--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:45:30 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2010/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -627.18 -631.12
2 -627.22 -629.51
--------------------------------------
TOTAL -627.20 -630.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888361 0.090530 0.342836 1.479037 0.863685 751.00 751.00 1.000
r(A<->C){all} 0.193055 0.025282 0.000174 0.524495 0.152426 39.35 56.82 1.000
r(A<->G){all} 0.150560 0.016257 0.000028 0.409664 0.116375 43.43 90.02 1.000
r(A<->T){all} 0.159005 0.019734 0.000111 0.456692 0.120616 80.35 142.32 1.013
r(C<->G){all} 0.184289 0.024069 0.000097 0.500157 0.144644 57.67 100.13 1.008
r(C<->T){all} 0.161776 0.019158 0.000251 0.442994 0.122052 25.66 71.95 1.004
r(G<->T){all} 0.151315 0.016023 0.000095 0.397249 0.114873 93.36 189.67 1.020
pi(A){all} 0.240276 0.000388 0.203969 0.281146 0.239585 584.34 667.67 1.000
pi(C){all} 0.299558 0.000441 0.259934 0.341155 0.298652 751.00 751.00 1.000
pi(G){all} 0.291989 0.000438 0.253645 0.334228 0.291471 593.08 666.61 1.000
pi(T){all} 0.168177 0.000295 0.135104 0.201422 0.167685 591.79 632.99 0.999
alpha{1,2} 0.448899 0.234757 0.000182 1.487835 0.266943 266.31 407.80 1.004
alpha{3} 0.453577 0.276592 0.000291 1.478553 0.283038 362.78 447.61 1.000
pinvar{all} 0.996494 0.000016 0.989182 0.999993 0.997817 414.96 498.16 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -608.78542
Model 2: PositiveSelection -608.785448
Model 0: one-ratio -608.785495
Model 3: discrete -608.785421
Model 7: beta -608.785452
Model 8: beta&w>1 -608.785421
Model 0 vs 1 1.4999999984866008E-4
Model 2 vs 1 5.599999985861359E-5
Model 8 vs 7 6.199999984346505E-5
>C1
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C2
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C3
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C4
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C5
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C6
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
C1 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C2 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C3 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C4 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C5 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C6 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
**************************************************
C1 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C2 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C3 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C4 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C5 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C6 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
**************************************************
C1 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C2 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C3 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C4 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C5 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C6 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
**************************************************
C1 PRS
C2 PRS
C3 PRS
C4 PRS
C5 PRS
C6 PRS
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4590]--->[4590]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.687 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C2 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C3 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C4 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C5 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
C6 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
**************************************************
C1 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C2 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C3 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C4 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C5 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
C6 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
