.910) (-1023.613) * (-1019.815) (-1021.113) (-1022.695) [-1020.192] -- 0:00:26 118000 -- (-1021.791) [-1021.459] (-1023.688) (-1021.988) * (-1019.092) (-1021.627) (-1022.529) [-1020.313] -- 0:00:25 118500 -- (-1020.483) [-1020.288] (-1020.213) (-1028.338) * (-1024.012) (-1021.910) [-1020.519] (-1021.459) -- 0:00:25 119000 -- (-1020.471) (-1021.590) [-1020.037] (-1024.424) * (-1023.817) (-1022.306) (-1019.917) [-1020.610] -- 0:00:25 119500 -- (-1022.854) (-1020.020) (-1020.297) [-1022.986] * (-1021.225) (-1021.798) [-1019.895] (-1024.632) -- 0:00:25 120000 -- (-1022.579) (-1021.826) (-1021.018) [-1021.237] * (-1023.005) (-1019.984) [-1020.376] (-1023.249) -- 0:00:25 Average standard deviation of split frequencies: 0.024742 120500 -- [-1021.850] (-1019.183) (-1019.837) (-1019.104) * (-1020.191) (-1023.862) (-1019.024) [-1022.254] -- 0:00:25 121000 -- (-1020.287) (-1020.716) (-1020.412) [-1019.232] * [-1019.406] (-1021.454) (-1019.423) (-1022.455) -- 0:00:25 121500 -- [-1021.508] (-1021.930) (-1022.096) (-1019.441) * [-1020.266] (-1021.936) (-1019.973) (-1021.752) -- 0:00:24 122000 -- [-1020.218] (-1022.995) (-1022.642) (-1019.811) * (-1023.398) [-1020.756] (-1019.630) (-1022.469) -- 0:00:24 122500 -- (-1020.121) [-1022.316] (-1020.115) (-1019.808) * (-1019.028) [-1022.058] (-1020.354) (-1020.490) -- 0:00:24 123000 -- (-1020.930) [-1021.364] (-1023.768) (-1020.047) * [-1019.915] (-1020.842) (-1022.225) (-1021.265) -- 0:00:24 123500 -- (-1019.493) (-1021.307) (-1024.035) [-1019.706] * (-1021.474) [-1020.821] (-1022.716) (-1022.583) -- 0:00:24 124000 -- [-1020.399] (-1020.648) (-1023.962) (-1019.812) * [-1020.526] (-1021.009) (-1020.095) (-1021.969) -- 0:00:24 124500 -- (-1019.832) [-1020.863] (-1023.000) (-1019.693) * (-1021.920) (-1021.456) (-1020.798) [-1023.266] -- 0:00:24 125000 -- (-1020.118) (-1024.325) [-1021.672] (-1021.859) * (-1021.078) [-1019.487] (-1019.264) (-1022.415) -- 0:00:24 Average standard deviation of split frequencies: 0.022982 125500 -- [-1021.446] (-1022.361) (-1029.008) (-1021.961) * (-1018.969) [-1020.214] (-1021.105) (-1021.317) -- 0:00:23 126000 -- (-1019.940) [-1020.485] (-1027.303) (-1024.499) * (-1020.122) (-1019.559) [-1018.967] (-1020.387) -- 0:00:23 126500 -- (-1019.262) [-1022.802] (-1021.794) (-1020.292) * (-1019.063) (-1019.453) [-1019.961] (-1025.995) -- 0:00:23 127000 -- (-1020.353) [-1019.606] (-1022.707) (-1020.037) * (-1022.117) (-1020.542) [-1020.343] (-1021.329) -- 0:00:23 127500 -- (-1021.482) [-1020.053] (-1024.871) (-1023.684) * (-1019.973) (-1023.208) [-1020.971] (-1024.285) -- 0:00:23 128000 -- (-1023.340) [-1022.514] (-1022.283) (-1020.832) * [-1020.867] (-1023.748) (-1019.315) (-1023.629) -- 0:00:23 128500 -- [-1019.993] (-1021.118) (-1021.158) (-1023.328) * (-1021.047) [-1021.886] (-1020.341) (-1024.898) -- 0:00:23 129000 -- (-1019.422) [-1019.842] (-1021.559) (-1024.040) * (-1018.970) [-1021.611] (-1020.409) (-1020.526) -- 0:00:23 129500 -- [-1020.595] (-1023.632) (-1020.600) (-1022.775) * [-1021.539] (-1019.183) (-1020.678) (-1020.170) -- 0:00:22 130000 -- (-1021.289) (-1021.828) [-1019.533] (-1020.291) * (-1019.882) (-1019.190) [-1024.075] (-1020.022) -- 0:00:22 Average standard deviation of split frequencies: 0.024532 130500 -- (-1019.548) (-1019.690) [-1018.856] (-1022.649) * (-1020.627) (-1020.651) [-1022.643] (-1020.550) -- 0:00:22 131000 -- (-1020.478) (-1019.016) (-1023.145) [-1021.026] * (-1020.863) (-1019.563) (-1020.926) [-1020.030] -- 0:00:22 131500 -- (-1021.937) (-1020.987) (-1019.983) [-1020.278] * (-1021.060) (-1025.603) [-1021.270] (-1019.742) -- 0:00:22 132000 -- [-1023.079] (-1020.125) (-1020.634) (-1019.666) * (-1021.841) (-1021.042) (-1019.734) [-1023.287] -- 0:00:25 132500 -- (-1020.858) (-1023.317) (-1019.637) [-1019.195] * (-1021.520) (-1019.971) (-1020.992) [-1019.885] -- 0:00:24 133000 -- (-1020.782) (-1020.426) [-1021.999] (-1021.629) * (-1021.375) [-1019.371] (-1019.152) (-1019.892) -- 0:00:24 133500 -- [-1023.290] (-1022.291) (-1022.095) (-1019.254) * (-1022.291) [-1019.272] (-1020.965) (-1020.445) -- 0:00:24 134000 -- (-1021.587) (-1023.916) (-1022.384) [-1022.223] * (-1019.563) [-1019.564] (-1020.267) (-1020.354) -- 0:00:24 134500 -- (-1022.347) [-1021.825] (-1022.035) (-1020.739) * (-1022.123) (-1020.555) [-1021.169] (-1019.998) -- 0:00:24 135000 -- (-1021.218) (-1021.343) [-1020.558] (-1019.931) * (-1024.006) (-1019.932) (-1021.546) [-1020.224] -- 0:00:24 Average standard deviation of split frequencies: 0.024628 135500 -- (-1022.353) (-1022.298) [-1019.775] (-1022.237) * (-1022.533) (-1019.457) (-1021.110) [-1021.470] -- 0:00:24 136000 -- (-1018.854) (-1022.661) [-1019.854] (-1020.135) * (-1026.914) (-1020.392) (-1021.692) [-1022.510] -- 0:00:24 136500 -- (-1018.854) (-1021.925) (-1022.106) [-1020.251] * (-1020.296) (-1020.547) (-1021.073) [-1021.281] -- 0:00:23 137000 -- (-1019.522) [-1021.720] (-1022.585) (-1020.508) * (-1020.918) (-1019.964) [-1021.197] (-1020.436) -- 0:00:23 137500 -- (-1020.385) (-1030.087) [-1022.829] (-1022.103) * [-1019.258] (-1018.858) (-1019.559) (-1023.250) -- 0:00:23 138000 -- [-1020.503] (-1025.576) (-1024.051) (-1023.047) * (-1021.189) (-1020.313) [-1020.632] (-1020.873) -- 0:00:23 138500 -- (-1021.993) (-1024.465) (-1021.194) [-1021.173] * [-1022.095] (-1020.934) (-1021.343) (-1023.276) -- 0:00:23 139000 -- (-1021.712) (-1024.742) (-1019.632) [-1022.318] * [-1020.871] (-1022.436) (-1019.919) (-1025.748) -- 0:00:23 139500 -- (-1020.961) (-1024.198) (-1022.470) [-1022.073] * [-1020.526] (-1023.997) (-1022.475) (-1022.702) -- 0:00:23 140000 -- (-1024.411) (-1025.248) (-1019.180) [-1020.453] * (-1019.993) [-1020.280] (-1023.870) (-1021.267) -- 0:00:23 Average standard deviation of split frequencies: 0.026810 140500 -- (-1024.412) [-1022.573] (-1021.305) (-1021.558) * (-1020.187) (-1021.268) (-1020.318) [-1021.240] -- 0:00:23 141000 -- (-1021.215) (-1022.978) [-1020.142] (-1021.248) * (-1020.195) (-1020.180) [-1019.606] (-1022.395) -- 0:00:22 141500 -- (-1023.336) (-1020.198) [-1021.425] (-1021.498) * [-1019.904] (-1019.441) (-1019.879) (-1022.101) -- 0:00:22 142000 -- (-1021.493) [-1021.663] (-1020.667) (-1019.005) * (-1021.073) (-1022.086) [-1019.967] (-1021.944) -- 0:00:22 142500 -- (-1022.052) (-1024.153) [-1019.976] (-1019.090) * [-1020.533] (-1020.487) (-1020.951) (-1019.999) -- 0:00:22 143000 -- (-1022.650) (-1019.761) (-1020.997) [-1021.683] * (-1024.321) (-1020.493) [-1020.486] (-1019.598) -- 0:00:22 143500 -- (-1021.534) [-1021.272] (-1019.539) (-1019.489) * (-1023.634) (-1021.980) (-1021.989) [-1022.110] -- 0:00:22 144000 -- (-1021.770) (-1022.002) [-1021.031] (-1021.226) * (-1019.906) [-1020.937] (-1020.429) (-1030.365) -- 0:00:22 144500 -- (-1027.900) [-1021.210] (-1020.784) (-1020.870) * (-1023.314) (-1020.396) [-1020.950] (-1027.999) -- 0:00:22 145000 -- [-1022.685] (-1026.546) (-1022.228) (-1019.603) * (-1027.814) (-1022.116) [-1019.224] (-1023.092) -- 0:00:22 Average standard deviation of split frequencies: 0.026000 145500 -- (-1032.256) [-1020.497] (-1021.543) (-1024.159) * (-1022.773) (-1020.982) (-1019.800) [-1021.475] -- 0:00:21 146000 -- (-1029.436) (-1019.776) [-1022.258] (-1021.561) * (-1023.109) [-1021.241] (-1022.549) (-1024.900) -- 0:00:21 146500 -- (-1022.676) (-1020.334) [-1020.289] (-1020.696) * [-1021.784] (-1020.495) (-1020.851) (-1026.091) -- 0:00:21 147000 -- [-1021.889] (-1020.385) (-1022.547) (-1020.513) * [-1021.787] (-1019.966) (-1022.045) (-1023.098) -- 0:00:21 147500 -- (-1019.474) [-1022.034] (-1021.467) (-1019.697) * (-1024.318) [-1024.906] (-1022.572) (-1023.089) -- 0:00:21 148000 -- [-1020.024] (-1024.836) (-1020.960) (-1022.592) * [-1020.256] (-1024.321) (-1022.701) (-1021.324) -- 0:00:23 148500 -- (-1021.750) (-1025.724) (-1019.653) [-1019.094] * (-1024.072) (-1023.662) (-1018.943) [-1023.964] -- 0:00:23 149000 -- (-1019.211) (-1026.513) (-1021.055) [-1019.235] * (-1020.840) (-1020.672) (-1022.475) [-1019.612] -- 0:00:23 149500 -- (-1019.043) [-1022.427] (-1020.764) (-1020.284) * [-1022.167] (-1021.412) (-1019.620) (-1019.111) -- 0:00:23 150000 -- (-1018.996) (-1020.418) (-1021.821) [-1019.524] * (-1019.731) (-1020.777) [-1019.523] (-1021.713) -- 0:00:23 Average standard deviation of split frequencies: 0.025726 150500 -- [-1018.844] (-1024.074) (-1021.943) (-1019.641) * [-1019.082] (-1021.165) (-1019.068) (-1023.291) -- 0:00:23 151000 -- (-1020.367) [-1021.532] (-1021.018) (-1020.218) * (-1021.922) [-1020.209] (-1022.753) (-1020.073) -- 0:00:23 151500 -- (-1020.104) (-1020.159) [-1020.900] (-1022.619) * (-1020.240) (-1020.303) [-1021.387] (-1019.643) -- 0:00:23 152000 -- (-1030.998) (-1021.498) (-1019.975) [-1020.821] * (-1020.863) (-1019.318) (-1024.123) [-1020.782] -- 0:00:22 152500 -- [-1020.365] (-1021.140) (-1019.999) (-1023.872) * (-1019.789) [-1021.190] (-1021.299) (-1020.627) -- 0:00:22 153000 -- (-1022.351) (-1021.729) (-1025.363) [-1021.024] * [-1020.567] (-1020.842) (-1024.414) (-1019.585) -- 0:00:22 153500 -- (-1022.478) [-1020.772] (-1019.172) (-1019.947) * (-1019.661) [-1022.971] (-1022.149) (-1020.087) -- 0:00:22 154000 -- [-1019.889] (-1022.742) (-1019.118) (-1019.746) * (-1022.355) (-1021.357) [-1024.387] (-1024.836) -- 0:00:22 154500 -- (-1020.532) (-1022.335) [-1020.747] (-1023.569) * (-1020.761) (-1026.060) [-1030.005] (-1021.848) -- 0:00:22 155000 -- (-1021.904) (-1018.833) [-1020.124] (-1023.237) * [-1021.266] (-1023.628) (-1026.042) (-1023.092) -- 0:00:22 Average standard deviation of split frequencies: 0.025182 155500 -- (-1024.502) [-1018.833] (-1020.005) (-1023.941) * (-1021.511) [-1022.505] (-1023.310) (-1021.382) -- 0:00:22 156000 -- (-1021.115) [-1021.896] (-1019.539) (-1022.901) * (-1023.609) (-1022.581) [-1021.105] (-1019.441) -- 0:00:22 156500 -- (-1020.577) [-1020.906] (-1020.375) (-1021.814) * [-1020.275] (-1022.272) (-1023.099) (-1019.514) -- 0:00:21 157000 -- (-1020.160) (-1020.000) [-1021.084] (-1022.848) * (-1020.106) [-1022.168] (-1022.720) (-1019.409) -- 0:00:21 157500 -- (-1019.294) [-1020.509] (-1021.896) (-1020.982) * (-1019.508) (-1022.190) (-1019.084) [-1022.233] -- 0:00:21 158000 -- (-1020.927) (-1022.296) (-1022.558) [-1020.314] * (-1019.741) (-1023.736) (-1019.897) [-1021.436] -- 0:00:21 158500 -- [-1020.773] (-1025.844) (-1022.247) (-1022.141) * (-1021.024) [-1021.180] (-1020.408) (-1020.444) -- 0:00:21 159000 -- [-1020.238] (-1022.596) (-1023.860) (-1021.773) * (-1020.659) (-1020.894) (-1021.658) [-1022.388] -- 0:00:21 159500 -- (-1024.475) (-1023.515) (-1019.685) [-1020.352] * (-1021.912) (-1019.508) (-1021.702) [-1020.837] -- 0:00:21 160000 -- (-1024.036) (-1026.234) [-1019.588] (-1021.584) * (-1020.408) [-1019.345] (-1023.697) (-1019.784) -- 0:00:21 Average standard deviation of split frequencies: 0.024853 160500 -- (-1022.944) [-1024.337] (-1023.232) (-1019.740) * (-1020.269) [-1020.507] (-1025.019) (-1019.599) -- 0:00:21 161000 -- (-1019.659) (-1022.075) [-1018.936] (-1020.164) * (-1019.296) (-1021.479) [-1019.755] (-1020.598) -- 0:00:21 161500 -- [-1020.736] (-1021.055) (-1019.410) (-1019.925) * (-1024.497) (-1020.469) (-1020.590) [-1022.106] -- 0:00:20 162000 -- (-1020.839) (-1019.000) (-1023.006) [-1022.009] * (-1024.034) [-1020.151] (-1021.174) (-1019.939) -- 0:00:20 162500 -- (-1023.228) (-1022.716) [-1021.848] (-1022.316) * (-1020.649) [-1019.780] (-1020.544) (-1021.219) -- 0:00:20 163000 -- (-1027.297) (-1023.864) [-1019.109] (-1022.387) * (-1020.528) [-1020.181] (-1019.811) (-1024.610) -- 0:00:20 163500 -- (-1025.026) (-1020.882) [-1020.633] (-1019.568) * (-1020.967) [-1019.179] (-1020.306) (-1025.565) -- 0:00:20 164000 -- (-1021.541) [-1020.047] (-1021.630) (-1019.483) * (-1021.616) (-1021.146) [-1019.678] (-1019.310) -- 0:00:22 164500 -- [-1022.005] (-1021.452) (-1019.720) (-1019.373) * (-1022.072) (-1020.154) (-1025.755) [-1019.395] -- 0:00:22 165000 -- [-1021.520] (-1021.613) (-1023.353) (-1022.082) * (-1020.705) (-1020.162) [-1027.667] (-1020.852) -- 0:00:22 Average standard deviation of split frequencies: 0.024661 165500 -- [-1018.879] (-1020.649) (-1020.550) (-1023.570) * [-1019.253] (-1020.289) (-1030.939) (-1026.479) -- 0:00:22 166000 -- (-1018.819) [-1021.236] (-1022.225) (-1020.781) * (-1023.067) [-1020.197] (-1023.758) (-1021.083) -- 0:00:22 166500 -- (-1019.727) (-1020.786) (-1021.679) [-1019.678] * (-1024.077) [-1020.820] (-1023.384) (-1021.157) -- 0:00:22 167000 -- [-1020.629] (-1021.219) (-1020.012) (-1022.734) * (-1022.827) (-1020.847) (-1025.859) [-1020.097] -- 0:00:21 167500 -- (-1019.630) [-1021.840] (-1021.379) (-1021.948) * (-1023.584) [-1021.181] (-1020.726) (-1021.837) -- 0:00:21 168000 -- (-1021.902) (-1022.020) (-1022.174) [-1021.173] * (-1019.385) (-1019.781) (-1019.389) [-1019.369] -- 0:00:21 168500 -- [-1024.955] (-1021.619) (-1021.143) (-1022.117) * (-1025.165) (-1021.215) (-1023.554) [-1021.811] -- 0:00:21 169000 -- [-1025.768] (-1020.620) (-1029.673) (-1022.580) * (-1021.806) (-1023.135) [-1019.606] (-1019.360) -- 0:00:21 169500 -- (-1020.546) [-1019.958] (-1022.637) (-1021.358) * (-1019.595) (-1023.839) [-1025.048] (-1020.137) -- 0:00:21 170000 -- (-1019.387) (-1024.695) (-1018.850) [-1022.996] * [-1021.390] (-1019.824) (-1023.212) (-1022.206) -- 0:00:21 Average standard deviation of split frequencies: 0.025005 170500 -- (-1019.155) (-1024.201) (-1018.857) [-1021.860] * (-1023.213) (-1019.893) (-1022.378) [-1021.862] -- 0:00:21 171000 -- [-1019.427] (-1022.828) (-1019.641) (-1021.210) * (-1022.815) (-1021.472) [-1021.429] (-1021.892) -- 0:00:21 171500 -- (-1022.073) [-1021.269] (-1019.985) (-1020.642) * (-1024.490) (-1021.292) [-1021.210] (-1022.217) -- 0:00:21 172000 -- [-1022.051] (-1021.139) (-1022.161) (-1020.997) * (-1020.493) (-1026.347) (-1020.036) [-1020.324] -- 0:00:20 172500 -- (-1022.405) (-1019.918) (-1019.683) [-1020.331] * (-1020.203) (-1022.077) [-1019.666] (-1021.732) -- 0:00:20 173000 -- (-1024.468) [-1019.129] (-1020.480) (-1024.276) * (-1020.339) (-1026.958) [-1021.933] (-1019.771) -- 0:00:20 173500 -- (-1026.177) (-1020.605) [-1019.027] (-1022.537) * (-1021.246) (-1024.120) [-1019.929] (-1023.213) -- 0:00:20 174000 -- (-1023.170) [-1021.955] (-1019.850) (-1020.728) * (-1022.810) (-1020.499) [-1020.530] (-1023.057) -- 0:00:20 174500 -- (-1020.867) (-1021.013) (-1021.146) [-1020.980] * (-1024.219) [-1020.322] (-1020.161) (-1023.879) -- 0:00:20 175000 -- (-1019.050) (-1021.284) [-1019.273] (-1019.665) * (-1020.827) [-1024.613] (-1020.736) (-1021.435) -- 0:00:20 Average standard deviation of split frequencies: 0.021991 175500 -- (-1019.860) [-1019.163] (-1021.694) (-1023.913) * (-1020.533) (-1021.846) [-1021.349] (-1023.940) -- 0:00:20 176000 -- [-1018.805] (-1019.014) (-1024.077) (-1024.583) * (-1020.726) (-1020.728) (-1021.234) [-1020.379] -- 0:00:20 176500 -- (-1020.117) (-1019.442) (-1025.869) [-1021.557] * [-1020.761] (-1020.790) (-1021.060) (-1021.455) -- 0:00:20 177000 -- (-1019.575) (-1019.219) (-1021.634) [-1021.457] * (-1020.069) [-1018.966] (-1021.524) (-1023.083) -- 0:00:20 177500 -- (-1019.501) (-1025.121) [-1019.821] (-1019.780) * (-1020.980) (-1021.598) [-1020.195] (-1020.889) -- 0:00:19 178000 -- (-1020.828) (-1020.799) (-1019.634) [-1019.991] * (-1021.502) (-1019.231) [-1022.598] (-1022.391) -- 0:00:19 178500 -- (-1019.366) (-1019.250) (-1020.863) [-1019.417] * (-1023.396) (-1019.487) [-1027.696] (-1020.701) -- 0:00:19 179000 -- (-1022.660) (-1019.614) [-1019.087] (-1019.557) * (-1020.942) (-1020.385) [-1029.183] (-1019.349) -- 0:00:19 179500 -- (-1023.105) [-1020.320] (-1019.690) (-1020.141) * (-1019.655) (-1019.224) (-1020.360) [-1020.031] -- 0:00:19 180000 -- (-1024.007) [-1020.431] (-1020.326) (-1020.063) * (-1019.657) (-1022.223) (-1022.654) [-1020.105] -- 0:00:19 Average standard deviation of split frequencies: 0.020325 180500 -- [-1024.175] (-1021.596) (-1020.605) (-1021.510) * (-1020.659) (-1019.917) [-1020.787] (-1020.614) -- 0:00:21 181000 -- (-1019.267) (-1021.925) [-1019.845] (-1022.048) * (-1021.573) [-1020.983] (-1022.907) (-1020.798) -- 0:00:21 181500 -- (-1019.387) (-1022.236) (-1023.154) [-1022.292] * (-1019.596) [-1024.127] (-1021.272) (-1020.268) -- 0:00:21 182000 -- (-1019.411) (-1020.741) [-1020.352] (-1024.064) * (-1021.202) [-1021.379] (-1023.624) (-1021.738) -- 0:00:20 182500 -- (-1021.531) [-1019.156] (-1020.789) (-1021.517) * (-1020.741) (-1021.035) [-1021.911] (-1027.400) -- 0:00:20 183000 -- [-1021.569] (-1019.624) (-1020.460) (-1022.686) * [-1019.185] (-1020.318) (-1022.242) (-1020.783) -- 0:00:20 183500 -- (-1021.186) [-1022.756] (-1020.178) (-1020.686) * (-1022.163) [-1023.227] (-1021.560) (-1023.812) -- 0:00:20 184000 -- (-1020.994) (-1019.574) (-1021.152) [-1020.370] * (-1021.403) [-1019.803] (-1021.462) (-1022.060) -- 0:00:20 184500 -- (-1018.946) [-1020.424] (-1022.160) (-1019.675) * (-1025.163) (-1020.014) [-1020.828] (-1020.776) -- 0:00:20 185000 -- (-1019.058) [-1021.900] (-1021.565) (-1019.679) * (-1023.607) (-1020.681) (-1020.341) [-1020.709] -- 0:00:20 Average standard deviation of split frequencies: 0.023744 185500 -- (-1021.738) (-1026.832) [-1020.482] (-1022.207) * (-1022.285) (-1021.837) [-1021.750] (-1023.148) -- 0:00:20 186000 -- (-1026.280) (-1019.396) [-1021.374] (-1021.224) * (-1023.017) [-1019.943] (-1020.312) (-1023.253) -- 0:00:20 186500 -- (-1023.153) (-1020.745) [-1023.081] (-1021.671) * (-1025.671) [-1019.407] (-1020.524) (-1021.207) -- 0:00:20 187000 -- (-1024.773) [-1019.409] (-1022.983) (-1020.712) * (-1022.408) (-1019.426) (-1019.120) [-1023.399] -- 0:00:20 187500 -- (-1021.655) [-1029.354] (-1024.079) (-1020.280) * (-1022.398) (-1022.356) (-1021.304) [-1020.035] -- 0:00:20 188000 -- (-1020.165) [-1020.223] (-1024.633) (-1022.203) * (-1023.244) (-1025.131) (-1024.113) [-1021.897] -- 0:00:19 188500 -- (-1020.452) (-1020.938) [-1020.513] (-1021.786) * (-1024.027) (-1023.153) (-1024.376) [-1025.172] -- 0:00:19 189000 -- (-1022.233) [-1020.004] (-1024.903) (-1020.011) * (-1025.484) [-1019.109] (-1020.101) (-1022.138) -- 0:00:19 189500 -- (-1020.660) [-1024.355] (-1021.577) (-1020.119) * (-1023.418) [-1020.424] (-1024.496) (-1020.299) -- 0:00:19 190000 -- (-1022.514) [-1024.806] (-1021.598) (-1020.408) * (-1022.841) (-1020.245) (-1021.805) [-1020.161] -- 0:00:19 Average standard deviation of split frequencies: 0.022252 190500 -- (-1021.647) (-1020.486) [-1020.822] (-1021.836) * [-1020.239] (-1019.321) (-1021.005) (-1019.402) -- 0:00:19 191000 -- (-1020.084) [-1020.481] (-1022.112) (-1022.847) * (-1019.787) [-1021.290] (-1020.524) (-1019.762) -- 0:00:19 191500 -- (-1021.000) (-1020.551) (-1021.148) [-1020.538] * (-1021.200) (-1020.795) (-1019.252) [-1020.232] -- 0:00:19 192000 -- (-1018.701) (-1024.496) [-1019.513] (-1021.003) * (-1021.592) [-1021.463] (-1022.054) (-1020.177) -- 0:00:19 192500 -- [-1019.278] (-1021.841) (-1020.667) (-1023.479) * (-1022.892) (-1019.837) (-1022.871) [-1021.918] -- 0:00:19 193000 -- [-1019.117] (-1022.570) (-1019.383) (-1023.688) * (-1021.520) (-1019.973) [-1022.768] (-1025.369) -- 0:00:19 193500 -- (-1020.544) (-1023.648) (-1022.512) [-1025.609] * (-1019.922) [-1022.482] (-1021.026) (-1021.461) -- 0:00:19 194000 -- (-1020.479) (-1023.007) [-1019.518] (-1026.616) * (-1019.427) (-1022.485) (-1020.482) [-1021.485] -- 0:00:18 194500 -- (-1019.961) (-1025.194) (-1021.436) [-1022.851] * (-1019.537) (-1021.795) [-1019.356] (-1022.952) -- 0:00:18 195000 -- (-1020.349) [-1023.769] (-1020.203) (-1025.105) * (-1020.753) (-1019.893) [-1018.857] (-1020.769) -- 0:00:18 Average standard deviation of split frequencies: 0.021520 195500 -- [-1021.088] (-1022.392) (-1019.831) (-1022.026) * (-1019.931) (-1020.266) (-1019.350) [-1020.295] -- 0:00:18 196000 -- (-1023.438) [-1020.344] (-1024.806) (-1021.926) * [-1019.067] (-1022.093) (-1019.649) (-1024.883) -- 0:00:18 196500 -- (-1020.236) [-1021.070] (-1024.347) (-1021.911) * (-1023.403) [-1020.067] (-1021.570) (-1023.693) -- 0:00:20 197000 -- (-1021.301) [-1020.439] (-1024.901) (-1021.136) * [-1019.810] (-1021.045) (-1023.693) (-1019.993) -- 0:00:19 197500 -- [-1021.075] (-1021.380) (-1024.310) (-1019.750) * [-1019.248] (-1019.995) (-1019.372) (-1019.946) -- 0:00:19 198000 -- [-1022.312] (-1023.316) (-1020.336) (-1022.398) * (-1019.067) (-1021.879) (-1020.194) [-1022.806] -- 0:00:19 198500 -- (-1023.787) (-1021.952) [-1024.788] (-1023.827) * [-1019.111] (-1021.971) (-1020.712) (-1021.234) -- 0:00:19 199000 -- (-1024.324) (-1020.994) (-1024.911) [-1022.206] * (-1024.116) (-1023.067) [-1019.100] (-1021.011) -- 0:00:19 199500 -- [-1020.775] (-1019.180) (-1024.611) (-1023.325) * (-1021.188) (-1021.866) [-1019.096] (-1018.940) -- 0:00:19 200000 -- (-1019.479) (-1021.795) (-1023.645) [-1021.384] * (-1020.293) (-1020.810) (-1020.759) [-1022.796] -- 0:00:19 Average standard deviation of split frequencies: 0.022008 200500 -- [-1019.669] (-1021.835) (-1020.679) (-1021.913) * (-1025.362) [-1019.809] (-1019.552) (-1019.962) -- 0:00:19 201000 -- (-1022.795) [-1025.790] (-1020.091) (-1021.919) * (-1019.779) [-1021.793] (-1020.824) (-1020.138) -- 0:00:19 201500 -- (-1020.021) [-1020.288] (-1022.319) (-1020.920) * [-1019.705] (-1020.256) (-1022.276) (-1020.235) -- 0:00:19 202000 -- (-1021.080) (-1019.197) (-1021.084) [-1020.659] * [-1021.703] (-1020.961) (-1021.587) (-1020.663) -- 0:00:19 202500 -- [-1021.010] (-1020.720) (-1024.996) (-1020.930) * (-1023.786) (-1020.449) [-1021.151] (-1020.184) -- 0:00:19 203000 -- (-1019.961) (-1021.793) (-1021.328) [-1021.303] * (-1020.125) (-1021.279) [-1021.943] (-1020.137) -- 0:00:19 203500 -- [-1020.412] (-1023.324) (-1021.132) (-1019.492) * (-1022.590) (-1020.983) [-1020.902] (-1020.893) -- 0:00:18 204000 -- [-1020.890] (-1024.048) (-1020.441) (-1020.063) * [-1023.613] (-1021.072) (-1021.457) (-1019.345) -- 0:00:18 204500 -- (-1022.095) [-1021.582] (-1021.849) (-1025.772) * [-1021.650] (-1021.424) (-1026.469) (-1019.131) -- 0:00:18 205000 -- (-1022.106) [-1020.063] (-1020.838) (-1026.171) * (-1019.653) [-1022.741] (-1021.519) (-1019.488) -- 0:00:18 Average standard deviation of split frequencies: 0.022041 205500 -- (-1025.210) [-1019.199] (-1021.282) (-1023.653) * (-1020.822) [-1020.290] (-1023.591) (-1019.264) -- 0:00:18 206000 -- (-1024.262) (-1023.154) (-1021.227) [-1019.603] * (-1025.541) [-1020.313] (-1024.960) (-1019.219) -- 0:00:18 206500 -- (-1022.081) (-1020.828) (-1021.476) [-1022.056] * (-1022.172) [-1020.133] (-1021.700) (-1026.267) -- 0:00:18 207000 -- (-1024.255) [-1018.968] (-1021.176) (-1021.930) * (-1019.387) (-1020.580) [-1019.232] (-1021.689) -- 0:00:18 207500 -- (-1025.100) [-1021.165] (-1021.529) (-1020.475) * (-1019.990) (-1021.596) (-1022.958) [-1023.313] -- 0:00:18 208000 -- [-1024.146] (-1021.982) (-1022.564) (-1020.974) * (-1020.272) (-1024.985) [-1021.032] (-1021.553) -- 0:00:18 208500 -- (-1020.120) [-1020.464] (-1024.330) (-1019.308) * (-1019.485) (-1020.796) (-1021.488) [-1021.340] -- 0:00:18 209000 -- [-1020.773] (-1020.472) (-1025.912) (-1022.240) * [-1021.272] (-1020.428) (-1019.567) (-1021.158) -- 0:00:18 209500 -- (-1020.410) [-1020.884] (-1023.339) (-1021.345) * (-1021.767) (-1021.706) [-1019.203] (-1020.439) -- 0:00:18 210000 -- (-1019.927) (-1022.441) [-1022.343] (-1020.816) * [-1020.043] (-1022.420) (-1019.016) (-1021.445) -- 0:00:17 Average standard deviation of split frequencies: 0.023672 210500 -- [-1019.917] (-1021.725) (-1026.602) (-1022.429) * (-1023.628) (-1023.142) [-1018.945] (-1022.491) -- 0:00:17 211000 -- (-1019.971) [-1021.227] (-1028.558) (-1025.341) * [-1022.981] (-1024.696) (-1021.427) (-1021.901) -- 0:00:17 211500 -- (-1021.576) (-1022.967) (-1023.101) [-1022.001] * [-1024.947] (-1022.842) (-1023.767) (-1023.160) -- 0:00:17 212000 -- (-1022.643) [-1020.073] (-1019.752) (-1022.430) * (-1022.810) [-1019.441] (-1024.211) (-1020.993) -- 0:00:17 212500 -- (-1019.947) (-1020.100) [-1019.829] (-1020.566) * [-1021.063] (-1021.562) (-1024.292) (-1021.108) -- 0:00:18 213000 -- [-1019.734] (-1022.549) (-1018.731) (-1023.548) * [-1020.304] (-1020.762) (-1019.582) (-1021.986) -- 0:00:18 213500 -- (-1020.937) [-1021.469] (-1022.322) (-1022.091) * (-1020.757) (-1020.188) (-1019.892) [-1020.527] -- 0:00:18 214000 -- [-1020.857] (-1019.900) (-1023.708) (-1019.431) * [-1023.495] (-1020.968) (-1021.438) (-1022.511) -- 0:00:18 214500 -- (-1019.524) [-1020.892] (-1020.402) (-1020.141) * (-1026.194) (-1020.008) [-1022.507] (-1022.352) -- 0:00:18 215000 -- (-1020.843) (-1020.391) (-1020.998) [-1020.743] * (-1020.581) [-1019.872] (-1020.212) (-1021.090) -- 0:00:18 Average standard deviation of split frequencies: 0.022858 215500 -- (-1020.012) [-1021.926] (-1019.015) (-1027.871) * (-1020.717) [-1020.797] (-1022.528) (-1019.997) -- 0:00:18 216000 -- [-1021.192] (-1020.192) (-1022.211) (-1023.972) * (-1020.643) [-1019.416] (-1021.493) (-1021.937) -- 0:00:18 216500 -- (-1024.606) (-1022.296) (-1020.573) [-1021.673] * [-1020.275] (-1020.019) (-1022.692) (-1020.265) -- 0:00:18 217000 -- (-1023.280) (-1022.152) [-1020.603] (-1022.332) * (-1020.352) (-1020.515) (-1020.439) [-1019.115] -- 0:00:18 217500 -- (-1023.494) (-1022.712) [-1019.655] (-1021.749) * (-1022.167) [-1020.483] (-1022.485) (-1020.192) -- 0:00:18 218000 -- (-1022.047) (-1023.761) (-1025.886) [-1021.598] * (-1021.187) [-1020.375] (-1021.706) (-1019.419) -- 0:00:18 218500 -- (-1020.593) (-1023.269) [-1021.745] (-1019.771) * (-1020.618) [-1019.196] (-1021.004) (-1020.124) -- 0:00:18 219000 -- (-1019.983) (-1022.472) (-1026.901) [-1023.465] * (-1022.727) (-1020.101) [-1019.944] (-1021.594) -- 0:00:17 219500 -- [-1020.367] (-1021.674) (-1025.417) (-1022.348) * (-1021.948) (-1020.315) [-1022.064] (-1021.223) -- 0:00:17 220000 -- (-1019.955) (-1021.155) [-1019.400] (-1018.850) * (-1022.943) (-1021.190) (-1020.182) [-1021.241] -- 0:00:17 Average standard deviation of split frequencies: 0.023162 220500 -- (-1019.243) (-1021.963) (-1020.612) [-1019.331] * (-1022.904) [-1022.785] (-1019.653) (-1020.224) -- 0:00:17 221000 -- [-1020.845] (-1019.240) (-1024.782) (-1019.352) * [-1023.012] (-1019.556) (-1021.062) (-1022.547) -- 0:00:17 221500 -- [-1020.266] (-1020.385) (-1027.862) (-1023.369) * (-1021.484) (-1021.611) (-1023.446) [-1020.690] -- 0:00:17 222000 -- (-1019.173) (-1020.403) (-1024.895) [-1019.164] * (-1020.698) (-1020.907) [-1018.914] (-1019.980) -- 0:00:17 222500 -- (-1019.772) (-1021.355) [-1019.928] (-1019.853) * (-1019.710) (-1023.111) (-1023.074) [-1020.844] -- 0:00:17 223000 -- (-1022.926) (-1021.613) [-1021.565] (-1021.496) * [-1020.367] (-1024.351) (-1021.485) (-1021.696) -- 0:00:17 223500 -- (-1022.260) [-1019.802] (-1021.118) (-1025.304) * (-1021.812) (-1022.058) (-1021.324) [-1020.634] -- 0:00:17 224000 -- (-1023.413) [-1025.104] (-1021.026) (-1022.713) * (-1020.837) (-1020.702) [-1019.896] (-1020.301) -- 0:00:17 224500 -- (-1030.026) (-1019.738) [-1021.011] (-1023.429) * (-1021.161) (-1021.065) (-1022.540) [-1019.655] -- 0:00:17 225000 -- (-1022.974) (-1022.401) (-1021.518) [-1021.336] * [-1019.843] (-1020.999) (-1024.384) (-1021.236) -- 0:00:17 Average standard deviation of split frequencies: 0.021298 225500 -- (-1022.446) (-1020.313) [-1019.386] (-1022.023) * (-1022.256) (-1021.007) [-1021.867] (-1019.438) -- 0:00:17 226000 -- (-1020.647) (-1021.206) [-1018.954] (-1019.245) * [-1021.912] (-1020.172) (-1019.569) (-1019.876) -- 0:00:16 226500 -- (-1023.415) (-1020.187) [-1019.513] (-1019.148) * (-1021.672) (-1022.013) (-1020.477) [-1020.440] -- 0:00:16 227000 -- (-1023.545) (-1021.332) [-1018.865] (-1021.501) * (-1022.282) (-1022.749) (-1020.502) [-1019.455] -- 0:00:18 227500 -- (-1024.297) [-1020.713] (-1020.563) (-1021.146) * [-1025.681] (-1021.357) (-1021.770) (-1020.554) -- 0:00:17 228000 -- (-1019.957) [-1020.630] (-1021.417) (-1019.789) * (-1020.629) (-1022.866) [-1019.813] (-1023.031) -- 0:00:17 228500 -- (-1022.411) (-1020.912) [-1023.765] (-1020.363) * (-1018.896) (-1021.672) (-1020.329) [-1021.342] -- 0:00:17 229000 -- (-1021.823) [-1020.234] (-1023.115) (-1020.300) * (-1018.990) (-1027.259) [-1020.221] (-1023.459) -- 0:00:17 229500 -- (-1022.474) (-1022.922) (-1021.727) [-1019.294] * (-1018.948) (-1027.972) (-1024.685) [-1021.731] -- 0:00:17 230000 -- (-1019.963) (-1022.725) [-1019.252] (-1018.934) * (-1024.732) (-1022.427) (-1021.348) [-1021.542] -- 0:00:17 Average standard deviation of split frequencies: 0.022158 230500 -- (-1020.589) [-1019.833] (-1021.615) (-1018.787) * [-1019.716] (-1022.715) (-1019.656) (-1019.231) -- 0:00:17 231000 -- (-1023.848) (-1022.120) [-1023.789] (-1022.459) * (-1025.780) (-1024.786) [-1021.672] (-1022.828) -- 0:00:17 231500 -- [-1019.597] (-1020.502) (-1020.464) (-1020.350) * (-1019.357) (-1021.117) (-1022.338) [-1021.451] -- 0:00:17 232000 -- (-1020.896) [-1021.111] (-1032.286) (-1022.185) * (-1020.068) (-1020.679) (-1019.424) [-1019.416] -- 0:00:17 232500 -- (-1024.407) [-1020.726] (-1020.796) (-1019.870) * (-1019.707) (-1020.062) (-1019.807) [-1019.015] -- 0:00:17 233000 -- [-1020.987] (-1019.695) (-1023.893) (-1022.085) * (-1019.602) (-1022.507) (-1021.785) [-1020.295] -- 0:00:17 233500 -- (-1025.765) (-1021.039) (-1020.363) [-1020.753] * [-1019.563] (-1023.440) (-1023.797) (-1021.204) -- 0:00:17 234000 -- (-1022.820) (-1021.309) [-1018.914] (-1020.548) * (-1022.980) (-1021.266) (-1020.028) [-1020.945] -- 0:00:17 234500 -- [-1020.162] (-1020.466) (-1022.351) (-1021.541) * (-1021.624) [-1020.429] (-1023.266) (-1026.041) -- 0:00:16 235000 -- (-1019.383) [-1021.406] (-1021.752) (-1020.063) * [-1020.585] (-1022.980) (-1018.909) (-1020.999) -- 0:00:16 Average standard deviation of split frequencies: 0.020500 235500 -- (-1024.329) (-1021.664) [-1021.756] (-1022.769) * (-1020.084) (-1022.601) (-1023.565) [-1023.221] -- 0:00:16 236000 -- (-1020.825) (-1020.775) (-1019.668) [-1020.000] * (-1020.322) (-1022.624) [-1020.153] (-1019.441) -- 0:00:16 236500 -- (-1023.492) (-1020.656) (-1021.552) [-1020.254] * (-1024.931) [-1019.909] (-1023.676) (-1020.299) -- 0:00:16 237000 -- (-1020.872) (-1023.189) [-1022.607] (-1024.665) * (-1024.342) (-1021.463) (-1023.890) [-1019.278] -- 0:00:16 237500 -- (-1019.490) [-1020.464] (-1028.304) (-1022.630) * (-1022.236) (-1020.576) (-1020.365) [-1019.564] -- 0:00:16 238000 -- (-1019.942) [-1020.471] (-1023.967) (-1022.315) * (-1019.064) [-1020.749] (-1021.898) (-1021.673) -- 0:00:16 238500 -- [-1019.702] (-1020.580) (-1021.729) (-1022.691) * (-1019.778) (-1021.306) (-1027.149) [-1020.034] -- 0:00:16 239000 -- (-1021.128) [-1022.199] (-1022.013) (-1021.831) * (-1023.167) (-1020.717) (-1028.466) [-1022.243] -- 0:00:16 239500 -- (-1019.138) (-1020.479) [-1021.712] (-1021.830) * (-1021.828) [-1021.038] (-1024.319) (-1019.992) -- 0:00:16 240000 -- (-1021.079) [-1019.908] (-1020.319) (-1020.314) * (-1022.211) (-1022.134) (-1025.340) [-1020.774] -- 0:00:16 Average standard deviation of split frequencies: 0.019278 240500 -- (-1019.367) (-1019.965) [-1021.723] (-1020.384) * (-1028.037) (-1020.183) (-1024.007) [-1020.438] -- 0:00:16 241000 -- (-1020.450) (-1020.554) (-1021.764) [-1022.016] * (-1019.938) [-1022.023] (-1024.970) (-1020.871) -- 0:00:17 241500 -- (-1022.836) (-1020.424) (-1026.218) [-1019.588] * [-1018.816] (-1020.707) (-1023.195) (-1019.152) -- 0:00:17 242000 -- (-1024.791) [-1022.122] (-1024.525) (-1019.860) * (-1023.596) (-1022.760) [-1023.364] (-1024.696) -- 0:00:17 242500 -- (-1020.834) (-1021.714) (-1022.953) [-1019.836] * (-1023.108) (-1022.232) (-1023.576) [-1023.579] -- 0:00:16 243000 -- (-1020.123) (-1020.956) (-1020.672) [-1021.242] * (-1020.537) (-1020.951) (-1020.878) [-1025.193] -- 0:00:16 243500 -- [-1020.356] (-1024.353) (-1023.833) (-1021.067) * [-1021.370] (-1020.388) (-1020.971) (-1020.396) -- 0:00:16 244000 -- (-1019.838) (-1025.525) (-1023.095) [-1024.989] * (-1019.288) (-1020.179) [-1020.081] (-1021.549) -- 0:00:16 244500 -- [-1022.968] (-1025.483) (-1021.564) (-1021.158) * [-1022.152] (-1021.117) (-1020.179) (-1020.264) -- 0:00:16 245000 -- (-1022.144) (-1021.130) [-1021.694] (-1021.986) * [-1022.252] (-1024.688) (-1021.852) (-1026.511) -- 0:00:16 Average standard deviation of split frequencies: 0.019667 245500 -- (-1019.090) (-1020.500) (-1022.107) [-1022.125] * (-1024.202) (-1024.008) [-1022.013] (-1022.375) -- 0:00:16 246000 -- (-1019.682) (-1024.726) [-1019.605] (-1020.831) * [-1023.738] (-1022.386) (-1023.158) (-1022.500) -- 0:00:16 246500 -- (-1019.856) (-1024.821) [-1019.808] (-1020.778) * (-1026.696) (-1021.156) (-1023.196) [-1021.322] -- 0:00:16 247000 -- [-1021.660] (-1021.383) (-1019.610) (-1020.223) * (-1021.312) [-1018.982] (-1024.265) (-1019.679) -- 0:00:16 247500 -- (-1019.345) [-1024.415] (-1019.742) (-1022.629) * [-1022.624] (-1024.225) (-1023.417) (-1019.443) -- 0:00:16 248000 -- (-1020.789) (-1021.755) [-1020.193] (-1020.328) * (-1021.389) (-1021.583) [-1019.886] (-1020.104) -- 0:00:16 248500 -- (-1022.484) (-1022.091) [-1019.107] (-1020.445) * [-1021.047] (-1021.240) (-1023.911) (-1019.256) -- 0:00:16 249000 -- (-1025.236) (-1020.375) [-1019.092] (-1020.330) * (-1022.828) (-1023.101) (-1024.104) [-1019.376] -- 0:00:16 249500 -- (-1028.109) (-1023.884) (-1019.756) [-1019.871] * (-1020.048) [-1025.460] (-1021.828) (-1020.645) -- 0:00:16 250000 -- (-1021.927) (-1022.724) (-1019.965) [-1021.626] * (-1020.443) [-1023.374] (-1020.793) (-1019.754) -- 0:00:16 Average standard deviation of split frequencies: 0.019103 250500 -- (-1020.697) (-1021.718) [-1019.697] (-1020.732) * (-1021.828) [-1019.868] (-1023.988) (-1023.774) -- 0:00:15 251000 -- (-1022.029) (-1022.111) (-1020.090) [-1022.066] * [-1020.131] (-1020.628) (-1022.721) (-1020.626) -- 0:00:15 251500 -- (-1023.715) (-1024.288) (-1020.090) [-1021.230] * [-1019.160] (-1020.850) (-1020.926) (-1021.273) -- 0:00:15 252000 -- (-1024.708) (-1023.021) [-1020.374] (-1022.949) * (-1020.787) (-1019.640) [-1025.370] (-1020.781) -- 0:00:15 252500 -- (-1023.092) (-1022.260) [-1021.608] (-1026.257) * [-1021.092] (-1020.381) (-1021.678) (-1021.449) -- 0:00:15 253000 -- (-1021.156) (-1020.596) [-1022.954] (-1020.867) * (-1022.506) [-1019.574] (-1021.205) (-1022.253) -- 0:00:15 253500 -- (-1022.361) [-1020.532] (-1023.849) (-1020.222) * [-1021.775] (-1019.285) (-1020.545) (-1021.910) -- 0:00:15 254000 -- (-1022.225) (-1025.448) [-1023.473] (-1023.375) * (-1021.733) [-1019.665] (-1027.050) (-1022.842) -- 0:00:15 254500 -- (-1024.008) [-1022.848] (-1021.578) (-1021.521) * (-1022.642) [-1020.288] (-1021.376) (-1022.880) -- 0:00:15 255000 -- (-1020.172) [-1020.620] (-1021.703) (-1022.184) * [-1023.139] (-1022.374) (-1022.541) (-1021.562) -- 0:00:15 Average standard deviation of split frequencies: 0.017736 255500 -- (-1021.232) (-1022.617) (-1020.981) [-1020.465] * (-1022.951) [-1020.670] (-1020.390) (-1022.066) -- 0:00:15 256000 -- (-1021.432) (-1018.886) (-1024.921) [-1024.579] * (-1022.358) [-1021.010] (-1021.056) (-1023.160) -- 0:00:16 256500 -- (-1020.939) [-1018.884] (-1021.581) (-1022.812) * (-1020.682) (-1019.466) (-1023.748) [-1020.278] -- 0:00:16 257000 -- (-1021.972) [-1020.431] (-1021.431) (-1019.204) * (-1022.997) (-1022.847) [-1020.104] (-1021.583) -- 0:00:16 257500 -- (-1020.320) (-1020.911) [-1019.775] (-1019.818) * [-1020.286] (-1020.687) (-1019.440) (-1019.069) -- 0:00:16 258000 -- (-1023.555) (-1022.509) (-1024.635) [-1019.468] * (-1019.313) (-1021.235) (-1025.886) [-1019.448] -- 0:00:15 258500 -- [-1020.003] (-1023.113) (-1022.993) (-1019.200) * (-1019.656) [-1020.847] (-1024.752) (-1021.406) -- 0:00:15 259000 -- (-1020.104) (-1021.872) (-1021.118) [-1019.935] * (-1019.548) (-1021.055) (-1023.558) [-1021.548] -- 0:00:15 259500 -- [-1023.550] (-1021.727) (-1020.744) (-1019.016) * (-1020.845) [-1022.107] (-1020.853) (-1020.345) -- 0:00:15 260000 -- (-1020.523) (-1020.645) [-1023.018] (-1022.858) * (-1020.703) (-1027.856) [-1021.627] (-1020.616) -- 0:00:15 Average standard deviation of split frequencies: 0.018275 260500 -- (-1025.544) (-1021.567) [-1020.007] (-1019.835) * [-1019.149] (-1021.872) (-1021.202) (-1019.408) -- 0:00:15 261000 -- (-1019.600) (-1020.751) [-1022.954] (-1018.778) * (-1021.504) (-1022.759) [-1020.405] (-1019.519) -- 0:00:15 261500 -- (-1019.587) [-1020.325] (-1021.101) (-1019.186) * [-1023.104] (-1020.368) (-1026.180) (-1020.059) -- 0:00:15 262000 -- [-1019.480] (-1023.227) (-1020.599) (-1025.222) * (-1020.341) [-1019.357] (-1021.927) (-1023.017) -- 0:00:15 262500 -- [-1019.808] (-1018.876) (-1020.480) (-1023.811) * (-1023.129) (-1019.949) [-1022.356] (-1020.601) -- 0:00:15 263000 -- (-1021.563) [-1019.181] (-1020.420) (-1019.616) * [-1023.809] (-1019.317) (-1026.850) (-1019.153) -- 0:00:15 263500 -- (-1019.115) (-1020.953) [-1018.768] (-1020.591) * [-1019.165] (-1023.233) (-1023.360) (-1021.099) -- 0:00:15 264000 -- (-1025.839) (-1020.933) [-1020.833] (-1021.765) * [-1020.377] (-1021.417) (-1020.563) (-1019.550) -- 0:00:15 264500 -- (-1019.867) (-1020.507) [-1019.611] (-1022.463) * [-1019.521] (-1021.735) (-1021.419) (-1019.850) -- 0:00:15 265000 -- (-1022.672) (-1021.588) [-1021.673] (-1020.998) * [-1021.639] (-1020.517) (-1020.445) (-1019.133) -- 0:00:15 Average standard deviation of split frequencies: 0.018188 265500 -- [-1020.639] (-1019.576) (-1019.063) (-1021.769) * (-1023.166) (-1021.152) (-1022.459) [-1021.452] -- 0:00:15 266000 -- (-1019.666) (-1018.907) [-1020.376] (-1020.043) * (-1022.524) (-1019.823) [-1020.184] (-1019.921) -- 0:00:14 266500 -- (-1020.450) (-1020.051) [-1023.068] (-1024.941) * (-1029.613) (-1019.776) [-1022.915] (-1020.098) -- 0:00:14 267000 -- (-1020.635) (-1020.044) [-1021.232] (-1027.736) * [-1023.976] (-1019.315) (-1024.656) (-1020.062) -- 0:00:14 267500 -- [-1021.741] (-1021.749) (-1025.240) (-1021.697) * [-1024.150] (-1018.969) (-1020.704) (-1021.786) -- 0:00:14 268000 -- [-1020.150] (-1019.153) (-1025.052) (-1019.592) * [-1019.135] (-1021.519) (-1021.416) (-1020.538) -- 0:00:14 268500 -- (-1020.690) (-1020.083) [-1020.750] (-1021.538) * [-1019.416] (-1027.298) (-1020.954) (-1020.549) -- 0:00:14 269000 -- [-1020.690] (-1021.645) (-1022.263) (-1020.979) * [-1019.969] (-1021.178) (-1020.725) (-1027.688) -- 0:00:14 269500 -- [-1020.082] (-1020.320) (-1019.942) (-1020.237) * (-1021.824) [-1020.234] (-1021.118) (-1020.001) -- 0:00:14 270000 -- (-1019.156) [-1019.608] (-1021.557) (-1020.163) * (-1024.020) (-1019.403) [-1020.770] (-1021.005) -- 0:00:14 Average standard deviation of split frequencies: 0.017325 270500 -- (-1020.808) (-1021.808) (-1022.245) [-1019.480] * [-1021.791] (-1019.187) (-1021.761) (-1023.289) -- 0:00:14 271000 -- (-1019.067) (-1019.757) (-1022.474) [-1019.435] * (-1022.184) (-1021.367) (-1019.785) [-1020.624] -- 0:00:14 271500 -- (-1019.214) (-1022.025) (-1022.947) [-1019.193] * (-1022.963) (-1022.690) [-1022.527] (-1020.303) -- 0:00:14 272000 -- (-1020.238) (-1023.321) [-1022.876] (-1020.530) * [-1019.803] (-1025.302) (-1021.579) (-1019.438) -- 0:00:15 272500 -- [-1021.795] (-1023.559) (-1020.382) (-1020.606) * [-1019.822] (-1021.840) (-1026.277) (-1019.493) -- 0:00:15 273000 -- [-1022.227] (-1021.247) (-1022.188) (-1020.485) * (-1020.900) [-1021.476] (-1023.603) (-1019.449) -- 0:00:14 273500 -- (-1021.929) (-1023.429) [-1027.395] (-1021.118) * (-1020.413) [-1023.299] (-1022.316) (-1019.520) -- 0:00:14 274000 -- (-1022.132) [-1019.377] (-1025.864) (-1023.044) * (-1021.400) (-1020.068) (-1021.948) [-1019.244] -- 0:00:14 274500 -- (-1023.215) (-1020.001) [-1020.980] (-1021.917) * (-1021.314) (-1019.755) (-1024.237) [-1019.242] -- 0:00:14 275000 -- (-1022.554) (-1019.142) [-1020.061] (-1020.374) * [-1020.106] (-1020.432) (-1024.554) (-1020.574) -- 0:00:14 Average standard deviation of split frequencies: 0.016001 275500 -- (-1022.554) [-1023.071] (-1022.344) (-1020.106) * (-1020.410) [-1019.771] (-1024.642) (-1019.754) -- 0:00:14 276000 -- (-1024.569) [-1027.281] (-1021.969) (-1024.519) * (-1020.410) (-1021.582) (-1020.120) [-1020.376] -- 0:00:14 276500 -- [-1025.467] (-1024.649) (-1023.740) (-1024.893) * (-1020.343) (-1020.334) (-1021.186) [-1019.959] -- 0:00:14 277000 -- (-1024.667) (-1027.006) (-1022.900) [-1020.574] * (-1023.425) (-1019.257) [-1019.340] (-1019.772) -- 0:00:14 277500 -- (-1022.577) (-1021.612) [-1020.273] (-1020.558) * (-1021.714) (-1019.215) (-1019.352) [-1019.703] -- 0:00:14 278000 -- (-1020.645) (-1021.657) [-1020.521] (-1028.321) * (-1020.760) (-1020.168) (-1020.752) [-1018.837] -- 0:00:14 278500 -- (-1020.335) (-1023.670) [-1020.267] (-1027.200) * (-1019.676) (-1019.302) (-1020.284) [-1019.247] -- 0:00:14 279000 -- (-1021.131) (-1022.750) [-1020.200] (-1021.636) * (-1025.733) [-1020.708] (-1023.889) (-1019.281) -- 0:00:14 279500 -- (-1019.682) (-1022.320) (-1023.015) [-1022.438] * [-1019.192] (-1020.352) (-1020.907) (-1022.938) -- 0:00:14 280000 -- (-1021.787) (-1022.057) [-1022.858] (-1022.111) * [-1019.978] (-1021.473) (-1021.458) (-1020.265) -- 0:00:14 Average standard deviation of split frequencies: 0.015116 280500 -- (-1021.728) [-1020.236] (-1021.485) (-1020.940) * (-1022.567) [-1022.738] (-1019.762) (-1022.016) -- 0:00:14 281000 -- [-1021.777] (-1021.901) (-1025.942) (-1021.207) * (-1025.170) [-1024.290] (-1020.236) (-1025.541) -- 0:00:14 281500 -- [-1020.507] (-1020.334) (-1021.969) (-1022.360) * (-1022.320) (-1021.960) [-1020.624] (-1020.507) -- 0:00:13 282000 -- [-1019.775] (-1020.707) (-1020.705) (-1021.420) * (-1023.316) [-1019.693] (-1021.335) (-1022.084) -- 0:00:13 282500 -- (-1019.875) [-1019.463] (-1027.139) (-1022.144) * [-1022.994] (-1021.935) (-1021.248) (-1021.003) -- 0:00:13 283000 -- [-1020.767] (-1018.808) (-1022.342) (-1020.010) * (-1020.877) (-1022.919) [-1021.343] (-1021.559) -- 0:00:13 283500 -- (-1025.956) [-1023.799] (-1023.073) (-1021.187) * (-1020.874) (-1023.516) [-1020.775] (-1022.725) -- 0:00:13 284000 -- (-1022.326) [-1023.083] (-1022.389) (-1022.068) * (-1019.304) [-1021.805] (-1020.733) (-1025.235) -- 0:00:13 284500 -- [-1020.539] (-1023.035) (-1021.410) (-1021.259) * [-1019.256] (-1020.527) (-1020.836) (-1025.358) -- 0:00:13 285000 -- (-1020.827) [-1022.542] (-1021.667) (-1020.049) * (-1022.534) (-1020.080) (-1020.048) [-1020.676] -- 0:00:13 Average standard deviation of split frequencies: 0.015962 285500 -- [-1019.985] (-1022.960) (-1020.574) (-1020.594) * (-1020.052) (-1020.286) (-1024.222) [-1020.938] -- 0:00:13 286000 -- (-1019.822) (-1020.385) (-1020.540) [-1023.277] * (-1021.543) [-1021.795] (-1023.432) (-1022.260) -- 0:00:13 286500 -- (-1020.245) [-1021.890] (-1021.694) (-1022.787) * (-1019.128) (-1022.838) [-1022.318] (-1021.763) -- 0:00:13 287000 -- (-1020.471) (-1019.430) [-1019.083] (-1020.250) * (-1020.739) (-1022.986) (-1021.194) [-1020.980] -- 0:00:13 287500 -- [-1021.741] (-1020.097) (-1022.939) (-1023.810) * (-1020.744) (-1019.728) (-1022.524) [-1020.779] -- 0:00:13 288000 -- (-1022.347) (-1020.499) (-1023.259) [-1018.968] * [-1021.640] (-1020.200) (-1021.601) (-1022.432) -- 0:00:13 288500 -- (-1022.280) [-1022.047] (-1019.180) (-1019.146) * (-1019.323) [-1020.359] (-1020.976) (-1023.084) -- 0:00:13 289000 -- [-1021.750] (-1024.061) (-1019.886) (-1019.147) * (-1023.343) (-1024.344) (-1019.404) [-1023.451] -- 0:00:13 289500 -- (-1023.530) (-1020.018) [-1019.701] (-1019.127) * (-1021.662) (-1019.274) (-1019.215) [-1021.899] -- 0:00:13 290000 -- (-1022.754) (-1021.219) [-1020.324] (-1019.544) * [-1020.712] (-1019.274) (-1019.113) (-1023.806) -- 0:00:13 Average standard deviation of split frequencies: 0.015023 290500 -- [-1021.471] (-1021.060) (-1020.702) (-1024.142) * [-1020.750] (-1019.439) (-1019.446) (-1019.784) -- 0:00:13 291000 -- [-1022.317] (-1021.874) (-1021.616) (-1024.327) * [-1020.846] (-1018.890) (-1020.243) (-1024.841) -- 0:00:13 291500 -- [-1023.079] (-1020.266) (-1021.275) (-1023.195) * [-1022.171] (-1021.114) (-1019.006) (-1022.419) -- 0:00:13 292000 -- [-1023.153] (-1020.259) (-1020.253) (-1021.148) * [-1022.529] (-1020.839) (-1022.161) (-1024.102) -- 0:00:13 292500 -- [-1022.962] (-1019.576) (-1021.090) (-1021.454) * [-1020.821] (-1023.277) (-1023.189) (-1020.511) -- 0:00:13 293000 -- [-1025.023] (-1020.301) (-1020.724) (-1021.368) * [-1019.544] (-1020.045) (-1022.234) (-1021.099) -- 0:00:13 293500 -- (-1020.145) (-1022.831) (-1020.050) [-1020.713] * (-1020.467) [-1021.699] (-1020.694) (-1020.274) -- 0:00:13 294000 -- (-1021.312) [-1019.863] (-1020.376) (-1021.153) * (-1020.659) (-1020.842) [-1020.603] (-1021.994) -- 0:00:13 294500 -- (-1020.423) [-1020.252] (-1019.960) (-1018.966) * [-1025.224] (-1022.012) (-1020.448) (-1020.111) -- 0:00:13 295000 -- (-1021.092) [-1020.063] (-1019.418) (-1020.570) * (-1022.018) (-1020.558) [-1021.580] (-1020.769) -- 0:00:13 Average standard deviation of split frequencies: 0.014752 295500 -- (-1022.574) (-1021.330) [-1019.669] (-1022.730) * (-1020.006) (-1021.107) (-1022.244) [-1022.562] -- 0:00:13 296000 -- [-1021.194] (-1024.978) (-1022.645) (-1022.400) * (-1019.103) [-1023.524] (-1021.345) (-1019.898) -- 0:00:13 296500 -- (-1020.176) [-1028.224] (-1019.676) (-1022.672) * (-1020.316) (-1021.440) [-1020.949] (-1025.409) -- 0:00:13 297000 -- (-1021.987) (-1020.413) [-1020.023] (-1019.754) * (-1022.374) (-1021.973) [-1019.529] (-1021.840) -- 0:00:12 297500 -- [-1022.313] (-1022.836) (-1020.732) (-1019.555) * (-1019.209) [-1021.963] (-1020.581) (-1022.110) -- 0:00:12 298000 -- (-1021.048) (-1020.028) (-1026.427) [-1020.283] * (-1019.211) (-1020.288) (-1021.402) [-1020.560] -- 0:00:12 298500 -- [-1020.585] (-1019.720) (-1019.631) (-1019.908) * (-1020.628) (-1021.258) [-1023.666] (-1021.177) -- 0:00:12 299000 -- [-1020.962] (-1021.316) (-1020.241) (-1020.187) * (-1026.193) [-1019.545] (-1021.676) (-1019.738) -- 0:00:12 299500 -- [-1021.483] (-1021.475) (-1021.322) (-1019.990) * (-1024.716) [-1019.541] (-1022.606) (-1020.223) -- 0:00:12 300000 -- [-1022.734] (-1022.302) (-1021.465) (-1025.226) * (-1020.692) (-1025.687) (-1024.970) [-1021.169] -- 0:00:12 Average standard deviation of split frequencies: 0.015514 300500 -- (-1022.894) (-1021.483) [-1022.754] (-1028.463) * [-1019.855] (-1026.411) (-1019.440) (-1020.521) -- 0:00:12 301000 -- [-1021.269] (-1021.660) (-1025.015) (-1020.764) * [-1021.546] (-1022.556) (-1025.423) (-1019.199) -- 0:00:12 301500 -- [-1021.309] (-1021.867) (-1019.498) (-1020.927) * (-1023.726) [-1020.458] (-1021.412) (-1020.526) -- 0:00:12 302000 -- (-1020.740) [-1020.234] (-1020.946) (-1021.757) * (-1021.065) [-1019.972] (-1021.211) (-1023.046) -- 0:00:12 302500 -- (-1022.515) (-1022.408) [-1020.594] (-1022.379) * (-1019.610) (-1020.027) [-1021.440] (-1022.766) -- 0:00:12 303000 -- (-1020.177) (-1021.528) [-1019.697] (-1019.268) * (-1019.829) [-1022.639] (-1024.567) (-1020.514) -- 0:00:12 303500 -- (-1019.856) (-1021.104) (-1020.428) [-1018.997] * (-1023.998) (-1021.609) [-1021.589] (-1022.127) -- 0:00:12 304000 -- (-1021.520) (-1021.285) (-1022.552) [-1021.631] * [-1019.371] (-1023.559) (-1020.424) (-1021.969) -- 0:00:12 304500 -- (-1021.880) [-1020.419] (-1025.276) (-1019.713) * (-1019.097) (-1020.614) (-1020.241) [-1023.341] -- 0:00:12 305000 -- [-1020.229] (-1021.165) (-1028.879) (-1018.784) * (-1021.386) (-1021.723) (-1021.272) [-1021.742] -- 0:00:12 Average standard deviation of split frequencies: 0.014027 305500 -- (-1021.405) (-1021.344) (-1022.895) [-1019.765] * (-1023.031) (-1024.690) (-1021.060) [-1019.741] -- 0:00:12 306000 -- (-1023.124) (-1019.276) (-1026.781) [-1019.829] * [-1020.579] (-1020.348) (-1022.528) (-1020.506) -- 0:00:12 306500 -- (-1022.943) [-1022.990] (-1025.514) (-1024.488) * (-1020.749) (-1023.473) (-1020.616) [-1020.925] -- 0:00:12 307000 -- [-1026.491] (-1021.342) (-1019.842) (-1023.518) * (-1024.449) (-1021.812) (-1022.498) [-1022.576] -- 0:00:12 307500 -- (-1024.020) (-1020.377) [-1021.362] (-1022.450) * [-1020.148] (-1019.954) (-1020.720) (-1019.707) -- 0:00:12 308000 -- [-1024.652] (-1020.018) (-1024.128) (-1023.986) * (-1021.421) (-1019.406) (-1022.879) [-1023.723] -- 0:00:12 308500 -- (-1022.499) [-1020.365] (-1020.318) (-1020.653) * (-1021.159) (-1019.973) (-1020.154) [-1022.436] -- 0:00:12 309000 -- (-1020.997) (-1022.634) (-1020.731) [-1020.927] * (-1020.804) (-1020.563) (-1020.161) [-1019.354] -- 0:00:12 309500 -- (-1023.700) (-1021.481) (-1025.436) [-1020.225] * (-1022.014) (-1023.007) [-1020.892] (-1019.147) -- 0:00:12 310000 -- (-1023.001) (-1021.049) (-1029.024) [-1022.657] * (-1023.776) (-1020.289) (-1019.040) [-1021.463] -- 0:00:12 Average standard deviation of split frequencies: 0.014056 310500 -- (-1022.211) (-1024.468) (-1020.753) [-1025.018] * (-1020.828) (-1024.231) (-1019.171) [-1021.822] -- 0:00:12 311000 -- (-1021.940) (-1020.554) [-1021.610] (-1021.629) * [-1020.494] (-1020.254) (-1020.138) (-1026.064) -- 0:00:12 311500 -- [-1020.097] (-1019.360) (-1021.196) (-1019.892) * (-1019.569) (-1019.121) [-1026.963] (-1022.063) -- 0:00:12 312000 -- (-1022.349) [-1020.557] (-1021.991) (-1022.045) * (-1023.939) [-1023.887] (-1023.007) (-1024.224) -- 0:00:12 312500 -- (-1021.478) (-1020.811) (-1019.250) [-1020.943] * (-1019.502) (-1021.768) (-1021.225) [-1019.267] -- 0:00:12 313000 -- (-1020.889) (-1018.881) (-1019.658) [-1021.894] * [-1020.364] (-1020.807) (-1021.865) (-1020.628) -- 0:00:11 313500 -- [-1021.689] (-1020.498) (-1022.121) (-1020.317) * [-1019.617] (-1021.227) (-1024.328) (-1021.334) -- 0:00:11 314000 -- (-1025.024) (-1019.727) [-1020.587] (-1020.986) * (-1020.045) [-1022.133] (-1022.253) (-1020.989) -- 0:00:11 314500 -- (-1020.508) (-1020.033) (-1020.485) [-1019.604] * (-1019.669) (-1020.473) [-1020.184] (-1022.943) -- 0:00:11 315000 -- [-1023.673] (-1020.309) (-1022.854) (-1019.658) * [-1021.693] (-1023.708) (-1020.753) (-1021.570) -- 0:00:11 Average standard deviation of split frequencies: 0.013269 315500 -- [-1021.041] (-1019.601) (-1020.135) (-1020.724) * [-1020.356] (-1020.802) (-1019.755) (-1021.802) -- 0:00:11 316000 -- (-1019.514) [-1019.702] (-1020.408) (-1018.838) * (-1019.945) (-1019.993) [-1022.109] (-1020.948) -- 0:00:11 316500 -- (-1018.934) (-1020.010) [-1020.849] (-1023.881) * (-1022.511) (-1023.122) [-1022.954] (-1019.761) -- 0:00:11 317000 -- (-1018.987) (-1019.214) (-1021.073) [-1021.380] * (-1019.722) (-1023.905) (-1020.804) [-1021.640] -- 0:00:11 317500 -- (-1020.051) (-1019.878) (-1020.676) [-1020.029] * [-1020.504] (-1023.500) (-1020.795) (-1025.085) -- 0:00:11 318000 -- (-1025.635) [-1020.457] (-1019.671) (-1021.166) * (-1025.433) (-1023.761) [-1019.588] (-1023.565) -- 0:00:11 318500 -- (-1023.771) [-1023.628] (-1020.653) (-1027.767) * (-1024.683) (-1024.001) [-1021.446] (-1022.615) -- 0:00:11 319000 -- [-1019.867] (-1021.681) (-1020.334) (-1025.895) * (-1025.055) [-1021.702] (-1023.606) (-1021.758) -- 0:00:11 319500 -- [-1019.564] (-1019.208) (-1022.416) (-1025.783) * (-1023.769) (-1022.196) (-1023.385) [-1023.191] -- 0:00:11 320000 -- (-1020.182) (-1021.480) [-1019.729] (-1022.600) * (-1022.670) [-1021.607] (-1019.840) (-1020.664) -- 0:00:11 Average standard deviation of split frequencies: 0.012302 320500 -- (-1020.120) (-1025.152) (-1021.535) [-1019.513] * [-1019.595] (-1020.217) (-1019.835) (-1019.295) -- 0:00:11 321000 -- (-1019.237) (-1023.320) [-1019.203] (-1020.188) * (-1021.649) [-1020.217] (-1020.569) (-1022.014) -- 0:00:11 321500 -- (-1019.649) (-1020.653) [-1021.678] (-1022.752) * (-1022.601) (-1020.084) [-1020.787] (-1020.633) -- 0:00:11 322000 -- (-1020.931) (-1024.124) [-1021.840] (-1025.987) * (-1025.728) (-1023.708) [-1020.598] (-1023.897) -- 0:00:11 322500 -- (-1022.277) (-1021.528) (-1022.339) [-1020.595] * [-1024.768] (-1021.433) (-1019.623) (-1021.388) -- 0:00:11 323000 -- (-1022.259) [-1021.622] (-1022.333) (-1018.999) * (-1022.576) [-1020.165] (-1019.914) (-1023.351) -- 0:00:11 323500 -- (-1021.293) [-1021.579] (-1020.689) (-1019.983) * [-1023.719] (-1022.278) (-1018.967) (-1022.953) -- 0:00:11 324000 -- (-1022.231) (-1020.531) [-1023.074] (-1022.395) * (-1021.971) (-1023.615) (-1020.850) [-1020.124] -- 0:00:11 324500 -- (-1021.871) [-1022.578] (-1023.906) (-1022.712) * (-1020.069) [-1020.863] (-1022.244) (-1021.284) -- 0:00:11 325000 -- [-1022.707] (-1020.987) (-1022.502) (-1022.133) * (-1023.561) (-1019.245) [-1019.405] (-1021.878) -- 0:00:11 Average standard deviation of split frequencies: 0.010959 325500 -- (-1021.407) (-1019.813) [-1019.494] (-1021.320) * (-1022.151) (-1020.318) (-1022.493) [-1020.837] -- 0:00:11 326000 -- (-1023.831) (-1025.308) [-1020.000] (-1023.636) * (-1021.374) [-1020.419] (-1020.300) (-1022.236) -- 0:00:11 326500 -- (-1020.177) [-1022.354] (-1023.706) (-1022.519) * [-1021.612] (-1019.973) (-1020.552) (-1021.966) -- 0:00:11 327000 -- [-1021.344] (-1019.736) (-1019.462) (-1021.706) * [-1023.613] (-1021.474) (-1019.416) (-1019.990) -- 0:00:11 327500 -- (-1022.385) (-1019.639) (-1019.623) [-1020.435] * [-1026.981] (-1021.697) (-1019.555) (-1023.134) -- 0:00:11 328000 -- (-1019.232) [-1023.575] (-1019.634) (-1023.632) * (-1025.086) (-1022.051) [-1021.341] (-1021.589) -- 0:00:11 328500 -- (-1022.808) [-1024.447] (-1022.006) (-1024.850) * (-1021.538) [-1020.346] (-1020.992) (-1020.591) -- 0:00:10 329000 -- (-1020.326) (-1022.491) (-1026.290) [-1019.971] * (-1020.759) (-1021.911) (-1021.339) [-1019.992] -- 0:00:10 329500 -- (-1021.270) (-1020.736) (-1022.481) [-1019.567] * (-1021.055) (-1028.319) (-1020.923) [-1019.801] -- 0:00:10 330000 -- (-1020.129) [-1023.546] (-1019.597) (-1020.383) * (-1020.659) [-1022.665] (-1023.642) (-1020.383) -- 0:00:10 Average standard deviation of split frequencies: 0.010851 330500 -- [-1019.556] (-1020.404) (-1021.066) (-1020.258) * (-1019.661) (-1021.027) (-1024.265) [-1021.412] -- 0:00:10 331000 -- (-1020.250) [-1019.455] (-1020.156) (-1022.532) * [-1019.001] (-1021.123) (-1020.494) (-1020.107) -- 0:00:10 331500 -- (-1025.044) [-1020.046] (-1020.495) (-1021.720) * [-1019.130] (-1024.802) (-1020.029) (-1023.315) -- 0:00:10 332000 -- (-1021.386) (-1020.140) [-1020.509] (-1022.438) * [-1019.387] (-1022.532) (-1019.883) (-1024.195) -- 0:00:10 332500 -- [-1019.501] (-1019.229) (-1021.647) (-1020.087) * [-1022.483] (-1025.801) (-1021.297) (-1020.334) -- 0:00:10 333000 -- (-1024.271) [-1019.713] (-1021.603) (-1021.379) * (-1023.196) [-1020.386] (-1022.570) (-1020.079) -- 0:00:10 333500 -- (-1019.909) (-1020.014) [-1023.212] (-1021.870) * [-1022.559] (-1023.416) (-1019.479) (-1021.124) -- 0:00:10 334000 -- (-1019.903) (-1019.280) (-1020.970) [-1020.198] * (-1021.093) [-1024.027] (-1020.414) (-1021.306) -- 0:00:10 334500 -- (-1019.814) [-1019.676] (-1020.784) (-1021.567) * (-1019.355) (-1020.932) (-1019.904) [-1021.583] -- 0:00:10 335000 -- [-1019.424] (-1020.401) (-1020.916) (-1022.393) * [-1019.579] (-1022.035) (-1019.958) (-1026.115) -- 0:00:10 Average standard deviation of split frequencies: 0.010834 335500 -- (-1020.464) [-1020.827] (-1020.356) (-1024.055) * (-1019.790) (-1020.057) (-1022.549) [-1021.920] -- 0:00:10 336000 -- (-1020.235) (-1020.868) (-1021.399) [-1019.488] * (-1021.050) (-1021.800) [-1022.063] (-1024.420) -- 0:00:10 336500 -- (-1020.376) (-1021.750) (-1021.396) [-1019.261] * (-1020.234) [-1021.193] (-1021.832) (-1025.888) -- 0:00:10 337000 -- (-1021.119) (-1021.331) (-1021.035) [-1020.208] * (-1019.661) (-1021.547) (-1021.847) [-1025.891] -- 0:00:10 337500 -- (-1022.907) (-1023.096) [-1021.122] (-1021.035) * [-1020.421] (-1024.344) (-1020.340) (-1021.128) -- 0:00:10 338000 -- [-1021.435] (-1020.681) (-1019.620) (-1020.928) * (-1022.098) [-1025.962] (-1021.601) (-1020.161) -- 0:00:10 338500 -- (-1024.292) [-1019.154] (-1019.345) (-1022.852) * [-1018.985] (-1020.540) (-1022.680) (-1023.169) -- 0:00:10 339000 -- [-1020.366] (-1022.676) (-1020.043) (-1018.996) * (-1019.062) (-1023.945) [-1020.395] (-1019.001) -- 0:00:10 339500 -- (-1020.632) (-1021.730) (-1020.252) [-1019.582] * (-1022.222) [-1027.855] (-1020.599) (-1021.151) -- 0:00:10 340000 -- (-1023.215) (-1021.421) [-1020.676] (-1020.069) * (-1019.697) [-1020.276] (-1023.098) (-1019.887) -- 0:00:10 Average standard deviation of split frequencies: 0.010071 340500 -- (-1025.698) (-1020.286) (-1021.595) [-1020.432] * (-1019.764) (-1019.637) (-1022.502) [-1022.386] -- 0:00:10 341000 -- [-1022.118] (-1020.803) (-1022.689) (-1023.745) * (-1022.735) [-1020.231] (-1021.883) (-1019.794) -- 0:00:10 341500 -- (-1026.200) [-1019.032] (-1023.289) (-1019.702) * (-1020.829) [-1020.723] (-1022.150) (-1019.004) -- 0:00:10 342000 -- (-1020.164) (-1022.311) (-1024.400) [-1019.993] * (-1021.575) (-1019.894) (-1025.357) [-1019.748] -- 0:00:10 342500 -- [-1019.754] (-1022.804) (-1021.631) (-1018.733) * (-1020.589) (-1019.899) [-1020.340] (-1019.461) -- 0:00:10 343000 -- (-1019.903) [-1020.676] (-1024.067) (-1021.710) * [-1021.309] (-1021.270) (-1019.659) (-1022.047) -- 0:00:10 343500 -- (-1020.295) (-1022.628) (-1020.513) [-1024.014] * [-1023.165] (-1024.367) (-1019.629) (-1019.380) -- 0:00:10 344000 -- (-1020.099) [-1020.746] (-1023.396) (-1022.197) * [-1023.021] (-1021.306) (-1019.283) (-1022.486) -- 0:00:09 344500 -- [-1020.456] (-1020.349) (-1021.517) (-1022.858) * (-1026.887) [-1021.166] (-1023.420) (-1022.815) -- 0:00:09 345000 -- [-1020.617] (-1019.069) (-1023.540) (-1020.778) * (-1023.256) (-1020.218) (-1024.133) [-1019.035] -- 0:00:09 Average standard deviation of split frequencies: 0.010294 345500 -- (-1021.292) [-1020.158] (-1021.945) (-1020.428) * (-1021.288) [-1019.299] (-1021.946) (-1020.271) -- 0:00:09 346000 -- (-1023.122) (-1024.626) [-1020.070] (-1020.130) * (-1020.192) [-1019.064] (-1021.963) (-1023.055) -- 0:00:09 346500 -- (-1024.209) (-1023.268) [-1019.456] (-1020.728) * (-1027.336) [-1018.933] (-1020.920) (-1020.272) -- 0:00:09 347000 -- (-1021.032) (-1022.157) [-1019.813] (-1022.615) * (-1020.596) [-1021.231] (-1020.899) (-1021.608) -- 0:00:09 347500 -- (-1022.074) [-1020.150] (-1019.351) (-1028.860) * (-1021.832) (-1019.973) (-1019.864) [-1020.809] -- 0:00:09 348000 -- [-1021.120] (-1021.241) (-1019.386) (-1021.449) * [-1020.722] (-1020.320) (-1023.398) (-1019.886) -- 0:00:09 348500 -- (-1020.601) [-1023.094] (-1020.497) (-1019.480) * (-1023.450) [-1020.495] (-1024.513) (-1023.545) -- 0:00:09 349000 -- (-1022.507) (-1020.744) (-1021.377) [-1021.480] * [-1024.395] (-1020.369) (-1023.334) (-1021.728) -- 0:00:09 349500 -- (-1022.102) (-1022.283) (-1019.764) [-1022.297] * (-1021.155) (-1022.310) (-1021.445) [-1021.345] -- 0:00:09 350000 -- (-1021.120) (-1019.860) (-1020.444) [-1019.482] * (-1026.612) [-1022.187] (-1021.245) (-1021.398) -- 0:00:09 Average standard deviation of split frequencies: 0.009410 350500 -- (-1020.568) (-1022.021) (-1019.955) [-1019.668] * (-1020.239) [-1022.031] (-1020.322) (-1020.539) -- 0:00:09 351000 -- (-1024.066) (-1019.601) [-1022.890] (-1020.696) * [-1019.814] (-1021.478) (-1023.511) (-1020.784) -- 0:00:09 351500 -- [-1021.428] (-1022.364) (-1020.111) (-1020.642) * (-1022.730) (-1020.068) [-1021.556] (-1021.952) -- 0:00:09 352000 -- [-1023.529] (-1024.099) (-1022.273) (-1021.193) * (-1019.187) (-1022.234) (-1025.680) [-1020.381] -- 0:00:09 352500 -- (-1020.270) [-1023.606] (-1021.306) (-1021.349) * (-1021.814) (-1019.610) (-1023.629) [-1024.498] -- 0:00:09 353000 -- (-1020.422) (-1022.149) (-1023.376) [-1018.917] * [-1025.044] (-1020.605) (-1019.917) (-1025.168) -- 0:00:09 353500 -- (-1021.331) (-1024.053) [-1023.565] (-1020.257) * (-1022.964) (-1023.587) [-1020.776] (-1021.107) -- 0:00:09 354000 -- [-1023.064] (-1021.414) (-1020.108) (-1021.876) * (-1023.697) (-1019.487) (-1021.395) [-1020.519] -- 0:00:09 354500 -- (-1023.092) [-1019.554] (-1022.459) (-1021.975) * (-1020.935) [-1019.438] (-1025.604) (-1023.943) -- 0:00:09 355000 -- (-1021.893) (-1020.144) [-1022.439] (-1022.413) * (-1020.416) [-1020.111] (-1021.077) (-1021.080) -- 0:00:09 Average standard deviation of split frequencies: 0.010226 355500 -- (-1022.087) (-1019.537) [-1018.874] (-1022.284) * (-1020.038) (-1023.992) [-1019.845] (-1020.169) -- 0:00:09 356000 -- [-1021.253] (-1019.462) (-1019.505) (-1020.416) * (-1022.626) (-1021.580) [-1019.830] (-1021.271) -- 0:00:09 356500 -- (-1022.987) (-1019.913) [-1024.795] (-1019.592) * [-1025.388] (-1022.419) (-1020.207) (-1020.762) -- 0:00:09 357000 -- (-1023.768) (-1019.166) [-1020.267] (-1020.800) * [-1019.085] (-1023.693) (-1020.028) (-1020.851) -- 0:00:09 357500 -- (-1023.389) (-1019.020) (-1020.950) [-1020.365] * (-1024.152) [-1023.048] (-1020.235) (-1019.242) -- 0:00:09 358000 -- (-1023.306) (-1022.633) [-1021.947] (-1020.740) * (-1019.848) [-1021.159] (-1021.439) (-1019.777) -- 0:00:09 358500 -- (-1022.881) [-1021.614] (-1019.307) (-1022.851) * (-1020.200) (-1019.092) (-1019.640) [-1019.736] -- 0:00:09 359000 -- (-1020.455) [-1019.314] (-1019.866) (-1023.166) * (-1020.592) (-1020.715) [-1019.353] (-1020.136) -- 0:00:09 359500 -- [-1020.700] (-1023.333) (-1019.763) (-1020.892) * (-1021.772) (-1019.507) [-1019.018] (-1019.505) -- 0:00:08 360000 -- (-1020.857) (-1022.725) [-1019.632] (-1019.341) * (-1025.661) (-1020.776) (-1024.240) [-1020.081] -- 0:00:08 Average standard deviation of split frequencies: 0.010747 360500 -- [-1020.832] (-1020.948) (-1022.046) (-1021.155) * (-1025.018) (-1020.539) [-1027.436] (-1019.940) -- 0:00:08 361000 -- (-1019.068) (-1021.992) [-1022.121] (-1020.246) * (-1022.747) (-1021.471) (-1026.732) [-1019.634] -- 0:00:08 361500 -- (-1021.637) (-1022.056) [-1020.548] (-1019.877) * (-1022.054) (-1019.481) (-1022.928) [-1020.142] -- 0:00:08 362000 -- (-1024.384) [-1022.473] (-1020.954) (-1020.521) * [-1020.318] (-1020.596) (-1022.991) (-1020.049) -- 0:00:08 362500 -- (-1021.031) (-1022.553) (-1022.438) [-1021.938] * (-1021.522) [-1020.460] (-1019.470) (-1021.494) -- 0:00:08 363000 -- (-1019.933) (-1019.460) (-1022.113) [-1024.286] * [-1022.304] (-1023.341) (-1019.725) (-1019.967) -- 0:00:08 363500 -- [-1021.759] (-1020.532) (-1020.503) (-1023.371) * [-1022.029] (-1020.731) (-1019.279) (-1021.915) -- 0:00:08 364000 -- (-1022.979) (-1019.885) [-1026.809] (-1021.956) * (-1023.051) [-1021.902] (-1018.929) (-1020.710) -- 0:00:08 364500 -- [-1024.406] (-1019.831) (-1024.505) (-1019.956) * (-1021.240) [-1023.154] (-1018.929) (-1021.099) -- 0:00:08 365000 -- (-1023.312) [-1019.739] (-1023.247) (-1020.809) * (-1024.619) (-1019.787) [-1019.658] (-1022.410) -- 0:00:08 Average standard deviation of split frequencies: 0.009875 365500 -- (-1019.899) [-1019.369] (-1023.439) (-1026.051) * [-1020.230] (-1020.193) (-1019.817) (-1022.988) -- 0:00:08 366000 -- (-1019.900) (-1021.784) [-1020.177] (-1020.952) * (-1021.506) [-1020.677] (-1021.626) (-1025.695) -- 0:00:08 366500 -- (-1019.475) (-1022.209) [-1021.147] (-1020.951) * [-1021.321] (-1021.544) (-1025.340) (-1020.735) -- 0:00:08 367000 -- (-1019.928) (-1020.538) [-1022.119] (-1026.990) * (-1020.698) (-1022.178) [-1025.176] (-1022.684) -- 0:00:08 367500 -- (-1020.576) (-1022.391) [-1020.280] (-1021.868) * (-1021.132) (-1022.959) (-1021.460) [-1019.954] -- 0:00:08 368000 -- (-1019.791) [-1019.414] (-1020.261) (-1021.530) * (-1023.870) (-1025.640) (-1020.595) [-1021.483] -- 0:00:08 368500 -- (-1019.175) [-1019.650] (-1019.986) (-1021.675) * (-1026.117) [-1020.114] (-1019.248) (-1025.008) -- 0:00:08 369000 -- (-1022.125) [-1022.868] (-1021.629) (-1021.113) * (-1023.189) [-1020.997] (-1020.170) (-1021.334) -- 0:00:08 369500 -- (-1020.453) (-1019.944) (-1021.809) [-1020.527] * (-1020.721) (-1025.768) [-1019.545] (-1021.202) -- 0:00:08 370000 -- (-1021.790) [-1019.697] (-1020.794) (-1019.764) * (-1020.769) (-1024.466) (-1018.743) [-1019.085] -- 0:00:08 Average standard deviation of split frequencies: 0.009773 370500 -- (-1020.650) (-1022.365) (-1022.943) [-1021.119] * [-1020.695] (-1026.276) (-1021.472) (-1018.934) -- 0:00:08 371000 -- (-1019.917) (-1020.144) (-1022.183) [-1020.179] * [-1020.505] (-1027.082) (-1019.947) (-1020.052) -- 0:00:08 371500 -- (-1020.600) [-1021.571] (-1020.239) (-1023.356) * [-1020.420] (-1023.591) (-1021.022) (-1024.685) -- 0:00:08 372000 -- (-1020.739) (-1020.279) [-1022.268] (-1022.238) * (-1021.119) (-1022.850) [-1021.140] (-1019.795) -- 0:00:08 372500 -- (-1020.516) (-1019.569) (-1022.519) [-1024.805] * (-1022.147) (-1022.118) (-1021.591) [-1019.913] -- 0:00:08 373000 -- (-1022.187) (-1021.463) [-1020.884] (-1021.363) * (-1020.323) (-1022.064) (-1021.318) [-1019.421] -- 0:00:08 373500 -- (-1023.568) (-1020.301) (-1020.168) [-1020.624] * (-1021.333) (-1019.792) [-1022.175] (-1019.869) -- 0:00:08 374000 -- (-1023.076) [-1021.228] (-1019.933) (-1021.343) * (-1020.932) (-1021.217) (-1020.790) [-1020.852] -- 0:00:08 374500 -- (-1020.953) [-1020.075] (-1023.234) (-1021.450) * (-1021.641) (-1020.370) (-1019.946) [-1021.408] -- 0:00:08 375000 -- (-1020.216) [-1020.442] (-1018.919) (-1023.971) * (-1023.220) (-1020.300) (-1020.736) [-1019.543] -- 0:00:08 Average standard deviation of split frequencies: 0.010308 375500 -- [-1023.858] (-1021.502) (-1021.037) (-1021.709) * (-1023.426) (-1021.696) (-1021.552) [-1021.375] -- 0:00:07 376000 -- [-1022.387] (-1023.547) (-1021.651) (-1021.935) * (-1028.081) (-1022.631) [-1020.052] (-1020.544) -- 0:00:07 376500 -- (-1020.443) (-1022.833) [-1020.797] (-1023.954) * (-1022.696) (-1019.166) [-1019.681] (-1027.143) -- 0:00:07 377000 -- (-1020.002) [-1020.067] (-1021.175) (-1021.321) * (-1022.342) (-1021.601) [-1021.988] (-1019.199) -- 0:00:07 377500 -- [-1020.411] (-1019.192) (-1021.581) (-1022.016) * (-1022.549) (-1022.940) (-1022.542) [-1019.272] -- 0:00:07 378000 -- (-1022.291) (-1019.343) (-1021.905) [-1021.329] * (-1023.571) (-1020.783) (-1020.470) [-1019.556] -- 0:00:07 378500 -- (-1033.573) [-1021.453] (-1019.960) (-1020.900) * [-1020.142] (-1022.372) (-1020.019) (-1019.575) -- 0:00:07 379000 -- (-1021.378) (-1021.359) (-1020.693) [-1020.578] * (-1022.780) (-1025.712) [-1020.328] (-1023.207) -- 0:00:07 379500 -- (-1022.589) (-1020.056) [-1019.870] (-1022.094) * (-1023.196) [-1021.634] (-1026.908) (-1021.192) -- 0:00:07 380000 -- (-1022.867) (-1020.003) (-1020.067) [-1023.098] * (-1020.463) (-1021.729) (-1025.019) [-1020.771] -- 0:00:07 Average standard deviation of split frequencies: 0.009907 380500 -- (-1022.603) [-1021.169] (-1021.585) (-1021.418) * (-1021.488) [-1020.151] (-1019.697) (-1019.981) -- 0:00:07 381000 -- (-1019.701) (-1022.786) [-1020.277] (-1022.616) * (-1019.356) (-1020.473) [-1022.472] (-1023.118) -- 0:00:07 381500 -- (-1028.597) [-1019.735] (-1021.878) (-1024.638) * (-1019.626) (-1022.153) [-1019.962] (-1021.190) -- 0:00:07 382000 -- [-1024.886] (-1019.935) (-1022.316) (-1026.311) * (-1020.951) (-1019.876) [-1019.813] (-1022.931) -- 0:00:07 382500 -- (-1022.624) [-1019.060] (-1022.228) (-1021.724) * (-1021.166) (-1019.822) [-1019.405] (-1019.875) -- 0:00:07 383000 -- (-1021.306) (-1019.390) [-1020.032] (-1021.714) * (-1020.639) (-1019.718) [-1020.475] (-1021.573) -- 0:00:07 383500 -- (-1021.616) (-1020.706) (-1021.452) [-1021.625] * [-1019.917] (-1020.736) (-1020.053) (-1022.306) -- 0:00:07 384000 -- (-1020.251) (-1020.261) (-1028.697) [-1021.233] * (-1021.079) (-1021.570) [-1021.723] (-1020.562) -- 0:00:07 384500 -- (-1021.297) (-1021.159) (-1027.011) [-1025.030] * [-1022.833] (-1022.941) (-1020.505) (-1020.308) -- 0:00:07 385000 -- (-1022.117) [-1020.646] (-1020.199) (-1025.277) * (-1022.174) [-1021.419] (-1021.132) (-1021.397) -- 0:00:07 Average standard deviation of split frequencies: 0.009770 385500 -- [-1019.957] (-1019.638) (-1020.785) (-1026.547) * (-1019.375) (-1019.941) [-1019.030] (-1022.725) -- 0:00:07 386000 -- [-1019.100] (-1020.531) (-1021.313) (-1020.646) * (-1020.967) (-1020.610) (-1022.125) [-1023.825] -- 0:00:07 386500 -- (-1018.950) (-1020.657) [-1021.105] (-1019.674) * (-1022.579) [-1020.418] (-1019.465) (-1020.703) -- 0:00:07 387000 -- (-1019.770) (-1024.864) [-1020.542] (-1020.339) * [-1021.277] (-1020.414) (-1020.613) (-1022.938) -- 0:00:07 387500 -- (-1021.819) [-1020.667] (-1025.012) (-1021.255) * (-1019.912) (-1021.333) (-1020.151) [-1024.065] -- 0:00:07 388000 -- (-1024.644) (-1021.754) (-1023.974) [-1020.287] * (-1019.947) [-1019.528] (-1023.907) (-1023.874) -- 0:00:07 388500 -- [-1019.757] (-1020.146) (-1024.337) (-1020.260) * (-1020.357) [-1018.974] (-1020.656) (-1023.337) -- 0:00:07 389000 -- (-1019.330) (-1022.441) (-1022.079) [-1019.399] * [-1020.309] (-1020.897) (-1020.596) (-1023.869) -- 0:00:07 389500 -- [-1019.114] (-1019.457) (-1019.754) (-1019.296) * [-1019.656] (-1019.245) (-1019.736) (-1021.737) -- 0:00:07 390000 -- (-1023.353) [-1019.719] (-1019.939) (-1019.088) * (-1021.345) (-1024.324) [-1019.339] (-1020.314) -- 0:00:07 Average standard deviation of split frequencies: 0.010324 390500 -- (-1022.690) [-1020.849] (-1022.695) (-1020.742) * (-1021.757) [-1022.295] (-1019.302) (-1019.321) -- 0:00:07 391000 -- (-1022.212) (-1024.010) [-1022.048] (-1022.767) * (-1024.084) (-1021.761) (-1019.179) [-1019.816] -- 0:00:06 391500 -- (-1020.030) (-1023.719) (-1021.290) [-1020.251] * (-1023.932) (-1020.698) (-1020.244) [-1020.033] -- 0:00:06 392000 -- [-1020.652] (-1022.126) (-1029.216) (-1021.063) * (-1020.483) (-1020.209) [-1020.967] (-1021.420) -- 0:00:06 392500 -- (-1020.078) (-1022.059) [-1024.343] (-1023.746) * [-1021.553] (-1019.076) (-1019.812) (-1022.907) -- 0:00:06 393000 -- [-1019.221] (-1024.102) (-1020.905) (-1024.321) * [-1021.891] (-1018.936) (-1020.015) (-1019.429) -- 0:00:06 393500 -- [-1018.975] (-1022.267) (-1019.408) (-1020.934) * (-1024.961) (-1018.936) (-1020.108) [-1019.087] -- 0:00:06 394000 -- (-1020.073) [-1021.255] (-1019.864) (-1023.357) * (-1020.699) (-1019.176) [-1020.435] (-1019.658) -- 0:00:06 394500 -- [-1022.725] (-1021.813) (-1024.069) (-1019.784) * (-1019.891) [-1023.592] (-1020.932) (-1022.215) -- 0:00:06 395000 -- (-1021.791) (-1023.208) [-1024.571] (-1021.486) * (-1019.145) (-1020.722) (-1021.224) [-1022.072] -- 0:00:06 Average standard deviation of split frequencies: 0.010013 395500 -- (-1028.569) (-1022.508) [-1024.539] (-1020.482) * (-1021.441) (-1019.548) [-1020.716] (-1022.098) -- 0:00:06 396000 -- (-1021.123) (-1019.210) [-1019.728] (-1022.908) * (-1020.836) (-1019.549) (-1022.753) [-1019.833] -- 0:00:06 396500 -- [-1020.042] (-1020.501) (-1022.140) (-1021.636) * (-1022.071) (-1025.752) (-1022.835) [-1020.147] -- 0:00:06 397000 -- [-1019.964] (-1020.919) (-1019.871) (-1021.625) * (-1024.132) (-1025.323) [-1020.975] (-1022.613) -- 0:00:06 397500 -- (-1021.610) (-1022.329) [-1020.399] (-1021.443) * (-1022.192) [-1021.916] (-1023.204) (-1021.272) -- 0:00:06 398000 -- (-1020.673) [-1022.935] (-1021.030) (-1025.655) * (-1021.132) (-1022.347) (-1019.546) [-1019.494] -- 0:00:06 398500 -- (-1019.235) (-1021.494) [-1021.926] (-1019.957) * [-1020.917] (-1021.461) (-1021.854) (-1020.240) -- 0:00:06 399000 -- (-1022.176) (-1023.870) (-1021.226) [-1021.592] * (-1021.327) (-1024.493) (-1021.559) [-1022.400] -- 0:00:06 399500 -- (-1024.815) (-1028.278) [-1021.088] (-1020.219) * [-1025.090] (-1020.710) (-1020.778) (-1022.049) -- 0:00:06 400000 -- (-1021.941) [-1019.211] (-1019.785) (-1019.928) * [-1019.729] (-1020.555) (-1021.368) (-1021.925) -- 0:00:06 Average standard deviation of split frequencies: 0.008859 400500 -- (-1022.345) [-1026.256] (-1022.764) (-1020.935) * (-1021.374) (-1019.738) [-1021.025] (-1022.665) -- 0:00:06 401000 -- (-1022.771) (-1020.509) [-1020.801] (-1020.577) * (-1022.164) [-1021.311] (-1023.413) (-1022.129) -- 0:00:06 401500 -- [-1021.049] (-1026.317) (-1020.727) (-1021.955) * (-1021.359) [-1019.450] (-1026.172) (-1020.331) -- 0:00:06 402000 -- (-1022.769) (-1019.437) [-1021.490] (-1022.411) * (-1021.142) [-1021.162] (-1022.139) (-1020.647) -- 0:00:06 402500 -- (-1019.863) [-1021.083] (-1021.292) (-1023.129) * [-1019.484] (-1022.123) (-1021.256) (-1021.470) -- 0:00:06 403000 -- (-1020.274) [-1022.198] (-1021.027) (-1021.857) * [-1020.189] (-1021.270) (-1021.034) (-1020.534) -- 0:00:06 403500 -- (-1020.100) (-1023.069) [-1020.351] (-1019.553) * (-1020.273) (-1021.930) [-1019.634] (-1025.155) -- 0:00:06 404000 -- [-1022.075] (-1022.046) (-1022.623) (-1020.857) * [-1022.265] (-1022.176) (-1020.304) (-1027.183) -- 0:00:06 404500 -- (-1019.223) (-1025.838) [-1020.869] (-1021.489) * (-1021.038) (-1021.442) [-1020.775] (-1026.660) -- 0:00:06 405000 -- (-1020.524) (-1022.686) [-1020.438] (-1020.232) * (-1021.132) [-1022.555] (-1024.512) (-1022.801) -- 0:00:06 Average standard deviation of split frequencies: 0.009494 405500 -- [-1019.316] (-1021.701) (-1020.433) (-1019.846) * (-1022.052) (-1021.386) [-1022.624] (-1020.132) -- 0:00:06 406000 -- (-1021.439) (-1021.917) (-1024.439) [-1022.558] * (-1020.506) [-1023.197] (-1020.297) (-1021.918) -- 0:00:06 406500 -- (-1019.404) [-1021.487] (-1030.945) (-1019.072) * [-1021.513] (-1020.609) (-1019.913) (-1023.305) -- 0:00:05 407000 -- [-1021.053] (-1021.224) (-1020.984) (-1019.083) * (-1021.409) (-1019.052) (-1020.712) [-1020.734] -- 0:00:05 407500 -- (-1019.295) (-1024.162) [-1022.324] (-1020.145) * [-1023.469] (-1019.984) (-1019.828) (-1022.777) -- 0:00:05 408000 -- [-1022.882] (-1023.787) (-1022.500) (-1021.369) * (-1022.932) (-1020.003) [-1020.822] (-1021.682) -- 0:00:05 408500 -- (-1023.251) (-1022.264) [-1023.785] (-1023.388) * (-1023.475) (-1022.190) [-1019.919] (-1019.374) -- 0:00:05 409000 -- [-1023.332] (-1023.366) (-1019.570) (-1020.840) * (-1023.507) (-1022.112) (-1019.723) [-1021.583] -- 0:00:05 409500 -- (-1023.033) (-1021.926) [-1020.216] (-1020.822) * [-1023.148] (-1023.747) (-1019.475) (-1027.330) -- 0:00:05 410000 -- (-1020.189) (-1022.653) (-1018.909) [-1018.900] * (-1020.622) (-1021.326) [-1020.085] (-1020.684) -- 0:00:05 Average standard deviation of split frequencies: 0.010459 410500 -- [-1020.971] (-1020.817) (-1018.734) (-1023.017) * (-1020.841) [-1019.256] (-1020.016) (-1019.027) -- 0:00:05 411000 -- (-1022.644) (-1021.593) (-1024.010) [-1020.517] * [-1020.307] (-1023.319) (-1020.752) (-1026.484) -- 0:00:05 411500 -- (-1027.056) [-1023.168] (-1022.411) (-1020.037) * (-1024.067) (-1021.490) [-1022.041] (-1029.936) -- 0:00:05 412000 -- (-1024.922) [-1022.522] (-1019.638) (-1019.948) * (-1021.401) (-1021.150) [-1021.514] (-1020.320) -- 0:00:05 412500 -- (-1022.995) (-1021.245) (-1021.184) [-1020.010] * [-1019.750] (-1020.454) (-1020.231) (-1019.930) -- 0:00:05 413000 -- [-1024.154] (-1020.522) (-1021.377) (-1022.898) * (-1020.110) [-1020.073] (-1019.578) (-1023.865) -- 0:00:05 413500 -- (-1024.781) [-1020.701] (-1019.599) (-1023.491) * [-1022.054] (-1021.745) (-1019.766) (-1021.572) -- 0:00:05 414000 -- [-1020.252] (-1020.718) (-1019.970) (-1020.516) * (-1020.447) [-1021.815] (-1019.559) (-1020.655) -- 0:00:05 414500 -- (-1024.225) (-1022.643) (-1021.940) [-1021.229] * (-1022.314) [-1022.850] (-1020.308) (-1020.786) -- 0:00:05 415000 -- (-1020.489) (-1021.012) (-1020.549) [-1023.352] * (-1023.091) (-1019.383) (-1022.163) [-1020.762] -- 0:00:05 Average standard deviation of split frequencies: 0.010639 415500 -- (-1020.543) (-1023.612) [-1024.380] (-1022.328) * (-1019.167) [-1019.163] (-1019.843) (-1020.871) -- 0:00:05 416000 -- (-1022.001) (-1020.884) (-1021.640) [-1020.418] * (-1019.394) (-1027.086) (-1021.814) [-1020.604] -- 0:00:05 416500 -- (-1022.410) (-1022.682) (-1022.536) [-1021.104] * (-1019.167) [-1023.150] (-1020.175) (-1022.250) -- 0:00:05 417000 -- (-1024.596) [-1019.625] (-1019.854) (-1020.914) * [-1020.306] (-1021.245) (-1024.912) (-1021.738) -- 0:00:05 417500 -- [-1020.133] (-1020.161) (-1020.492) (-1019.891) * (-1020.670) (-1022.488) [-1022.364] (-1021.531) -- 0:00:05 418000 -- (-1021.574) (-1022.582) [-1020.575] (-1018.986) * (-1022.323) (-1022.138) [-1022.350] (-1021.438) -- 0:00:05 418500 -- (-1026.963) (-1027.855) [-1021.704] (-1019.456) * (-1021.903) [-1021.219] (-1020.450) (-1021.411) -- 0:00:05 419000 -- (-1022.438) [-1022.438] (-1019.934) (-1020.667) * (-1022.679) (-1019.193) [-1019.901] (-1019.710) -- 0:00:05 419500 -- (-1022.450) (-1021.571) (-1019.560) [-1020.014] * (-1021.055) [-1022.446] (-1024.608) (-1021.677) -- 0:00:05 420000 -- [-1020.774] (-1024.160) (-1024.906) (-1019.319) * (-1026.946) [-1019.733] (-1022.340) (-1021.283) -- 0:00:05 Average standard deviation of split frequencies: 0.010833 420500 -- (-1020.792) (-1021.248) [-1024.413] (-1020.817) * [-1023.294] (-1022.286) (-1020.604) (-1022.200) -- 0:00:05 421000 -- (-1020.827) (-1020.039) (-1020.776) [-1020.333] * (-1023.073) (-1024.312) (-1022.887) [-1022.443] -- 0:00:05 421500 -- (-1023.409) (-1020.322) (-1020.044) [-1024.289] * [-1021.203] (-1022.296) (-1021.516) (-1021.955) -- 0:00:05 422000 -- (-1021.037) (-1020.265) (-1022.284) [-1024.711] * [-1022.310] (-1022.055) (-1020.181) (-1020.044) -- 0:00:04 422500 -- [-1021.371] (-1020.756) (-1020.717) (-1020.074) * (-1023.461) (-1019.687) [-1021.247] (-1019.239) -- 0:00:04 423000 -- (-1021.023) [-1021.798] (-1022.719) (-1023.423) * (-1025.345) (-1019.394) [-1022.542] (-1019.286) -- 0:00:04 423500 -- (-1021.837) (-1021.037) [-1024.600] (-1021.296) * (-1025.797) (-1021.291) [-1019.431] (-1021.821) -- 0:00:04 424000 -- (-1019.014) [-1020.916] (-1026.119) (-1026.487) * (-1022.791) [-1019.562] (-1021.432) (-1020.315) -- 0:00:04 424500 -- (-1024.156) (-1021.451) [-1020.023] (-1023.967) * [-1021.864] (-1020.446) (-1020.419) (-1020.560) -- 0:00:04 425000 -- (-1020.904) [-1019.796] (-1027.296) (-1023.073) * [-1019.224] (-1022.914) (-1019.460) (-1020.511) -- 0:00:04 Average standard deviation of split frequencies: 0.011232 425500 -- (-1027.075) (-1019.534) [-1022.006] (-1019.532) * (-1019.574) (-1022.094) (-1019.818) [-1023.899] -- 0:00:04 426000 -- [-1020.379] (-1020.064) (-1020.938) (-1020.638) * [-1022.306] (-1027.064) (-1020.236) (-1021.221) -- 0:00:04 426500 -- (-1021.190) (-1019.843) [-1022.860] (-1021.927) * (-1021.088) [-1021.424] (-1024.235) (-1030.727) -- 0:00:04 427000 -- (-1021.634) [-1019.283] (-1021.512) (-1019.868) * (-1022.095) (-1021.399) [-1026.855] (-1020.755) -- 0:00:04 427500 -- [-1018.972] (-1019.200) (-1019.745) (-1021.495) * (-1021.546) (-1023.092) (-1019.655) [-1020.870] -- 0:00:04 428000 -- [-1021.659] (-1020.108) (-1023.117) (-1020.272) * [-1024.594] (-1021.922) (-1019.728) (-1019.965) -- 0:00:04 428500 -- (-1024.394) [-1020.140] (-1023.698) (-1020.560) * (-1026.181) [-1023.164] (-1020.832) (-1020.845) -- 0:00:04 429000 -- [-1020.267] (-1020.421) (-1019.740) (-1018.841) * (-1021.993) [-1023.814] (-1021.596) (-1020.479) -- 0:00:04 429500 -- (-1022.092) (-1024.879) [-1020.460] (-1018.837) * (-1021.846) [-1021.162] (-1021.216) (-1020.801) -- 0:00:04 430000 -- (-1022.479) [-1018.803] (-1021.003) (-1020.070) * [-1021.422] (-1023.689) (-1019.381) (-1020.039) -- 0:00:04 Average standard deviation of split frequencies: 0.010703 430500 -- (-1023.005) (-1019.128) (-1020.373) [-1019.974] * (-1021.119) (-1022.589) (-1020.135) [-1020.488] -- 0:00:04 431000 -- (-1024.578) [-1021.572] (-1025.524) (-1021.228) * [-1020.818] (-1025.495) (-1019.080) (-1023.575) -- 0:00:04 431500 -- (-1024.274) (-1023.251) (-1024.284) [-1020.084] * (-1019.541) (-1021.199) [-1018.731] (-1020.620) -- 0:00:04 432000 -- (-1020.764) [-1020.580] (-1020.120) (-1024.127) * (-1019.517) [-1021.969] (-1019.230) (-1021.599) -- 0:00:04 432500 -- (-1020.895) [-1021.237] (-1020.179) (-1019.787) * (-1020.813) (-1022.738) [-1020.035] (-1022.812) -- 0:00:04 433000 -- (-1020.849) [-1020.739] (-1019.425) (-1019.302) * [-1023.582] (-1025.719) (-1020.383) (-1024.641) -- 0:00:04 433500 -- (-1019.419) (-1020.370) [-1019.812] (-1019.232) * (-1020.874) (-1019.496) (-1019.231) [-1021.788] -- 0:00:04 434000 -- (-1021.123) (-1019.654) (-1020.168) [-1020.481] * (-1019.800) (-1020.153) [-1019.753] (-1020.793) -- 0:00:04 434500 -- (-1021.236) [-1020.980] (-1021.025) (-1020.237) * [-1020.086] (-1020.950) (-1021.597) (-1021.238) -- 0:00:04 435000 -- [-1019.654] (-1024.318) (-1022.963) (-1020.237) * (-1019.594) (-1021.302) [-1022.669] (-1020.508) -- 0:00:04 Average standard deviation of split frequencies: 0.011552 435500 -- (-1020.801) [-1021.774] (-1022.062) (-1020.793) * (-1020.553) (-1020.535) (-1022.704) [-1022.803] -- 0:00:04 436000 -- (-1021.526) (-1022.289) (-1021.773) [-1020.945] * (-1022.123) (-1020.175) (-1024.073) [-1023.484] -- 0:00:04 436500 -- (-1018.838) [-1020.775] (-1026.739) (-1020.828) * (-1023.827) (-1020.070) [-1022.320] (-1029.067) -- 0:00:04 437000 -- (-1022.046) (-1022.197) (-1022.180) [-1019.937] * (-1021.371) (-1019.364) [-1020.266] (-1023.694) -- 0:00:04 437500 -- (-1021.332) (-1020.606) [-1020.644] (-1021.384) * [-1022.867] (-1020.385) (-1023.525) (-1020.659) -- 0:00:04 438000 -- (-1022.680) [-1022.511] (-1022.386) (-1024.174) * (-1021.167) (-1019.950) (-1020.549) [-1025.034] -- 0:00:03 438500 -- (-1019.826) (-1019.896) [-1022.008] (-1020.264) * (-1023.824) (-1020.645) [-1022.493] (-1020.030) -- 0:00:03 439000 -- (-1019.179) (-1023.216) (-1024.564) [-1019.700] * (-1022.102) [-1020.364] (-1020.746) (-1020.975) -- 0:00:03 439500 -- (-1022.832) [-1021.660] (-1023.094) (-1019.745) * (-1021.506) [-1019.079] (-1024.913) (-1022.966) -- 0:00:03 440000 -- (-1020.667) (-1019.991) (-1020.969) [-1020.586] * (-1020.771) (-1020.103) [-1019.438] (-1020.550) -- 0:00:03 Average standard deviation of split frequencies: 0.010638 440500 -- [-1019.223] (-1020.001) (-1020.614) (-1025.061) * [-1019.869] (-1024.373) (-1021.300) (-1021.172) -- 0:00:03 441000 -- [-1023.903] (-1023.863) (-1020.332) (-1020.725) * (-1024.175) [-1024.130] (-1025.425) (-1020.937) -- 0:00:03 441500 -- (-1026.083) [-1021.944] (-1021.696) (-1020.426) * (-1022.008) (-1023.195) [-1025.298] (-1023.310) -- 0:00:03 442000 -- (-1025.395) (-1021.237) [-1019.546] (-1019.135) * (-1020.189) [-1020.827] (-1024.078) (-1020.298) -- 0:00:03 442500 -- (-1024.107) (-1020.847) [-1019.258] (-1020.655) * [-1020.114] (-1022.866) (-1023.710) (-1024.788) -- 0:00:03 443000 -- (-1021.135) (-1023.696) (-1021.276) [-1027.147] * (-1024.077) (-1023.554) [-1023.885] (-1019.630) -- 0:00:03 443500 -- (-1021.708) (-1020.832) (-1021.921) [-1021.927] * (-1023.772) (-1021.689) [-1020.592] (-1022.443) -- 0:00:03 444000 -- (-1019.523) (-1020.496) [-1021.355] (-1019.586) * (-1022.620) [-1018.809] (-1020.547) (-1020.810) -- 0:00:03 444500 -- [-1020.636] (-1019.546) (-1025.674) (-1022.369) * (-1022.447) (-1019.732) (-1019.498) [-1023.215] -- 0:00:03 445000 -- (-1022.257) (-1020.131) (-1020.292) [-1021.087] * [-1020.385] (-1021.215) (-1019.975) (-1020.229) -- 0:00:03 Average standard deviation of split frequencies: 0.010848 445500 -- (-1021.712) (-1019.734) [-1020.882] (-1019.242) * (-1021.441) (-1021.403) (-1019.725) [-1019.754] -- 0:00:03 446000 -- (-1023.256) (-1019.201) (-1027.940) [-1019.958] * (-1023.933) (-1020.295) [-1019.755] (-1021.751) -- 0:00:03 446500 -- [-1021.570] (-1020.545) (-1022.004) (-1023.266) * (-1024.046) (-1021.642) (-1019.495) [-1020.317] -- 0:00:03 447000 -- (-1020.536) [-1021.013] (-1021.579) (-1022.937) * [-1023.560] (-1028.217) (-1021.543) (-1023.837) -- 0:00:03 447500 -- (-1020.626) (-1020.852) (-1022.891) [-1020.864] * (-1023.775) (-1021.015) [-1020.273] (-1019.988) -- 0:00:03 448000 -- (-1019.430) (-1026.597) (-1022.332) [-1019.780] * (-1023.582) [-1020.143] (-1024.512) (-1020.347) -- 0:00:03 448500 -- (-1019.026) [-1019.412] (-1021.199) (-1019.534) * [-1020.731] (-1020.614) (-1020.046) (-1020.651) -- 0:00:03 449000 -- (-1019.093) (-1018.933) [-1019.356] (-1020.031) * (-1022.690) [-1020.038] (-1020.618) (-1021.387) -- 0:00:03 449500 -- (-1021.695) [-1020.356] (-1021.113) (-1023.801) * (-1021.073) (-1019.933) [-1020.189] (-1026.117) -- 0:00:03 450000 -- [-1019.348] (-1018.989) (-1019.052) (-1020.860) * (-1024.638) (-1021.283) (-1020.200) [-1022.222] -- 0:00:03 Average standard deviation of split frequencies: 0.010130 450500 -- (-1019.695) (-1019.055) [-1019.812] (-1021.012) * [-1020.965] (-1023.511) (-1020.384) (-1019.544) -- 0:00:03 451000 -- (-1021.357) (-1019.706) (-1024.471) [-1021.152] * [-1019.189] (-1019.226) (-1022.789) (-1023.495) -- 0:00:03 451500 -- (-1021.040) (-1019.725) [-1020.771] (-1023.941) * (-1019.171) (-1018.913) [-1023.055] (-1020.060) -- 0:00:03 452000 -- (-1019.950) (-1020.407) [-1022.051] (-1020.953) * (-1020.159) (-1020.648) [-1020.711] (-1023.462) -- 0:00:03 452500 -- (-1022.677) (-1021.206) (-1022.686) [-1019.494] * (-1023.533) (-1021.937) [-1019.847] (-1023.435) -- 0:00:03 453000 -- (-1020.664) [-1021.939] (-1023.747) (-1019.630) * [-1020.117] (-1023.940) (-1024.530) (-1022.765) -- 0:00:03 453500 -- (-1021.447) [-1020.358] (-1022.826) (-1022.444) * (-1019.289) [-1022.469] (-1026.044) (-1022.875) -- 0:00:02 454000 -- [-1022.482] (-1020.167) (-1024.248) (-1020.089) * (-1021.388) (-1027.672) [-1020.073] (-1020.099) -- 0:00:02 454500 -- (-1023.050) (-1020.320) (-1029.665) [-1019.631] * [-1019.814] (-1023.046) (-1018.878) (-1023.040) -- 0:00:02 455000 -- (-1022.794) [-1020.563] (-1021.203) (-1022.769) * (-1020.033) [-1022.971] (-1018.878) (-1022.418) -- 0:00:02 Average standard deviation of split frequencies: 0.010447 455500 -- (-1019.463) (-1021.471) (-1021.109) [-1020.923] * (-1020.419) [-1021.237] (-1020.413) (-1021.587) -- 0:00:02 456000 -- (-1021.171) (-1021.466) (-1019.528) [-1020.909] * [-1020.927] (-1020.710) (-1020.704) (-1020.710) -- 0:00:02 456500 -- [-1020.128] (-1020.855) (-1020.075) (-1021.813) * (-1019.649) [-1020.616] (-1020.463) (-1019.093) -- 0:00:02 457000 -- [-1019.793] (-1019.338) (-1020.670) (-1022.966) * (-1022.095) (-1019.498) [-1021.474] (-1019.093) -- 0:00:02 457500 -- [-1019.985] (-1019.768) (-1022.485) (-1020.913) * [-1020.974] (-1019.938) (-1020.936) (-1019.760) -- 0:00:02 458000 -- (-1019.786) [-1021.325] (-1021.681) (-1022.758) * [-1022.026] (-1020.277) (-1021.070) (-1020.201) -- 0:00:02 458500 -- [-1020.369] (-1019.766) (-1022.624) (-1019.823) * (-1021.312) [-1019.727] (-1022.502) (-1022.530) -- 0:00:02 459000 -- [-1019.797] (-1022.607) (-1025.567) (-1021.346) * (-1021.219) [-1020.678] (-1019.938) (-1021.201) -- 0:00:02 459500 -- (-1019.385) [-1023.608] (-1022.555) (-1021.597) * (-1020.188) (-1019.691) [-1020.662] (-1021.483) -- 0:00:02 460000 -- (-1022.474) (-1023.462) [-1022.077] (-1022.099) * (-1020.119) (-1024.083) [-1020.655] (-1020.951) -- 0:00:02 Average standard deviation of split frequencies: 0.010395 460500 -- (-1021.595) [-1022.216] (-1023.266) (-1020.542) * (-1020.276) (-1024.470) [-1021.208] (-1022.946) -- 0:00:02 461000 -- (-1020.907) (-1021.676) [-1024.200] (-1020.611) * [-1022.303] (-1025.548) (-1024.239) (-1022.452) -- 0:00:02 461500 -- (-1022.756) (-1020.843) [-1019.969] (-1022.224) * (-1023.136) [-1021.933] (-1020.606) (-1022.139) -- 0:00:02 462000 -- (-1022.653) [-1020.674] (-1023.088) (-1023.599) * [-1020.495] (-1020.567) (-1023.495) (-1020.925) -- 0:00:02 462500 -- (-1019.711) [-1021.538] (-1022.205) (-1019.413) * (-1020.566) [-1020.744] (-1024.623) (-1021.171) -- 0:00:02 463000 -- (-1020.322) (-1024.550) [-1019.847] (-1019.347) * (-1020.754) [-1019.151] (-1025.074) (-1019.361) -- 0:00:02 463500 -- (-1024.605) [-1023.096] (-1020.261) (-1019.420) * (-1020.536) (-1021.434) (-1023.984) [-1021.813] -- 0:00:02 464000 -- (-1020.934) (-1020.893) (-1022.238) [-1018.958] * (-1022.343) [-1020.682] (-1019.722) (-1020.014) -- 0:00:02 464500 -- (-1024.074) (-1021.088) [-1022.704] (-1020.868) * [-1022.127] (-1020.251) (-1020.877) (-1024.919) -- 0:00:02 465000 -- (-1024.975) [-1021.118] (-1021.102) (-1019.474) * (-1027.099) [-1022.955] (-1023.704) (-1023.706) -- 0:00:02 Average standard deviation of split frequencies: 0.009637 465500 -- (-1021.347) (-1023.148) (-1024.548) [-1021.050] * [-1020.268] (-1022.062) (-1019.945) (-1026.241) -- 0:00:02 466000 -- [-1022.735] (-1020.623) (-1020.771) (-1019.784) * (-1019.606) (-1019.402) [-1019.439] (-1026.970) -- 0:00:02 466500 -- (-1022.274) [-1023.883] (-1019.966) (-1022.966) * (-1025.523) (-1019.172) [-1019.882] (-1024.039) -- 0:00:02 467000 -- (-1021.654) [-1023.008] (-1020.228) (-1023.006) * (-1022.723) (-1019.706) [-1019.493] (-1023.483) -- 0:00:02 467500 -- (-1020.249) (-1021.153) [-1020.490] (-1021.368) * (-1020.820) (-1022.507) (-1023.053) [-1022.909] -- 0:00:02 468000 -- (-1023.209) [-1024.946] (-1019.218) (-1019.668) * (-1023.499) (-1021.724) [-1021.737] (-1019.370) -- 0:00:02 468500 -- (-1021.814) (-1026.462) [-1018.866] (-1019.969) * (-1022.181) (-1021.698) (-1020.977) [-1020.771] -- 0:00:02 469000 -- (-1020.496) (-1020.324) (-1022.591) [-1021.036] * (-1020.693) (-1023.451) [-1019.847] (-1021.772) -- 0:00:01 469500 -- [-1022.010] (-1024.158) (-1023.230) (-1023.872) * [-1021.159] (-1023.844) (-1021.868) (-1020.501) -- 0:00:01 470000 -- (-1022.055) (-1023.821) (-1023.590) [-1021.459] * (-1025.917) (-1021.649) (-1024.984) [-1020.025] -- 0:00:01 Average standard deviation of split frequencies: 0.010016 470500 -- (-1020.726) (-1022.075) [-1020.126] (-1022.577) * (-1022.014) (-1022.099) (-1020.295) [-1022.290] -- 0:00:01 471000 -- (-1021.039) (-1019.348) [-1019.743] (-1024.329) * (-1020.071) (-1020.820) [-1020.232] (-1022.651) -- 0:00:01 471500 -- [-1019.275] (-1019.354) (-1019.380) (-1021.958) * (-1023.327) (-1019.725) [-1019.917] (-1021.414) -- 0:00:01 472000 -- (-1025.360) [-1020.228] (-1019.826) (-1023.643) * [-1020.786] (-1020.575) (-1020.785) (-1020.490) -- 0:00:01 472500 -- [-1019.238] (-1023.400) (-1020.723) (-1020.556) * (-1023.996) (-1019.842) (-1021.089) [-1019.658] -- 0:00:01 473000 -- [-1020.133] (-1023.954) (-1020.984) (-1022.563) * (-1021.290) (-1020.137) [-1020.345] (-1020.456) -- 0:00:01 473500 -- (-1028.294) (-1019.393) [-1019.137] (-1021.046) * (-1019.987) [-1025.581] (-1020.716) (-1021.556) -- 0:00:01 474000 -- (-1022.612) [-1019.188] (-1019.484) (-1023.139) * [-1022.579] (-1021.531) (-1022.546) (-1022.324) -- 0:00:01 474500 -- (-1021.083) (-1024.010) (-1020.044) [-1021.776] * (-1022.118) (-1022.555) [-1020.698] (-1021.775) -- 0:00:01 475000 -- (-1021.396) (-1020.761) [-1020.058] (-1020.053) * (-1023.213) (-1022.499) [-1023.819] (-1021.727) -- 0:00:01 Average standard deviation of split frequencies: 0.010477 475500 -- (-1021.575) (-1020.672) (-1019.526) [-1022.013] * [-1021.205] (-1022.321) (-1021.637) (-1021.960) -- 0:00:01 476000 -- (-1021.625) (-1022.550) [-1019.528] (-1019.413) * (-1020.054) (-1020.849) (-1022.825) [-1020.526] -- 0:00:01 476500 -- (-1022.267) (-1028.287) [-1020.459] (-1026.296) * [-1018.906] (-1023.333) (-1019.891) (-1020.348) -- 0:00:01 477000 -- (-1021.190) (-1020.937) (-1021.955) [-1023.199] * (-1019.913) (-1020.996) [-1019.284] (-1018.721) -- 0:00:01 477500 -- (-1026.150) (-1022.500) [-1020.282] (-1022.083) * (-1023.534) (-1022.414) [-1020.428] (-1020.752) -- 0:00:01 478000 -- (-1022.122) [-1019.937] (-1023.643) (-1021.705) * [-1022.347] (-1022.533) (-1019.516) (-1021.220) -- 0:00:01 478500 -- (-1020.542) (-1020.033) [-1020.548] (-1021.942) * (-1020.716) (-1019.372) (-1025.744) [-1020.213] -- 0:00:01 479000 -- (-1020.435) (-1020.713) (-1022.407) [-1023.247] * (-1019.662) (-1021.332) (-1021.529) [-1022.431] -- 0:00:01 479500 -- [-1020.945] (-1022.544) (-1022.557) (-1021.281) * (-1026.221) (-1020.868) [-1020.464] (-1020.803) -- 0:00:01 480000 -- (-1024.061) [-1021.756] (-1019.755) (-1018.942) * (-1020.119) (-1019.771) [-1018.900] (-1022.019) -- 0:00:01 Average standard deviation of split frequencies: 0.009807 480500 -- (-1022.812) (-1019.107) (-1018.769) [-1021.372] * [-1019.983] (-1024.522) (-1023.187) (-1019.816) -- 0:00:01 481000 -- (-1023.282) (-1022.847) [-1020.312] (-1022.275) * (-1019.838) (-1024.652) [-1019.847] (-1020.316) -- 0:00:01 481500 -- (-1023.148) (-1019.913) (-1019.492) [-1021.419] * (-1020.843) [-1024.569] (-1019.703) (-1020.596) -- 0:00:01 482000 -- (-1022.092) (-1020.311) (-1022.462) [-1018.955] * [-1023.096] (-1023.818) (-1020.140) (-1020.855) -- 0:00:01 482500 -- [-1020.776] (-1020.011) (-1024.124) (-1019.014) * (-1022.642) [-1020.675] (-1021.353) (-1024.613) -- 0:00:01 483000 -- (-1022.711) (-1020.100) (-1023.878) [-1019.735] * (-1020.729) (-1019.739) (-1018.908) [-1019.136] -- 0:00:01 483500 -- (-1022.284) (-1019.845) [-1022.529] (-1020.173) * (-1020.720) [-1024.712] (-1024.633) (-1020.188) -- 0:00:01 484000 -- [-1020.271] (-1020.110) (-1021.360) (-1020.137) * [-1025.522] (-1022.120) (-1024.141) (-1022.226) -- 0:00:01 484500 -- (-1025.594) [-1019.860] (-1021.681) (-1021.317) * (-1022.926) (-1022.581) [-1025.077] (-1021.236) -- 0:00:00 485000 -- [-1023.335] (-1020.818) (-1020.269) (-1021.344) * [-1022.741] (-1020.205) (-1024.833) (-1019.342) -- 0:00:00 Average standard deviation of split frequencies: 0.009802 485500 -- (-1021.169) (-1022.150) [-1019.455] (-1021.447) * (-1024.114) (-1020.953) (-1022.072) [-1019.505] -- 0:00:00 486000 -- (-1024.094) (-1020.019) (-1021.930) [-1019.833] * [-1020.371] (-1020.452) (-1023.798) (-1021.612) -- 0:00:00 486500 -- [-1020.547] (-1027.524) (-1021.931) (-1020.292) * (-1019.571) (-1023.169) (-1020.810) [-1021.435] -- 0:00:00 487000 -- (-1020.248) (-1025.959) (-1019.207) [-1019.803] * (-1022.015) (-1021.701) (-1020.965) [-1020.308] -- 0:00:00 487500 -- [-1020.619] (-1027.344) (-1020.967) (-1019.896) * (-1021.512) [-1021.465] (-1023.812) (-1022.473) -- 0:00:00 488000 -- (-1021.012) (-1022.372) (-1022.423) [-1019.942] * (-1020.624) (-1025.392) (-1019.859) [-1022.193] -- 0:00:00 488500 -- (-1019.828) (-1022.051) [-1020.215] (-1021.550) * [-1020.451] (-1021.641) (-1020.135) (-1022.792) -- 0:00:00 489000 -- (-1020.227) (-1022.707) [-1024.207] (-1020.264) * (-1021.947) [-1021.216] (-1020.708) (-1019.487) -- 0:00:00 489500 -- [-1020.298] (-1019.467) (-1020.223) (-1019.090) * (-1020.798) [-1022.575] (-1022.957) (-1019.610) -- 0:00:00 490000 -- [-1019.820] (-1019.371) (-1019.617) (-1019.866) * (-1023.346) (-1021.396) (-1020.857) [-1022.122] -- 0:00:00 Average standard deviation of split frequencies: 0.009355 490500 -- [-1021.629] (-1020.583) (-1021.550) (-1019.612) * [-1022.568] (-1021.655) (-1020.373) (-1019.531) -- 0:00:00 491000 -- (-1026.499) [-1020.583] (-1023.070) (-1021.109) * (-1023.142) [-1020.586] (-1022.012) (-1019.564) -- 0:00:00 491500 -- [-1019.737] (-1023.485) (-1022.478) (-1021.191) * (-1019.644) [-1021.946] (-1020.456) (-1019.657) -- 0:00:00 492000 -- [-1019.695] (-1020.556) (-1022.680) (-1019.588) * [-1019.509] (-1019.644) (-1020.860) (-1022.529) -- 0:00:00 492500 -- [-1019.025] (-1024.028) (-1024.054) (-1021.918) * (-1022.894) [-1022.008] (-1022.862) (-1022.751) -- 0:00:00 493000 -- [-1019.850] (-1023.714) (-1021.235) (-1019.783) * (-1022.962) [-1024.032] (-1021.516) (-1028.640) -- 0:00:00 493500 -- [-1019.620] (-1023.884) (-1021.399) (-1024.013) * [-1021.078] (-1022.299) (-1020.273) (-1019.555) -- 0:00:00 494000 -- (-1021.176) (-1020.363) (-1027.547) [-1020.178] * (-1020.671) [-1019.775] (-1021.919) (-1022.564) -- 0:00:00 494500 -- (-1019.312) [-1019.344] (-1024.296) (-1019.711) * (-1020.971) (-1021.691) (-1019.368) [-1019.719] -- 0:00:00 495000 -- (-1019.844) [-1022.417] (-1020.126) (-1024.568) * (-1020.212) (-1025.401) [-1021.314] (-1021.715) -- 0:00:00 Average standard deviation of split frequencies: 0.009004 495500 -- [-1021.513] (-1027.170) (-1021.965) (-1020.000) * (-1019.779) [-1020.643] (-1021.431) (-1019.822) -- 0:00:00 496000 -- (-1023.969) (-1024.123) [-1019.889] (-1019.624) * (-1019.518) [-1021.143] (-1021.180) (-1022.283) -- 0:00:00 496500 -- (-1022.823) (-1020.721) [-1021.955] (-1021.951) * [-1022.059] (-1027.255) (-1020.400) (-1022.003) -- 0:00:00 497000 -- [-1020.635] (-1021.465) (-1024.394) (-1021.592) * (-1023.932) (-1021.362) (-1024.175) [-1020.180] -- 0:00:00 497500 -- (-1020.539) (-1021.744) (-1024.021) [-1025.191] * (-1026.671) [-1020.289] (-1027.507) (-1019.443) -- 0:00:00 498000 -- (-1021.100) [-1019.543] (-1020.154) (-1022.635) * (-1023.219) [-1021.532] (-1023.185) (-1026.905) -- 0:00:00 498500 -- (-1022.477) (-1020.083) (-1025.050) [-1022.933] * (-1021.109) (-1021.637) [-1019.670] (-1030.110) -- 0:00:00 499000 -- (-1019.705) [-1021.832] (-1023.637) (-1022.739) * (-1021.049) (-1021.415) (-1022.606) [-1020.572] -- 0:00:00 499500 -- [-1019.085] (-1025.619) (-1023.719) (-1025.877) * (-1019.991) (-1021.144) (-1019.742) [-1019.113] -- 0:00:00 500000 -- (-1021.160) (-1021.559) (-1019.638) [-1020.661] * (-1021.396) [-1020.646] (-1024.557) (-1019.907) -- 0:00:00 Average standard deviation of split frequencies: 0.008108 Analysis completed in 33 seconds Analysis used 32.06 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1018.67 Likelihood of best state for "cold" chain of run 2 was -1018.67 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 78.3 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 28.5 % ( 30 %) Dirichlet(Pi{all}) 33.1 % ( 33 %) Slider(Pi{all}) 88.8 % ( 88 %) Multiplier(Alpha{1,2}) 88.0 % ( 76 %) Multiplier(Alpha{3}) 18.2 % ( 22 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 79 %) ParsSPR(Tau{all},V{all}) 30.7 % ( 23 %) Multiplier(V{all}) 97.5 % ( 98 %) Nodeslider(V{all}) 35.5 % ( 26 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 79.2 % ( 77 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 29.0 % ( 32 %) Dirichlet(Pi{all}) 32.4 % ( 30 %) Slider(Pi{all}) 88.2 % ( 87 %) Multiplier(Alpha{1,2}) 87.6 % ( 74 %) Multiplier(Alpha{3}) 17.9 % ( 16 %) Slider(Pinvar{all}) 98.6 % ( 96 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 86 %) ParsSPR(Tau{all},V{all}) 30.7 % ( 31 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 35.1 % ( 29 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ------------------------------ 1 | 0.81 0.64 0.50 2 | 83676 0.82 0.67 3 | 83097 83265 0.84 4 | 83268 83561 83133 Chain swap information for run 2: 1 2 3 4 ------------------------------ 1 | 0.81 0.64 0.50 2 | 83382 0.83 0.67 3 | 83478 83213 0.84 4 | 83212 83396 83319 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 1250 Summarizing parameters in files /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1019.86 | 2 | | 1 | | 1 2 1 | | 1 12 1 1 12| |1 2 2 2 11 1 22 2 1 * 21 | | 1 2 1 2 2 1 * 1 | |22 1211 1 21 2 2 | | 1 212 1 2 1 2 2 1 2 22 21 | | 1 1 22 1 2 1 121 1 1 2* 11 22 1 1| | 1 2 2 2 22 1 2 21 12 2 | | 2 2 2 1 1 | | 1 1 1 22 1 1 1 2 | | 2 1 1 2 | | 2 2 1 | | 1 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1022.31 ^ ^ 125000 500000 Estimated marginal likelihoods for runs sampled in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1020.31 -1023.69 2 -1020.34 -1024.25 -------------------------------------- TOTAL -1020.33 -1024.01 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 1502 samples from 2 runs. Each run produced 1001 samples of which 751 samples were included. Parameter summaries saved to file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897961 0.088107 0.336528 1.458723 0.874549 723.51 737.26 0.999 r(A<->C){all} 0.177430 0.020291 0.001861 0.442749 0.147405 40.75 80.69 1.000 r(A<->G){all} 0.169456 0.018934 0.000056 0.444973 0.130264 81.89 96.23 1.005 r(A<->T){all} 0.153573 0.018930 0.000102 0.431596 0.111431 73.15 95.75 1.002 r(C<->G){all} 0.179879 0.022807 0.000016 0.512567 0.142407 94.65 112.40 1.044 r(C<->T){all} 0.157635 0.019557 0.000031 0.441193 0.118653 35.93 95.76 1.000 r(G<->T){all} 0.162027 0.021368 0.000048 0.449776 0.124290 85.93 105.05 1.078 pi(A){all} 0.219317 0.000218 0.191478 0.247521 0.219980 687.63 696.03 0.999 pi(C){all} 0.310621 0.000269 0.279788 0.343838 0.310768 368.69 518.91 1.009 pi(G){all} 0.300497 0.000271 0.267598 0.330534 0.299981 610.69 620.23 1.002 pi(T){all} 0.169565 0.000186 0.140204 0.195587 0.170052 620.30 685.65 1.002 alpha{1,2} 0.421546 0.256443 0.000116 1.446486 0.239735 356.46 374.97 0.999 alpha{3} 0.470475 0.267064 0.000887 1.518705 0.291275 413.98 496.20 1.000 pinvar{all} 0.997986 0.000006 0.993052 0.999999 0.998820 546.11 598.76 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 1250 Summarizing trees in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 2002 trees in 2 files (sampling 1502 of them) (Each file contained 1001 trees of which 751 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*...