**************************************************
C1 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C2 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C3 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C4 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C5 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
C6 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
**************************************************
C1 PRS
C2 PRS
C3 PRS
C4 PRS
C5 PRS
C6 PRS
***
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
C2 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
C3 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
C4 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
C5 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
C6 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
**************************************************
C1 GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
C2 GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
C3 GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
C4 GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
C5 GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
C6 GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
**************************************************
C1 AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
C2 AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
C3 AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
C4 AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
C5 AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
C6 AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
**************************************************
C1 GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
C2 GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
C3 GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
C4 GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
C5 GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
C6 GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
**************************************************
C1 CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
C2 CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
C3 CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
C4 CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
C5 CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
C6 CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
**************************************************
C1 ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
C2 ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
C3 ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
C4 ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
C5 ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
C6 ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
**************************************************
C1 AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
C2 AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
C3 AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
C4 AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
C5 AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
C6 AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
**************************************************
C1 CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
C2 CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
C3 CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
C4 CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
C5 CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
C6 CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
**************************************************
C1 GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
C2 GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
C3 GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
C4 GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
C5 GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
C6 GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
**************************************************
C1 CCGCGGTCC
C2 CCGCGGTCC
C3 CCGCGGTCC
C4 CCGCGGTCC
C5 CCGCGGTCC
C6 CCGCGGTCC
*********
>C1
ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
CCGCGGTCC
>C2
ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
CCGCGGTCC
>C3
ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
CCGCGGTCC
>C4
ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
CCGCGGTCC
>C5
ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
CCGCGGTCC
>C6
ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT
GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC
AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG
GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG
CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG
ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC
AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC
CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA
GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG
CCGCGGTCC
>C1
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C2
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C3
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C4
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C5
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
>C6
MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
PRS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 459 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855480
Setting output file names to "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2121157842
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5493547137
Seed = 1543826539
Swapseed = 1579855480
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1027.264008 -- -24.965149
Chain 2 -- -1027.264008 -- -24.965149
Chain 3 -- -1027.263949 -- -24.965149
Chain 4 -- -1027.264008 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1027.263949 -- -24.965149
Chain 2 -- -1027.264008 -- -24.965149
Chain 3 -- -1027.263851 -- -24.965149
Chain 4 -- -1027.264008 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-1027.264] (-1027.264) (-1027.264) (-1027.264) * [-1027.264] (-1027.264) (-1027.264) (-1027.264)
500 -- (-644.251) (-645.864) (-645.347) [-635.221] * (-640.627) (-637.020) (-633.335) [-636.109] -- 0:00:00
1000 -- (-633.452) [-636.613] (-641.909) (-634.178) * (-636.355) (-646.555) (-639.032) [-633.356] -- 0:00:00
1500 -- (-639.690) (-641.986) (-635.461) [-637.041] * (-637.125) [-633.252] (-633.335) (-638.073) -- 0:00:00
2000 -- (-630.380) [-637.670] (-636.361) (-635.886) * (-637.082) (-649.278) (-633.309) [-634.866] -- 0:00:00
2500 -- [-635.916] (-633.814) (-636.647) (-633.893) * (-649.771) (-634.500) [-634.296] (-639.172) -- 0:00:00
3000 -- (-633.778) [-632.043] (-641.357) (-640.556) * (-639.525) (-636.532) (-644.371) [-637.127] -- 0:00:00
3500 -- [-633.404] (-635.261) (-633.711) (-641.848) * (-636.164) (-635.457) [-638.160] (-635.984) -- 0:00:00
4000 -- (-633.124) (-632.666) (-638.691) [-639.161] * [-631.184] (-631.872) (-638.529) (-640.904) -- 0:00:00
4500 -- (-636.269) [-634.958] (-632.715) (-637.733) * [-642.739] (-636.551) (-650.330) (-638.055) -- 0:00:00
5000 -- [-632.132] (-649.557) (-638.507) (-634.997) * (-637.888) (-640.174) (-631.378) [-629.979] -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-639.541) (-643.574) [-632.318] (-633.756) * (-637.777) (-635.655) (-636.731) [-634.496] -- 0:00:00
6000 -- (-650.060) (-641.975) (-635.510) [-637.093] * (-645.183) (-633.135) (-650.619) [-634.648] -- 0:00:00
6500 -- (-638.364) [-633.357] (-635.870) (-638.034) * [-635.681] (-632.200) (-640.018) (-635.484) -- 0:00:00
7000 -- [-632.934] (-644.884) (-632.388) (-637.180) * [-636.477] (-635.864) (-637.644) (-646.831) -- 0:00:00
7500 -- [-636.388] (-639.515) (-643.356) (-627.094) * (-637.858) [-629.359] (-641.820) (-643.162) -- 0:00:00
8000 -- (-636.394) (-645.412) [-633.113] (-627.772) * (-643.245) (-637.970) (-634.166) [-634.486] -- 0:00:00
8500 -- (-635.476) (-634.342) (-639.341) [-627.049] * (-640.554) (-640.633) [-641.541] (-639.251) -- 0:00:00
9000 -- (-633.669) (-648.993) [-632.431] (-626.524) * (-640.025) (-634.229) [-633.579] (-636.504) -- 0:00:00
9500 -- [-633.136] (-652.823) (-637.691) (-626.529) * (-637.792) [-636.233] (-638.461) (-638.730) -- 0:00:00
10000 -- (-636.242) (-645.149) (-643.465) [-627.577] * [-636.836] (-645.723) (-637.110) (-637.962) -- 0:00:00
Average standard deviation of split frequencies: 0.081023
10500 -- (-638.944) (-630.324) [-640.947] (-626.594) * (-635.243) (-637.549) [-635.050] (-642.232) -- 0:00:00