* 8 -- ..**** 9 -- ..*.*. 10 -- ..*..* 11 -- ..**.. 12 -- .***.* 13 -- .*..*. 14 -- .*.*.. 15 -- ....** 16 -- ...*.* 17 -- ...**. 18 -- .**.** 19 -- .**... 20 -- .*.*** 21 -- .****. 22 -- .**..* 23 -- ..*.** 24 -- ..**.* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 235 0.156458 0.004708 0.153129 0.159787 2 8 228 0.151798 0.003766 0.149134 0.154461 2 9 224 0.149134 0.007532 0.143808 0.154461 2 10 221 0.147137 0.016006 0.135819 0.158455 2 11 219 0.145806 0.000942 0.145140 0.146471 2 12 219 0.145806 0.004708 0.142477 0.149134 2 13 218 0.145140 0.007532 0.139814 0.150466 2 14 218 0.145140 0.001883 0.143808 0.146471 2 15 216 0.143808 0.003766 0.141145 0.146471 2 16 209 0.139148 0.010357 0.131824 0.146471 2 17 207 0.137816 0.002825 0.135819 0.139814 2 18 203 0.135153 0.006591 0.130493 0.139814 2 19 202 0.134487 0.003766 0.131824 0.137150 2 20 200 0.133156 0.003766 0.130493 0.135819 2 21 194 0.129161 0.007532 0.123835 0.134487 2 22 136 0.090546 0.015065 0.079893 0.101198 2 23 133 0.088549 0.017890 0.075899 0.101198 2 24 129 0.085885 0.027305 0.066578 0.105193 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.100515 0.010151 0.000024 0.304985 0.069920 1.000 2 length{all}[2] 0.100251 0.010159 0.000039 0.301690 0.068210 1.000 2 length{all}[3] 0.102957 0.010096 0.000198 0.294623 0.073458 1.003 2 length{all}[4] 0.102105 0.009760 0.000012 0.297621 0.071205 1.000 2 length{all}[5] 0.099432 0.010373 0.000016 0.316022 0.067436 1.000 2 length{all}[6] 0.093959 0.009194 0.000125 0.288602 0.063522 1.000 2 length{all}[7] 0.104121 0.010819 0.000267 0.274276 0.074607 0.996 2 length{all}[8] 0.095226 0.007297 0.000119 0.279461 0.071626 0.999 2 length{all}[9] 0.095013 0.008851 0.000846 0.303565 0.064106 1.001 2 length{all}[10] 0.098703 0.009405 0.000131 0.280097 0.066935 1.036 2 length{all}[11] 0.092541 0.007604 0.000035 0.263608 0.063140 0.996 2 length{all}[12] 0.088038 0.006822 0.000324 0.229402 0.068691 0.995 2 length{all}[13] 0.098187 0.009216 0.000596 0.303948 0.073170 1.002 2 length{all}[14] 0.100170 0.010609 0.000861 0.349631 0.061683 0.996 2 length{all}[15] 0.101399 0.009673 0.002041 0.277183 0.075731 0.996 2 length{all}[16] 0.104927 0.011404 0.000578 0.323559 0.067251 0.999 2 length{all}[17] 0.109014 0.015310 0.000264 0.353824 0.068726 0.996 2 length{all}[18] 0.089066 0.009221 0.001332 0.289245 0.056631 0.998 2 length{all}[19] 0.107373 0.011537 0.000226 0.313359 0.076465 0.995 2 length{all}[20] 0.101982 0.012018 0.000220 0.294142 0.068777 1.001 2 length{all}[21] 0.106488 0.011086 0.000179 0.281536 0.080988 1.002 2 length{all}[22] 0.097258 0.009231 0.000432 0.272509 0.075358 1.007 2 length{all}[23] 0.094605 0.010292 0.001035 0.280730 0.061946 0.993 2 length{all}[24] 0.095267 0.008232 0.000489 0.319966 0.063202 1.009 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008108 Maximum standard deviation of split frequencies = 0.027305 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.036 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /--------------------------------------------------------------------- C1 (1) | |------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |---------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------ C5 (5) | \-------------------------------------------------------------- C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 44 trees 90 % credible set contains 89 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 750 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 54 patterns at 250 / 250 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 54 patterns at 250 / 250 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 52704 bytes for conP 4752 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.091378 0.018191 0.039937 0.027535 0.013864 0.086077 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1059.411232 Iterating by ming2 Initial: fx= 1059.411232 x= 0.09138 0.01819 0.03994 0.02753 0.01386 0.08608 0.30000 1.30000 1 h-m-p 0.0000 0.0001 599.5905 ++ 1039.142401 m 0.0001 13 | 1/8 2 h-m-p 0.0007 0.0076 44.9381 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 548.0277 ++ 1033.856642 m 0.0000 44 | 2/8 4 h-m-p 0.0002 0.0096 36.3378 ----------.. | 2/8 5 h-m-p 0.0000 0.0000 489.8117 ++ 1024.720116 m 0.0000 74 | 3/8 6 h-m-p 0.0005 0.0115 30.0697 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 424.0478 ++ 1015.609456 m 0.0001 105 | 4/8 8 h-m-p 0.0008 0.0152 22.8915 -----------.. | 4/8 9 h-m-p 0.0000 0.0002 345.9992 +++ 992.800275 m 0.0002 137 | 5/8 10 h-m-p 0.0036 0.0308 12.9781 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 246.4715 ++ 991.473762 m 0.0000 169 | 6/8 12 h-m-p 0.0968 8.0000 0.0000 +Y 991.473762 0 0.2083 181 | 6/8 13 h-m-p 1.5971 8.0000 0.0000 ------------Y 991.473762 0 0.0000 206 Out.. lnL = -991.473762 207 lfun, 207 eigenQcodon, 1242 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.058536 0.073315 0.043681 0.023110 0.081482 0.090065 0.299954 0.875644 0.266544 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 15.064678 np = 9 lnL0 = -1079.311217 Iterating by ming2 Initial: fx= 1079.311217 x= 0.05854 0.07332 0.04368 0.02311 0.08148 0.09006 0.29995 0.87564 0.26654 1 h-m-p 0.0000 0.0001 565.2568 ++ 1047.285397 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0001 696.9729 ++ 1022.699159 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 7414.7530 ++ 1008.603867 m 0.0000 38 | 3/9 4 h-m-p 0.0001 0.0003 260.1071 ++ 997.278937 m 0.0003 50 | 4/9 5 h-m-p 0.0000 0.0000 4412.2400 ++ 993.355073 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 4377.2714 ++ 991.473711 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 991.473711 m 8.0000 86 | 6/9 8 h-m-p 0.0160 8.0000 0.0426 --------C 991.473711 0 0.0000 109 | 6/9 9 h-m-p 0.0160 8.0000 0.0010 +++++ 991.473710 m 8.0000 127 | 6/9 10 h-m-p 0.0217 0.2124 0.3555 -----------Y 991.473710 0 0.0000 153 | 6/9 11 h-m-p 0.0160 8.0000 0.0026 +++++ 991.473706 m 8.0000 171 | 6/9 12 h-m-p 0.0813 3.1183 0.2601 -----------C 991.473706 0 0.0000 197 | 6/9 13 h-m-p 0.0160 8.0000 0.0072 ------------C 991.473706 0 0.0000 224 | 6/9 14 h-m-p 0.0160 8.0000 0.0002 ----------C 991.473706 0 0.0000 249 Out.. lnL = -991.473706 250 lfun, 750 eigenQcodon, 3000 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.012645 0.012208 0.030856 0.046756 0.088795 0.070887 0.260611 1.031911 0.518058 0.391340 1.389137 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.512137 np = 11 lnL0 = -1054.294731 Iterating by ming2 Initial: fx= 1054.294731 x= 0.01265 0.01221 0.03086 0.04676 0.08879 0.07089 0.26061 1.03191 0.51806 0.39134 1.38914 1 h-m-p 0.0000 0.0001 573.8698 ++ 1037.130149 m 0.0001 16 | 1/11 2 h-m-p 0.0000 0.0000 181.6778 ++ 1036.583382 m 0.0000 30 | 2/11 3 h-m-p 0.0000 0.0002 230.7488 ++ 1021.008185 m 0.0002 44 | 3/11 4 h-m-p 0.0002 0.0008 141.1847 ++ 1008.980687 m 0.0008 58 | 4/11 5 h-m-p 0.0000 0.0000 4634.7175 ++ 996.472801 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0000 4105.1324 ++ 991.473737 m 0.0000 86 | 6/11 7 h-m-p 1.6000 8.0000 0.0001 ++ 991.473737 m 8.0000 100 | 6/11 8 h-m-p 0.0160 8.0000 0.0610 --------N 991.473737 0 0.0000 127 | 6/11 9 h-m-p 0.0002 0.1009 0.2807 +++++ 991.473735 m 0.1009 149 | 7/11 10 h-m-p 0.0525 8.0000 0.4133 -------------Y 991.473735 0 0.0000 181 | 7/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 991.473735 m 8.0000 202 | 7/11 12 h-m-p 0.0160 8.0000 0.9300 ---------C 991.473735 0 0.0000 229 | 7/11 13 h-m-p 0.0160 8.0000 0.0002 +++++ 991.473735 m 8.0000 250 | 7/11 14 h-m-p 0.0160 8.0000 1.1929 ----------Y 991.473735 0 0.0000 278 | 7/11 15 h-m-p 0.0160 8.0000 0.0108 +++++ 991.473732 m 8.0000 295 | 7/11 16 h-m-p 0.0783 8.0000 1.1066 -----------C 991.473732 0 0.0000 324 | 7/11 17 h-m-p 0.0160 8.0000 0.0000 +++++ 991.473732 m 8.0000 341 | 7/11 18 h-m-p 0.0023 1.1580 0.4403 +++++ 991.473722 m 1.1580 362 | 8/11 19 h-m-p 0.0801 8.0000 3.8207 +Y 991.473717 0 0.2429 381 | 8/11 20 h-m-p 1.6000 8.0000 0.0899 C 991.473717 0 0.6071 395 | 8/11 21 h-m-p 1.6000 8.0000 0.0003 ---C 991.473717 0 0.0063 415 | 8/11 22 h-m-p 0.0189 8.0000 0.0001 +++++ 991.473717 m 8.0000 435 | 8/11 23 h-m-p 0.0017 0.8313 1.2756 +++++ 991.473695 m 0.8313 455 | 9/11 24 h-m-p 0.4977 8.0000 1.9803 +++ 991.473572 m 8.0000 470 | 9/11 25 h-m-p 1.6000 8.0000 0.0000 C 991.473572 0 1.6000 484 | 9/11 26 h-m-p 0.0160 8.0000 0.0000 N 991.473572 0 0.0160 500 Out.. lnL = -991.473572 501 lfun, 2004 eigenQcodon, 9018 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -991.524708 S = -991.474607 -0.019357 Calculating f(w|X), posterior probabilities of site classes. did 10 / 54 patterns 0:04 did 20 / 54 patterns 0:04 did 30 / 54 patterns 0:04 did 40 / 54 patterns 0:04 did 50 / 54 patterns 0:04 did 54 / 54 patterns 0:04 Time used: 0:04 Model 3: discrete TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.027963 0.108506 0.108124 0.103226 0.070644 0.038732 0.000100 0.185467 0.027822 0.649986 1.532905 2.342002 ntime & nrate & np: 6 4 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 6.440068 np = 12 lnL0 = -1098.601255 Iterating by ming2 Initial: fx= 1098.601255 x= 0.02796 0.10851 0.10812 0.10323 0.07064 0.03873 0.00011 0.18547 0.02782 0.64999 1.53291 2.34200 1 h-m-p 0.0000 0.0000 546.8742 ++ 1097.620668 m 0.0000 17 | 1/12 2 h-m-p 0.0000 0.0013 193.4980 ++++ 1056.163676 m 0.0013 34 | 2/12 3 h-m-p 0.0000 0.0001 336.3931 ++ 1044.671970 m 0.0001 49 | 3/12 4 h-m-p 0.0003 0.0025 131.9399 ++ 1012.478629 m 0.0025 64 | 4/12 5 h-m-p 0.0000 0.0000 83198.3454 ++ 999.564905 m 0.0000 79 | 5/12 6 h-m-p 0.0083 0.5790 9.5675 -------------.. | 5/12 7 h-m-p 0.0000 0.0000 415.7206 ++ 993.334952 m 0.0000 120 | 6/12 8 h-m-p 0.0024 1.0765 4.9514 ------------.. | 6/12 9 h-m-p 0.0000 0.0000 346.1965 ++ 991.543135 m 0.0000 160 | 7/12 10 h-m-p 0.0048 2.4131 1.7869 ------------.. | 7/12 11 h-m-p 0.0000 0.0000 246.2953 ++ 991.473755 m 0.0000 200 | 8/12 12 h-m-p 0.0160 8.0000 0.0000 C 991.473755 0 0.0040 215 | 8/12 13 h-m-p 0.0160 8.0000 0.0000 +Y 991.473755 0 0.0640 235 | 8/12 14 h-m-p 0.0160 8.0000 0.0000 ----------N 991.473755 0 0.0000 264 Out.. lnL = -991.473755 265 lfun, 1060 eigenQcodon, 4770 P(t) Time used: 0:06 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.026160 0.064818 0.036027 0.076281 0.081476 0.075147 0.000100 0.918523 1.641167 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 17.385926 np = 9 lnL0 = -1075.822242 Iterating by ming2 Initial: fx= 1075.822242 x= 0.02616 0.06482 0.03603 0.07628 0.08148 0.07515 0.00011 0.91852 1.64117 1 h-m-p 0.0000 0.0000 552.5937 ++ 1075.317397 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0151 60.8471 +++++ 1036.576088 m 0.0151 29 | 2/9 3 h-m-p 0.0001 0.0003 367.1213 ++ 1012.005367 m 0.0003 41 | 3/9 4 h-m-p 0.0001 0.0007 23.9778 ++ 1005.614810 m 0.0007 53 | 4/9 5 h-m-p 0.0000 0.0000 54.8106 ++ 1005.492632 m 0.0000 65 | 5/9 6 h-m-p 0.0000 0.0001 105.2261 ++ 1002.139560 m 0.0001 77 | 6/9 7 h-m-p 0.0002 0.0012 28.9373 ++ 1001.501891 m 0.0012 89 | 7/9 8 h-m-p 0.0238 7.5568 1.0220 -------------.. | 7/9 9 h-m-p 0.0000 0.0002 228.8873 +++ 991.473572 m 0.0002 125 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 Y 991.473572 0 1.6000 137 | 8/9 11 h-m-p 1.6000 8.0000 0.0000 Y 991.473572 0 1.6000 150 Out.. lnL = -991.473572 151 lfun, 1661 eigenQcodon, 9060 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.087548 0.094455 0.018578 0.093621 0.059586 0.065668 0.000100 0.900000 0.637052 1.722659 1.299972 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 17.028058 np = 11 lnL0 = -1085.472563 Iterating by ming2 Initial: fx= 1085.472563 x= 0.08755 0.09445 0.01858 0.09362 0.05959 0.06567 0.00011 0.90000 0.63705 1.72266 1.29997 1 h-m-p 0.0000 0.0000 508.4001 ++ 1085.174274 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0004 284.6407 +++ 1061.133130 m 0.0004 31 | 2/11 3 h-m-p 0.0001 0.0005 243.8543 ++ 1015.048734 m 0.0005 45 | 3/11 4 h-m-p 0.0002 0.0010 97.7622 ++ 1009.240433 m 0.0010 59 | 4/11 5 h-m-p 0.0000 0.0000 14168.2845 ++ 994.095518 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 5509.8387 ++ 991.630320 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0000 2773.1176 ++ 991.588000 m 0.0000 101 | 7/11 8 h-m-p 0.0004 0.0291 28.5761 ----------.. | 7/11 9 h-m-p 0.0000 0.0000 244.3062 ++ 991.473710 m 0.0000 137 | 8/11 10 h-m-p 0.0160 8.0000 0.0000 C 991.473710 0 0.0040 151 | 8/11 11 h-m-p 0.0221 8.0000 0.0000 N 991.473710 0 0.0055 168 Out.. lnL = -991.473710 169 lfun, 2028 eigenQcodon, 11154 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -991.496784 S = -991.470540 -0.011560 Calculating f(w|X), posterior probabilities of site classes. did 10 / 54 patterns 0:11 did 20 / 54 patterns 0:11 did 30 / 54 patterns 0:12 did 40 / 54 patterns 0:12 did 50 / 54 patterns 0:12 did 54 / 54 patterns 0:12 Time used: 0:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=250 NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV NC_002677_1_NP_302523_1_1395_ML2337 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV ************************************************** NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI NC_002677_1_NP_302523_1_1395_ML2337 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI ************************************************** NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL NC_002677_1_NP_302523_1_1395_ML2337 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL ************************************************** NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP NC_002677_1_NP_302523_1_1395_ML2337 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ************************************************** NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN NC_002677_1_NP_302523_1_1395_ML2337 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN **************************************************
>NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >NC_002677_1_NP_302523_1_1395_ML2337 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT >NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 ATGGGATACAAGGTCGCCACGCTGTGGCACGCGTCATTTTCGATTGGCGC TGGCGTCCTCTACTTCTATTTCGTGCTGCCCCGCTGGCCGGAGCTGATAG GCGAGACCACGCACACGTTGGGAACAACACTACGCATCGTGACAGGCGTG CTGTTCGGCCTGGCCGCACTGCCAGTGGTTTTCACGCTGTTGCGCAGCCA AACATCCGAGCTCGGCATCCCGCAGCTGGCACTGTCCATCAGGACCTGGT CGATCGTGGCCCACGTGCTGTCCGGGGTACTAATCGTGAGCACCGCAATC GGCGAGATCTGGCTCAGCAGCGATACCGCTGTCCAGTGTTTGTTCGGAAT TTATGGAGCTGCTGCAGCCAGTGCGGTACTCGGCTTCGTCGCTTTCTATT TGTCGTTCGTCGCCGCGCTGCCGCCGCCATCGCCGAAACCGGTCAAACTG AAGAAAGCCAACCAGCGACGTATTCGCCGGCGGAAAGGCCGCAAGGACAA CGAGGCTGAGGATGAAGAAGCCGATGCTGGCGAGCACAACGAGGCCGAAA CGCCAGCGCAGGCCGAAGAGGTCACCTCGGAGAACCCACAGCCAGCACCC GAATCAGGGGCACAGAAAGAACCTGACGAACTCCTAGCCAACAAGACCGA AGAGACCGACGAACCTCGGCGCGGACTGCACAACCGCCGCCCGACCGGCA AAGTGTCACATCAGCGTAGGCGTGCACGCAGCGGGATCGCGGTCGAGAAT
>NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >NC_002677_1_NP_302523_1_1395_ML2337 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN >NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 MGYKVATLWHASFSIGAGVLYFYFVLPRWPELIGETTHTLGTTLRIVTGV LFGLAALPVVFTLLRSQTSELGIPQLALSIRTWSIVAHVLSGVLIVSTAI GEIWLSSDTAVQCLFGIYGAAAASAVLGFVAFYLSFVAALPPPSPKPVKL KKANQRRIRRRKGRKDNEAEDEEADAGEHNEAETPAQAEEVTSENPQPAP ESGAQKEPDELLANKTEETDEPRRGLHNRRPTGKVSHQRRRARSGIAVEN
#NEXUS [ID: 5170077024] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 NC_002677_1_NP_302523_1_1395_ML2337 NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 ; end; begin trees; translate 1 NC_011896_1_WP_010908843_1_2496_MLBR_RS11895, 2 NC_002677_1_NP_302523_1_1395_ML2337, 3 NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305, 4 NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065, 5 NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835, 6 NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06991992,2:0.06821022,3:0.07345783,4:0.07120537,5:0.06743557,6:0.06352223); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06991992,2:0.06821022,3:0.07345783,4:0.07120537,5:0.06743557,6:0.06352223); end;
Estimated marginal likelihoods for runs sampled in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1020.31 -1023.69 2 -1020.34 -1024.25 -------------------------------------- TOTAL -1020.33 -1024.01 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 1502 samples from 2 runs. Each run produced 1001 samples of which 751 samples were included. Parameter summaries saved to file "/data/8res/ML2337/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.897961 0.088107 0.336528 1.458723 0.874549 723.51 737.26 0.999 r(A<->C){all} 0.177430 0.020291 0.001861 0.442749 0.147405 40.75 80.69 1.000 r(A<->G){all} 0.169456 0.018934 0.000056 0.444973 0.130264 81.89 96.23 1.005 r(A<->T){all} 0.153573 0.018930 0.000102 0.431596 0.111431 73.15 95.75 1.002 r(C<->G){all} 0.179879 0.022807 0.000016 0.512567 0.142407 94.65 112.40 1.044 r(C<->T){all} 0.157635 0.019557 0.000031 0.441193 0.118653 35.93 95.76 1.000 r(G<->T){all} 0.162027 0.021368 0.000048 0.449776 0.124290 85.93 105.05 1.078 pi(A){all} 0.219317 0.000218 0.191478 0.247521 0.219980 687.63 696.03 0.999 pi(C){all} 0.310621 0.000269 0.279788 0.343838 0.310768 368.69 518.91 1.009 pi(G){all} 0.300497 0.000271 0.267598 0.330534 0.299981 610.69 620.23 1.002 pi(T){all} 0.169565 0.000186 0.140204 0.195587 0.170052 620.30 685.65 1.002 alpha{1,2} 0.421546 0.256443 0.000116 1.446486 0.239735 356.46 374.97 0.999 alpha{3} 0.470475 0.267064 0.000887 1.518705 0.291275 413.98 496.20 1.000 pinvar{all} 0.997986 0.000006 0.993052 0.999999 0.998820 546.11 598.76 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2337/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 250 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1 TTC 8 8 8 8 8 8 | TCC 3 3 3 3 3 3 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0 Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3 CTC 5 5 5 5 5 5 | CCC 2 2 2 2 2 2 | CAC 5 5 5 5 5 5 | CGC 9 9 9 9 9 9 CTA 3 3 3 3 3 3 | CCA 5 5 5 5 5 5 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1 CTG 13 13 13 13 13 13 | CCG 7 7 7 7 7 7 | CAG 7 7 7 7 7 7 | CGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1 ATC 8 8 8 8 8 8 | ACC 8 8 8 8 8 8 | AAC 6 6 6 6 6 6 | AGC 5 5 5 5 5 5 ATA 1 1 1 1 1 1 | ACA 4 4 4 4 4 4 | Lys AAA 6 6 6 6 6 6 | Arg AGA 0 0 0 0 0 0 Met ATG 1 1 1 1 1 1 | ACG 5 5 5 5 5 5 | AAG 4 4 4 4 4 4 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 1 1 1 | Ala GCT 7 7 7 7 7 7 | Asp GAT 3 3 3 3 3 3 | Gly GGT 0 0 0 0 0 0 GTC 8 8 8 8 8 8 | GCC 10 10 10 10 10 10 | GAC 3 3 3 3 3 3 | GGC 11 11 11 11 11 11 GTA 2 2 2 2 2 2 | GCA 7 7 7 7 7 7 | Glu GAA 9 9 9 9 9 9 | GGA 5 5 5 5 5 5 GTG 8 8 8 8 8 8 | GCG 5 5 5 5 5 5 | GAG 12 12 12 12 12 12 | GGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908843_1_2496_MLBR_RS11895 position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 #2: NC_002677_1_NP_302523_1_1395_ML2337 position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 #3: NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305 position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 #4: NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065 position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 #5: NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835 position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 #6: NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170 position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 6 TTC 48 | TCC 18 | TAC 12 | TGC 0 Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 30 | TAG 0 | Trp W TGG 24 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 18 CTC 30 | CCC 12 | CAC 30 | CGC 54 CTA 18 | CCA 30 | Gln Q CAA 6 | CGA 6 CTG 78 | CCG 42 | CAG 42 | CGG 18 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6 ATC 48 | ACC 48 | AAC 36 | AGC 30 ATA 6 | ACA 24 | Lys K AAA 36 | Arg R AGA 0 Met M ATG 6 | ACG 30 | AAG 24 | AGG 12 ------------------------------------------------------------------------------ Val V GTT 6 | Ala A GCT 42 | Asp D GAT 18 | Gly G GGT 0 GTC 48 | GCC 60 | GAC 18 | GGC 66 GTA 12 | GCA 42 | Glu E GAA 54 | GGA 30 GTG 48 | GCG 30 | GAG 72 | GGG 18 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.13600 C:0.26800 A:0.22000 G:0.37600 position 2: T:0.26400 C:0.29200 A:0.25200 G:0.19200 position 3: T:0.10800 C:0.37200 A:0.18800 G:0.33200 Average T:0.16933 C:0.31067 A:0.22000 G:0.30000 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -991.473762 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299954 1.299972 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908843_1_2496_MLBR_RS11895: 0.000004, NC_002677_1_NP_302523_1_1395_ML2337: 0.000004, NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305: 0.000004, NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065: 0.000004, NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835: 0.000004, NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29995 omega (dN/dS) = 1.29997 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 576.8 173.2 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 576.8 173.2 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 576.8 173.2 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 576.8 173.2 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 576.8 173.2 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 576.8 173.2 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -991.473706 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.260611 0.799182 0.015077 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908843_1_2496_MLBR_RS11895: 0.000004, NC_002677_1_NP_302523_1_1395_ML2337: 0.000004, NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305: 0.000004, NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065: 0.000004, NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835: 0.000004, NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.26061 MLEs of dN/dS (w) for site classes (K=2) p: 0.79918 0.20082 w: 0.01508 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 577.4 172.6 0.2129 0.0000 0.0000 0.0 0.0 7..2 0.000 577.4 172.6 0.2129 0.0000 0.0000 0.0 0.0 7..3 0.000 577.4 172.6 0.2129 0.0000 0.0000 0.0 0.0 7..4 0.000 577.4 172.6 0.2129 0.0000 0.0000 0.0 0.0 7..5 0.000 577.4 172.6 0.2129 0.0000 0.0000 0.0 0.0 7..6 0.000 577.4 172.6 0.2129 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -991.473572 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999999 0.000001 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908843_1_2496_MLBR_RS11895: 0.000004, NC_002677_1_NP_302523_1_1395_ML2337: 0.000004, NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305: 0.000004, NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065: 0.000004, NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835: 0.000004, NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908843_1_2496_MLBR_RS11895) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 3: discrete (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 12): -991.473755 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.450448 0.258324 0.000001 1.474140 2.482590 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908843_1_2496_MLBR_RS11895: 0.000004, NC_002677_1_NP_302523_1_1395_ML2337: 0.000004, NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305: 0.000004, NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065: 0.000004, NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835: 0.000004, NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.45045 0.25832 0.29123 w: 0.00000 1.47414 2.48259 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 582.3 167.7 1.1038 0.0000 0.0000 0.0 0.0 7..2 0.000 582.3 167.7 1.1038 0.0000 0.0000 0.0 0.0 7..3 0.000 582.3 167.7 1.1038 0.0000 0.0000 0.0 0.0 7..4 0.000 582.3 167.7 1.1038 0.0000 0.0000 0.0 0.0 7..5 0.000 582.3 167.7 1.1038 0.0000 0.0000 0.0 0.0 7..6 0.000 582.3 167.7 1.1038 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908843_1_2496_MLBR_RS11895) Pr(w>1) post mean +- SE for w 1 M 0.550 1.104 2 G 0.550 1.104 3 Y 0.550 1.104 4 K 0.550 1.104 5 V 0.550 1.104 6 A 0.550 1.104 7 T 0.550 1.104 8 L 0.550 1.104 9 W 0.550 1.104 10 H 0.550 1.104 11 A 0.550 1.104 12 S 0.550 1.104 13 F 0.550 1.104 14 S 0.550 1.104 15 I 0.550 1.104 16 G 0.550 1.104 17 A 0.550 1.104 18 G 0.550 1.104 19 V 0.550 1.104 20 L 0.550 1.104 21 Y 0.550 1.104 22 F 0.550 1.104 23 Y 0.550 1.104 24 F 0.550 1.104 25 V 0.550 1.104 26 L 0.550 1.104 27 P 0.550 1.104 28 R 0.550 1.104 29 W 0.550 1.104 30 P 0.550 1.104 31 E 0.550 1.104 32 L 0.550 1.104 33 I 0.550 1.104 34 G 0.550 1.104 35 E 0.550 1.104 36 T 0.550 1.104 37 T 0.550 1.104 38 H 0.550 1.104 39 T 0.550 1.104 40 L 0.550 1.104 41 G 0.550 1.104 42 T 0.550 1.104 43 T 0.550 1.104 44 L 0.550 1.104 45 R 0.550 1.104 46 I 0.550 1.104 47 V 0.550 1.104 48 T 0.550 1.104 49 G 0.550 1.104 50 V 0.550 1.104 51 L 0.550 1.104 52 F 0.550 1.104 53 G 0.550 1.104 54 L 0.550 1.104 55 A 0.550 1.104 56 A 0.550 1.104 57 L 0.550 1.104 58 P 0.550 1.104 59 V 0.550 1.104 60 V 0.550 1.104 61 F 0.550 1.104 62 T 0.550 1.104 63 L 0.550 1.104 64 L 0.550 1.104 65 R 0.550 1.104 66 S 0.550 1.104 67 Q 0.550 1.104 68 T 0.550 1.104 69 S 0.550 1.104 70 E 0.550 1.104 71 L 0.550 1.104 72 G 0.550 1.104 73 I 0.550 1.104 74 P 0.550 1.104 75 Q 0.550 1.104 76 L 0.550 1.104 77 A 0.550 1.104 78 L 0.550 1.104 79 S 0.550 1.104 80 I 0.550 1.104 81 R 0.550 1.104 82 T 0.550 1.104 83 W 0.550 1.104 84 S 0.550 1.104 85 I 0.550 1.104 86 V 0.550 1.104 87 A 0.550 1.104 88 H 0.550 1.104 89 V 0.550 1.104 90 L 0.550 1.104 91 S 0.550 1.104 92 G 0.550 1.104 93 V 0.550 1.104 94 L 0.550 1.104 95 I 0.550 1.104 96 V 0.550 1.104 97 S 0.550 1.104 98 T 0.550 1.104 99 A 0.550 1.104 100 I 0.550 1.104 101 G 0.550 1.104 102 E 0.550 1.104 103 I 0.550 1.104 104 W 0.550 1.104 105 L 0.550 1.104 106 S 0.550 1.104 107 S 0.550 1.104 108 D 0.550 1.104 109 T 0.550 1.104 110 A 0.550 1.104 111 V 0.550 1.104 112 Q 0.550 1.104 113 C 0.550 1.104 114 L 0.550 1.104 115 F 0.550 1.104 116 G 0.550 1.104 117 I 0.550 1.104 118 Y 0.550 1.104 119 G 0.550 1.104 120 A 0.550 1.104 121 A 0.550 1.104 122 A 0.550 1.104 123 A 0.550 1.104 124 S 0.550 1.104 125 A 0.550 1.104 126 V 0.550 1.104 127 L 0.550 1.104 128 G 0.550 1.104 129 F 0.550 1.104 130 V 0.550 1.104 131 A 0.550 1.104 132 F 0.550 1.104 133 Y 0.550 1.104 134 L 0.550 1.104 135 S 0.550 1.104 136 F 0.550 1.104 137 V 0.550 1.104 138 A 0.550 1.104 139 A 0.550 1.104 140 L 0.550 1.104 141 P 0.550 1.104 142 P 0.550 1.104 143 P 0.550 1.104 144 S 0.550 1.104 145 P 0.550 1.104 146 K 0.550 1.104 147 P 0.550 1.104 148 V 0.550 1.104 149 K 0.550 1.104 150 L 0.550 1.104 151 K 0.550 1.104 152 K 0.550 1.104 153 A 0.550 1.104 154 N 0.550 1.104 155 Q 0.550 1.104 156 R 0.550 1.104 157 R 0.550 1.104 158 I 0.550 1.104 159 R 0.550 1.104 160 R 0.550 1.104 161 R 0.550 1.104 162 K 0.550 1.104 163 G 0.550 1.104 164 R 0.550 1.104 165 K 0.550 1.104 166 D 0.550 1.104 167 N 0.550 1.104 168 E 0.550 1.104 169 A 0.550 1.104 170 E 0.550 1.104 171 D 0.550 1.104 172 E 0.550 1.104 173 E 0.550 1.104 174 A 0.550 1.104 175 D 0.550 1.104 176 A 0.550 1.104 177 G 0.550 1.104 178 E 0.550 1.104 179 H 0.550 1.104 180 N 0.550 1.104 181 E 0.550 1.104 182 A 0.550 1.104 183 E 0.550 1.104 184 T 0.550 1.104 185 P 0.550 1.104 186 A 0.550 1.104 187 Q 0.550 1.104 188 A 0.550 1.104 189 E 0.550 1.104 190 E 0.550 1.104 191 V 0.550 1.104 192 T 0.550 1.104 193 S 0.550 1.104 194 E 0.550 1.104 195 N 0.550 1.104 196 P 0.550 1.104 197 Q 0.550 1.104 198 P 0.550 1.104 199 A 0.550 1.104 200 P 0.550 1.104 201 E 0.550 1.104 202 S 0.550 1.104 203 G 0.550 1.104 204 A 0.550 1.104 205 Q 0.550 1.104 206 K 0.550 1.104 207 E 0.550 1.104 208 P 0.550 1.104 209 D 0.550 1.104 210 E 0.550 1.104 211 L 0.550 1.104 212 L 0.550 1.104 213 A 0.550 1.104 214 N 0.550 1.104 215 K 0.550 1.104 216 T 0.550 1.104 217 E 0.550 1.104 218 E 0.550 1.104 219 T 0.550 1.104 220 D 0.550 1.104 221 E 0.550 1.104 222 P 0.550 1.104 223 R 0.550 1.104 224 R 0.550 1.104 225 G 0.550 1.104 226 L 0.550 1.104 227 H 0.550 1.104 228 N 0.550 1.104 229 R 0.550 1.104 230 R 0.550 1.104 231 P 0.550 1.104 232 T 0.550 1.104 233 G 0.550 1.104 234 K 0.550 1.104 235 V 0.550 1.104 236 S 0.550 1.104 237 H 0.550 1.104 238 Q 0.550 1.104 239 R 0.550 1.104 240 R 0.550 1.104 241 R 0.550 1.104 242 A 0.550 1.104 243 R 0.550 1.104 244 S 0.550 1.104 245 G 0.550 1.104 246 I 0.550 1.104 247 A 0.550 1.104 248 V 0.550 1.104 249 E 0.550 1.104 250 N 0.550 1.104 Note: more than one w>1. Check rst for details Time used: 0:06 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -991.473572 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.695596 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908843_1_2496_MLBR_RS11895: 0.000004, NC_002677_1_NP_302523_1_1395_ML2337: 0.000004, NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305: 0.000004, NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065: 0.000004, NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835: 0.000004, NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.69560 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 582.3 167.7 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -991.473710 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.757731 0.005000 1.879331 1.791224 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908843_1_2496_MLBR_RS11895: 0.000004, NC_002677_1_NP_302523_1_1395_ML2337: 0.000004, NZ_LVXE01000002_1_WP_010908843_1_766_A3216_RS01305: 0.000004, NZ_LYPH01000022_1_WP_010908843_1_856_A8144_RS04065: 0.000004, NZ_CP029543_1_WP_010908843_1_2518_DIJ64_RS12835: 0.000004, NZ_AP014567_1_WP_010908843_1_2585_JK2ML_RS13170: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.75773 p = 0.00500 q = 1.87933 (p1 = 0.24227) w = 1.79122 MLEs of dN/dS (w) for site classes (K=11) p: 0.07577 0.07577 0.07577 0.07577 0.07577 0.07577 0.07577 0.07577 0.07577 0.07577 0.24227 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.79122 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 582.3 167.7 0.4340 0.0000 0.0000 0.0 0.0 7..2 0.000 582.3 167.7 0.4340 0.0000 0.0000 0.0 0.0 7..3 0.000 582.3 167.7 0.4340 0.0000 0.0000 0.0 0.0 7..4 0.000 582.3 167.7 0.4340 0.0000 0.0000 0.0 0.0 7..5 0.000 582.3 167.7 0.4340 0.0000 0.0000 0.0 0.0 7..6 0.000 582.3 167.7 0.4340 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908843_1_2496_MLBR_RS11895) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908843_1_2496_MLBR_RS11895) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098 Time used: 0:12
Model 1: NearlyNeutral -991.473706 Model 2: PositiveSelection -991.473572 Model 0: one-ratio -991.473762 Model 3: discrete -991.473755 Model 7: beta -991.473572 Model 8: beta&w>1 -991.47371 Model 0 vs 1 1.1199999994460086E-4 Model 2 vs 1 2.6800000000548607E-4 Model 8 vs 7 2.75999999985288E-4