11000 -- (-642.329) [-627.424] (-640.377) (-625.805) * (-638.881) (-636.789) (-636.606) [-633.437] -- 0:00:44
11500 -- (-638.421) [-625.734] (-635.371) (-625.805) * [-640.612] (-638.968) (-634.889) (-641.610) -- 0:00:42
12000 -- (-648.098) (-627.293) (-635.500) [-626.768] * (-637.980) (-641.983) (-640.639) [-643.031] -- 0:00:40
12500 -- (-645.238) [-626.119] (-643.846) (-626.413) * (-636.734) [-634.123] (-638.923) (-635.091) -- 0:00:39
13000 -- (-633.570) (-627.342) (-643.905) [-626.319] * (-640.232) [-626.414] (-636.209) (-636.232) -- 0:00:37
13500 -- [-634.649] (-629.023) (-660.920) (-629.402) * (-634.213) (-628.313) (-636.755) [-639.760] -- 0:00:36
14000 -- [-635.199] (-629.346) (-651.866) (-626.308) * (-634.080) (-627.630) [-636.030] (-634.632) -- 0:00:34
14500 -- [-636.531] (-626.856) (-648.106) (-629.019) * [-639.536] (-627.164) (-631.219) (-638.916) -- 0:00:33
15000 -- [-637.577] (-626.050) (-632.611) (-628.813) * [-632.332] (-627.760) (-634.576) (-634.297) -- 0:00:32
Average standard deviation of split frequencies: 0.078076
15500 -- (-643.540) (-630.809) (-626.964) [-633.446] * (-647.700) (-630.454) (-631.470) [-636.323] -- 0:00:31
16000 -- (-630.963) (-630.694) (-631.780) [-630.336] * (-643.554) (-633.196) (-633.516) [-640.481] -- 0:00:30
16500 -- (-638.789) [-625.808] (-632.263) (-627.908) * (-626.597) (-626.592) (-639.265) [-633.403] -- 0:00:29
17000 -- (-641.223) (-626.674) (-629.179) [-628.405] * (-636.280) (-626.787) (-637.337) [-632.989] -- 0:00:28
17500 -- (-640.511) [-627.320] (-628.089) (-627.301) * (-631.892) [-626.225] (-640.589) (-640.374) -- 0:00:27
18000 -- (-635.872) [-626.819] (-628.935) (-626.615) * (-627.617) [-627.658] (-636.645) (-636.991) -- 0:00:26
18500 -- [-632.371] (-626.827) (-626.023) (-627.808) * (-630.664) (-627.988) (-637.674) [-638.792] -- 0:00:26
19000 -- (-637.813) [-626.539] (-626.848) (-629.487) * (-629.580) (-635.786) (-637.698) [-637.018] -- 0:00:25
19500 -- (-637.397) [-627.706] (-630.706) (-628.966) * (-632.482) [-630.769] (-637.533) (-639.702) -- 0:00:24
20000 -- [-633.143] (-628.403) (-630.222) (-631.205) * (-633.523) [-628.733] (-636.319) (-640.778) -- 0:00:24
Average standard deviation of split frequencies: 0.055758
20500 -- (-640.381) [-628.237] (-627.222) (-626.139) * (-627.738) (-626.502) [-634.302] (-640.194) -- 0:00:23
21000 -- (-648.797) [-630.051] (-627.447) (-627.535) * [-626.703] (-630.777) (-634.410) (-639.878) -- 0:00:22
21500 -- (-631.826) (-626.929) [-628.372] (-631.376) * (-626.834) (-627.310) [-641.824] (-636.746) -- 0:00:22
22000 -- [-634.650] (-627.268) (-631.534) (-629.658) * (-627.881) [-626.319] (-637.906) (-639.301) -- 0:00:21
22500 -- [-635.680] (-628.906) (-629.668) (-627.454) * (-626.463) [-626.242] (-634.974) (-632.401) -- 0:00:21
23000 -- (-639.313) (-627.635) [-629.895] (-627.802) * (-628.409) (-627.739) (-644.796) [-636.423] -- 0:00:20
23500 -- [-633.341] (-629.714) (-627.750) (-626.851) * (-628.673) [-626.026] (-651.420) (-641.160) -- 0:00:20
24000 -- (-635.772) (-629.852) (-625.665) [-626.573] * [-629.497] (-627.367) (-627.394) (-634.289) -- 0:00:19
24500 -- (-638.029) [-626.390] (-625.949) (-628.784) * (-629.771) [-627.788] (-629.498) (-635.513) -- 0:00:19
25000 -- (-640.515) (-627.422) (-629.027) [-629.756] * (-628.249) [-627.898] (-628.318) (-634.956) -- 0:00:19
Average standard deviation of split frequencies: 0.048624
25500 -- (-638.094) (-626.666) [-629.651] (-628.215) * (-631.020) (-627.130) (-628.642) [-638.323] -- 0:00:18
26000 -- [-638.087] (-629.342) (-627.740) (-626.428) * (-627.167) (-628.204) (-629.202) [-638.888] -- 0:00:36
26500 -- [-634.451] (-626.116) (-627.799) (-627.327) * (-626.569) (-630.886) [-630.564] (-647.051) -- 0:00:35
27000 -- (-634.361) (-627.247) [-628.540] (-629.534) * (-628.225) (-632.214) (-628.984) [-633.812] -- 0:00:35
27500 -- (-641.947) [-626.023] (-626.907) (-628.807) * (-628.170) (-628.312) [-627.747] (-637.199) -- 0:00:34
28000 -- (-650.999) (-626.173) [-626.974] (-629.072) * (-629.135) (-628.764) (-630.093) [-635.929] -- 0:00:33
28500 -- (-628.537) [-627.090] (-628.926) (-628.238) * (-631.159) (-628.341) (-626.540) [-632.792] -- 0:00:33
29000 -- (-631.417) [-626.312] (-627.704) (-627.091) * (-626.436) [-627.504] (-626.621) (-644.624) -- 0:00:32
29500 -- (-630.322) (-627.071) [-626.795] (-627.655) * [-629.188] (-626.183) (-626.289) (-634.920) -- 0:00:31
30000 -- [-626.223] (-628.148) (-627.049) (-625.985) * (-629.435) (-627.838) (-625.809) [-640.299] -- 0:00:31
Average standard deviation of split frequencies: 0.043041
30500 -- [-626.161] (-630.018) (-626.108) (-627.914) * [-630.749] (-633.026) (-627.343) (-640.656) -- 0:00:30
31000 -- (-627.315) [-632.723] (-626.460) (-626.479) * [-628.941] (-628.684) (-628.688) (-635.130) -- 0:00:30
31500 -- (-627.774) (-628.487) [-627.382] (-627.086) * (-630.739) [-627.106] (-628.445) (-642.893) -- 0:00:29
32000 -- (-631.708) (-626.230) (-628.403) [-631.703] * (-627.662) (-631.497) [-628.733] (-640.726) -- 0:00:29
32500 -- (-633.106) (-628.200) [-628.589] (-630.682) * (-628.033) (-629.304) [-628.287] (-637.811) -- 0:00:28
33000 -- (-632.351) (-626.385) (-632.069) [-628.964] * [-631.580] (-631.048) (-636.192) (-635.102) -- 0:00:28
33500 -- (-625.806) [-626.351] (-628.498) (-626.615) * (-628.196) (-628.957) (-629.967) [-642.031] -- 0:00:27
34000 -- (-626.354) [-627.422] (-628.112) (-628.314) * (-629.494) (-631.825) (-628.243) [-636.515] -- 0:00:27
34500 -- (-628.979) (-629.132) [-627.051] (-627.803) * [-632.376] (-628.774) (-628.208) (-644.965) -- 0:00:26
35000 -- (-629.210) (-627.386) [-630.932] (-627.018) * (-629.879) [-626.290] (-627.895) (-652.532) -- 0:00:26
Average standard deviation of split frequencies: 0.036665
35500 -- (-629.517) (-626.913) (-629.785) [-632.726] * (-628.674) [-627.954] (-626.541) (-632.644) -- 0:00:26
36000 -- (-628.024) (-627.379) [-632.779] (-631.400) * (-628.022) (-630.539) [-626.681] (-626.165) -- 0:00:25
36500 -- [-628.488] (-626.453) (-631.193) (-626.455) * (-629.381) [-630.315] (-628.322) (-629.067) -- 0:00:25
37000 -- [-630.219] (-626.550) (-627.493) (-628.978) * (-627.405) [-631.477] (-627.196) (-627.117) -- 0:00:25
37500 -- (-627.490) [-626.215] (-627.633) (-635.526) * (-634.685) [-630.344] (-626.063) (-627.574) -- 0:00:24
38000 -- (-628.131) (-631.980) (-628.424) [-627.385] * (-629.481) [-626.086] (-626.817) (-628.549) -- 0:00:24
38500 -- [-628.556] (-634.554) (-629.897) (-626.829) * (-625.748) (-626.885) [-628.309] (-631.383) -- 0:00:23
39000 -- (-627.442) (-628.563) (-628.427) [-626.402] * [-626.867] (-629.767) (-627.599) (-629.623) -- 0:00:23
39500 -- [-627.650] (-627.459) (-627.927) (-629.260) * (-625.559) (-628.268) (-626.402) [-628.265] -- 0:00:23
40000 -- (-627.655) (-628.793) (-626.699) [-626.520] * (-627.225) (-629.142) [-625.969] (-631.100) -- 0:00:23
Average standard deviation of split frequencies: 0.037826
40500 -- (-625.939) [-630.354] (-626.942) (-628.969) * (-626.695) (-629.103) (-626.054) [-628.159] -- 0:00:22
41000 -- (-627.611) [-625.937] (-629.525) (-627.687) * (-629.039) (-628.818) (-627.926) [-625.862] -- 0:00:33
41500 -- (-626.310) (-627.412) (-628.918) [-627.392] * (-630.535) (-629.892) [-626.678] (-630.861) -- 0:00:33
42000 -- (-626.796) (-627.348) (-629.250) [-626.501] * [-625.821] (-634.993) (-626.801) (-629.672) -- 0:00:32
42500 -- (-627.152) (-628.988) (-628.095) [-627.047] * (-626.010) [-626.629] (-627.686) (-627.198) -- 0:00:32
43000 -- [-628.549] (-633.632) (-626.618) (-626.707) * (-626.977) (-626.585) (-626.667) [-628.599] -- 0:00:31
43500 -- (-626.666) [-626.270] (-627.301) (-626.895) * (-628.465) (-630.639) (-633.595) [-627.487] -- 0:00:31
44000 -- (-625.930) [-627.374] (-627.312) (-625.544) * (-632.397) (-626.975) [-629.284] (-627.650) -- 0:00:31
44500 -- (-625.860) (-627.625) [-628.068] (-633.619) * (-631.228) [-626.645] (-625.925) (-629.202) -- 0:00:30
45000 -- [-627.976] (-627.299) (-629.917) (-628.830) * (-625.691) [-626.631] (-627.376) (-630.049) -- 0:00:30
Average standard deviation of split frequencies: 0.032281
45500 -- (-628.695) [-627.974] (-627.187) (-629.844) * (-628.102) [-629.855] (-627.784) (-631.455) -- 0:00:29
46000 -- (-630.417) (-631.114) [-628.956] (-629.779) * (-627.158) (-627.670) [-629.194] (-625.936) -- 0:00:29
46500 -- (-631.969) (-628.189) [-627.898] (-628.553) * (-629.079) (-629.386) (-629.407) [-626.587] -- 0:00:29
47000 -- (-627.079) (-628.537) [-625.806] (-630.121) * (-626.450) (-629.373) [-626.516] (-626.340) -- 0:00:28
47500 -- (-626.692) [-627.970] (-627.152) (-632.824) * [-628.428] (-626.737) (-627.747) (-630.171) -- 0:00:28
48000 -- (-626.028) (-627.212) [-628.107] (-630.731) * (-627.738) (-629.014) (-631.389) [-627.474] -- 0:00:28
48500 -- (-629.261) (-627.718) (-627.976) [-626.492] * (-629.508) [-629.651] (-627.697) (-626.810) -- 0:00:27
49000 -- (-628.957) (-626.916) [-627.704] (-627.310) * (-628.984) (-627.512) (-627.979) [-626.403] -- 0:00:27
49500 -- (-627.499) (-628.312) (-632.120) [-630.806] * (-635.605) [-627.457] (-627.205) (-627.579) -- 0:00:27
50000 -- [-628.768] (-626.985) (-628.996) (-627.838) * [-630.836] (-627.873) (-627.222) (-626.538) -- 0:00:27
Average standard deviation of split frequencies: 0.030450
50500 -- (-630.477) (-627.134) [-627.315] (-627.348) * (-629.914) (-626.679) (-629.032) [-627.118] -- 0:00:26
51000 -- (-628.776) (-626.875) (-628.581) [-630.767] * (-628.370) (-630.414) [-626.863] (-629.215) -- 0:00:26
51500 -- (-626.900) [-626.234] (-627.112) (-626.848) * (-626.332) (-631.198) [-628.411] (-631.317) -- 0:00:26
52000 -- (-628.090) [-627.947] (-628.041) (-627.073) * (-627.187) (-627.324) [-626.249] (-626.269) -- 0:00:25
52500 -- (-627.519) (-627.085) (-628.872) [-626.018] * (-626.409) [-627.738] (-629.911) (-626.115) -- 0:00:25
53000 -- [-626.904] (-628.097) (-630.129) (-626.501) * [-628.783] (-626.920) (-626.977) (-626.285) -- 0:00:25
53500 -- (-627.365) [-628.408] (-627.174) (-629.510) * [-630.298] (-628.901) (-626.394) (-627.515) -- 0:00:25
54000 -- [-627.161] (-636.356) (-628.202) (-632.889) * (-628.754) (-627.886) [-627.109] (-627.469) -- 0:00:24
54500 -- (-626.346) [-626.861] (-628.261) (-628.386) * (-628.007) (-627.687) [-629.475] (-628.189) -- 0:00:24
55000 -- (-628.171) (-627.732) [-631.236] (-626.155) * [-627.052] (-626.539) (-627.588) (-627.326) -- 0:00:24
Average standard deviation of split frequencies: 0.028621
55500 -- (-627.234) [-629.917] (-627.641) (-627.198) * (-626.780) (-634.087) (-626.862) [-628.870] -- 0:00:32
56000 -- (-631.727) (-628.299) [-625.993] (-628.929) * (-627.237) (-629.921) (-626.817) [-631.052] -- 0:00:31
56500 -- (-630.460) (-629.484) (-627.098) [-627.392] * (-628.693) (-625.944) [-627.516] (-627.097) -- 0:00:31
57000 -- [-627.102] (-626.008) (-626.436) (-628.403) * (-628.327) (-626.293) (-627.354) [-626.513] -- 0:00:31
57500 -- [-627.188] (-627.987) (-625.936) (-628.982) * (-628.500) [-626.250] (-631.068) (-627.481) -- 0:00:30
58000 -- (-626.710) (-632.663) [-627.640] (-627.289) * (-625.885) (-627.440) (-629.201) [-629.354] -- 0:00:30
58500 -- (-630.233) (-628.255) [-627.005] (-629.928) * (-626.170) (-628.579) (-627.033) [-626.418] -- 0:00:30
59000 -- (-626.420) (-627.305) (-626.534) [-626.993] * [-627.656] (-630.856) (-628.914) (-626.824) -- 0:00:29
59500 -- [-627.242] (-630.100) (-631.524) (-631.523) * (-627.745) (-628.003) (-628.590) [-626.857] -- 0:00:29
60000 -- [-625.944] (-631.021) (-626.256) (-627.787) * (-626.511) (-626.756) (-629.434) [-625.799] -- 0:00:29
Average standard deviation of split frequencies: 0.029855
60500 -- (-627.883) (-629.048) [-627.797] (-630.116) * [-626.784] (-627.450) (-631.879) (-627.273) -- 0:00:29
61000 -- [-626.979] (-628.309) (-628.906) (-628.845) * (-628.878) [-628.313] (-629.226) (-625.716) -- 0:00:28
61500 -- (-631.110) [-627.779] (-630.230) (-626.379) * (-627.551) (-629.877) (-631.144) [-626.163] -- 0:00:28
62000 -- (-630.200) [-629.332] (-627.130) (-625.769) * [-627.492] (-627.012) (-631.664) (-626.470) -- 0:00:28
62500 -- (-634.033) [-629.328] (-627.065) (-627.499) * (-626.517) [-626.712] (-628.337) (-629.526) -- 0:00:28
63000 -- [-627.382] (-629.493) (-628.669) (-629.546) * (-627.719) [-627.049] (-632.776) (-631.015) -- 0:00:27
63500 -- (-629.145) (-628.289) [-630.715] (-627.705) * (-627.566) [-627.614] (-628.916) (-629.008) -- 0:00:27
64000 -- (-628.848) (-628.313) (-633.700) [-626.581] * [-627.635] (-631.193) (-626.748) (-630.054) -- 0:00:27
64500 -- [-627.472] (-628.310) (-630.148) (-630.249) * (-627.900) (-628.558) [-628.742] (-630.145) -- 0:00:27
65000 -- (-626.916) (-629.250) [-631.581] (-627.987) * (-627.075) (-631.258) (-626.701) [-628.780] -- 0:00:26
Average standard deviation of split frequencies: 0.028910
65500 -- [-626.457] (-627.659) (-628.023) (-627.194) * (-631.487) (-632.355) [-627.188] (-626.761) -- 0:00:26
66000 -- (-627.479) [-628.078] (-628.865) (-629.157) * (-629.160) (-628.564) (-627.998) [-628.867] -- 0:00:26
66500 -- (-628.680) (-627.983) [-627.560] (-628.649) * (-628.762) (-626.936) (-627.274) [-627.465] -- 0:00:26
67000 -- (-627.187) (-627.163) (-626.948) [-627.189] * (-630.387) [-626.890] (-625.865) (-632.414) -- 0:00:25
67500 -- (-628.926) [-628.282] (-627.234) (-626.880) * [-627.331] (-629.831) (-629.870) (-626.691) -- 0:00:25
68000 -- (-625.971) [-628.127] (-627.335) (-626.136) * [-627.723] (-629.217) (-629.755) (-626.998) -- 0:00:25
68500 -- (-625.565) (-628.938) [-627.281] (-628.568) * (-627.318) (-625.700) (-628.153) [-626.912] -- 0:00:25
69000 -- (-633.305) (-630.741) [-629.541] (-630.524) * (-627.942) [-626.146] (-631.398) (-626.172) -- 0:00:24
69500 -- [-626.722] (-632.085) (-626.541) (-628.148) * (-627.201) (-626.097) (-629.278) [-625.885] -- 0:00:24
70000 -- (-630.962) (-631.092) (-626.563) [-629.329] * (-629.743) (-627.102) [-635.337] (-631.219) -- 0:00:24
Average standard deviation of split frequencies: 0.028907
70500 -- (-629.058) (-626.515) [-627.007] (-628.604) * (-630.855) (-626.771) (-631.451) [-631.891] -- 0:00:24
71000 -- (-627.661) (-627.806) (-627.433) [-629.608] * (-626.793) (-626.844) (-628.279) [-627.651] -- 0:00:24
71500 -- (-629.620) (-631.916) (-626.673) [-628.000] * [-626.305] (-627.337) (-627.593) (-628.083) -- 0:00:29
72000 -- (-626.750) [-627.086] (-626.198) (-627.126) * (-627.002) (-626.822) [-629.854] (-628.595) -- 0:00:29
72500 -- (-627.169) (-628.006) [-628.179] (-627.488) * (-626.704) [-626.863] (-635.224) (-629.701) -- 0:00:29
73000 -- (-627.580) (-628.653) [-627.845] (-628.365) * [-626.681] (-627.614) (-632.193) (-628.093) -- 0:00:29
73500 -- [-626.924] (-629.698) (-626.119) (-629.067) * (-629.180) (-627.625) [-628.000] (-628.699) -- 0:00:29
74000 -- (-627.960) (-628.836) (-628.155) [-626.254] * (-626.395) (-627.716) (-628.404) [-630.063] -- 0:00:28
74500 -- (-628.964) (-627.108) (-630.529) [-626.318] * [-627.586] (-629.750) (-626.123) (-627.021) -- 0:00:28
75000 -- (-626.981) (-626.726) [-632.353] (-631.310) * (-626.402) (-629.855) (-627.601) [-626.741] -- 0:00:28
Average standard deviation of split frequencies: 0.029832
75500 -- (-626.767) [-630.158] (-635.316) (-628.181) * (-626.516) (-627.984) (-628.085) [-628.178] -- 0:00:28
76000 -- (-627.750) (-627.948) (-630.008) [-629.292] * [-626.294] (-631.948) (-628.549) (-628.706) -- 0:00:27
76500 -- [-625.784] (-630.703) (-629.309) (-628.519) * (-627.987) (-630.664) [-625.972] (-629.687) -- 0:00:27
77000 -- (-626.918) (-629.742) (-627.615) [-627.334] * [-627.225] (-630.136) (-627.094) (-628.495) -- 0:00:27
77500 -- (-629.567) [-626.392] (-627.196) (-626.499) * (-627.130) [-626.561] (-629.187) (-628.183) -- 0:00:27
78000 -- (-628.985) [-629.182] (-626.884) (-627.661) * (-630.097) [-629.888] (-626.696) (-626.325) -- 0:00:27
78500 -- (-627.217) [-627.718] (-626.894) (-627.229) * (-626.841) (-632.610) (-625.949) [-627.144] -- 0:00:26
79000 -- (-627.189) [-626.761] (-627.017) (-634.338) * [-627.214] (-630.390) (-628.140) (-626.392) -- 0:00:26
79500 -- [-626.826] (-627.635) (-631.721) (-630.246) * [-628.667] (-626.847) (-629.082) (-627.149) -- 0:00:26
80000 -- (-626.226) (-630.256) (-630.980) [-632.527] * (-628.545) [-626.154] (-630.321) (-632.918) -- 0:00:26
Average standard deviation of split frequencies: 0.022453
80500 -- [-627.598] (-627.087) (-630.853) (-629.134) * (-626.127) (-625.834) [-631.832] (-631.718) -- 0:00:26
81000 -- (-627.115) (-626.698) (-626.324) [-627.145] * [-627.121] (-626.225) (-630.030) (-632.849) -- 0:00:25
81500 -- [-626.572] (-627.045) (-627.577) (-630.167) * (-628.899) [-629.931] (-632.586) (-628.270) -- 0:00:25
82000 -- (-626.030) (-627.140) [-627.689] (-627.500) * (-630.006) (-629.849) (-629.078) [-626.672] -- 0:00:25
82500 -- (-631.700) [-628.087] (-628.997) (-626.165) * [-628.368] (-627.181) (-627.699) (-628.728) -- 0:00:25
83000 -- (-630.003) (-625.823) (-625.972) [-629.288] * [-630.209] (-627.779) (-628.506) (-629.215) -- 0:00:25
83500 -- (-627.666) (-626.412) (-626.948) [-629.079] * [-627.167] (-628.058) (-629.636) (-628.290) -- 0:00:24
84000 -- (-628.364) (-631.981) (-626.636) [-631.647] * (-625.967) [-631.559] (-629.968) (-631.955) -- 0:00:24
84500 -- (-630.925) (-628.040) [-627.823] (-631.729) * (-627.184) [-631.824] (-630.040) (-630.289) -- 0:00:24
85000 -- (-627.625) [-628.719] (-626.327) (-630.202) * [-626.418] (-626.623) (-628.238) (-628.319) -- 0:00:24
Average standard deviation of split frequencies: 0.020555
85500 -- [-628.080] (-630.058) (-625.797) (-626.898) * [-627.527] (-626.372) (-626.551) (-629.381) -- 0:00:24
86000 -- (-629.776) (-628.663) [-629.210] (-626.908) * [-628.444] (-626.541) (-627.740) (-628.739) -- 0:00:24
86500 -- [-628.073] (-628.297) (-630.392) (-630.075) * [-626.135] (-626.430) (-630.585) (-632.370) -- 0:00:23
87000 -- [-626.161] (-628.948) (-626.890) (-628.070) * [-626.340] (-626.978) (-633.246) (-631.329) -- 0:00:23
87500 -- [-626.022] (-629.538) (-628.042) (-628.248) * (-626.712) (-625.740) (-628.877) [-628.927] -- 0:00:23
88000 -- [-626.450] (-632.546) (-632.095) (-627.932) * (-628.918) (-628.145) [-629.188] (-628.318) -- 0:00:23
88500 -- (-626.694) [-629.968] (-632.514) (-626.051) * (-629.575) [-629.001] (-626.570) (-627.576) -- 0:00:27
89000 -- [-626.473] (-629.731) (-627.037) (-627.682) * (-626.736) (-630.034) [-626.514] (-627.247) -- 0:00:27
89500 -- (-626.373) (-629.826) [-628.450] (-626.926) * [-628.091] (-629.721) (-628.099) (-629.195) -- 0:00:27
90000 -- (-626.688) (-631.200) (-630.469) [-628.001] * (-629.670) (-626.465) [-630.199] (-625.944) -- 0:00:27
Average standard deviation of split frequencies: 0.021071
90500 -- (-628.582) [-627.924] (-627.483) (-628.916) * (-628.792) (-633.496) (-625.982) [-631.030] -- 0:00:27
91000 -- (-631.410) [-627.158] (-626.583) (-629.856) * (-626.500) (-630.710) (-628.162) [-627.587] -- 0:00:26
91500 -- (-626.256) (-625.827) [-628.738] (-633.263) * (-626.183) (-631.048) (-630.556) [-627.235] -- 0:00:26
92000 -- (-632.825) [-625.698] (-628.827) (-631.603) * (-627.741) (-627.066) (-626.742) [-630.244] -- 0:00:26
92500 -- (-626.732) [-626.281] (-630.291) (-626.673) * (-627.838) (-631.487) [-627.914] (-628.891) -- 0:00:26
93000 -- (-626.986) (-626.020) [-628.926] (-626.951) * (-629.495) [-630.471] (-628.320) (-626.851) -- 0:00:26
93500 -- (-627.442) (-626.158) (-632.887) [-626.756] * (-626.876) [-626.951] (-628.871) (-629.587) -- 0:00:26
94000 -- (-627.415) (-628.989) (-628.716) [-629.642] * (-628.454) [-629.485] (-629.297) (-628.985) -- 0:00:25
94500 -- [-627.033] (-625.531) (-629.069) (-629.238) * (-628.463) (-629.880) (-629.689) [-627.856] -- 0:00:25
95000 -- (-627.507) (-629.433) [-626.696] (-627.614) * (-627.763) (-626.132) (-629.775) [-631.195] -- 0:00:25
Average standard deviation of split frequencies: 0.021451
95500 -- (-628.584) (-630.146) (-626.149) [-627.116] * [-628.290] (-627.369) (-627.362) (-630.574) -- 0:00:25
96000 -- (-631.164) (-626.611) [-626.215] (-628.122) * [-626.015] (-627.677) (-628.661) (-626.557) -- 0:00:25
96500 -- (-630.892) (-626.806) [-626.646] (-628.913) * [-628.684] (-630.341) (-630.634) (-628.291) -- 0:00:25
97000 -- [-628.528] (-635.572) (-628.326) (-630.885) * (-629.713) (-627.230) (-639.096) [-628.140] -- 0:00:24
97500 -- (-626.733) (-632.359) (-632.834) [-629.330] * (-627.314) (-628.071) (-629.059) [-628.860] -- 0:00:24
98000 -- (-626.319) (-627.849) (-629.096) [-628.418] * [-626.896] (-626.959) (-628.167) (-630.399) -- 0:00:24
98500 -- (-628.189) (-627.010) (-628.388) [-626.192] * (-626.614) [-627.796] (-629.446) (-633.821) -- 0:00:24
99000 -- [-630.080] (-629.443) (-628.593) (-627.415) * (-626.713) (-625.731) [-628.239] (-627.380) -- 0:00:24
99500 -- (-631.339) (-627.009) (-628.183) [-625.936] * (-627.248) (-625.792) [-629.186] (-630.048) -- 0:00:24
100000 -- (-628.841) (-629.425) (-630.170) [-626.480] * (-629.977) (-627.765) [-625.858] (-628.001) -- 0:00:24
Average standard deviation of split frequencies: 0.019200
100500 -- (-626.557) (-627.209) [-627.801] (-629.089) * (-631.432) (-629.337) [-626.666] (-627.172) -- 0:00:23
101000 -- (-631.865) [-628.066] (-627.282) (-627.389) * (-630.185) [-628.024] (-626.038) (-627.751) -- 0:00:23
101500 -- (-630.936) [-627.669] (-635.078) (-627.987) * (-628.846) (-629.886) (-626.147) [-627.985] -- 0:00:23
102000 -- (-627.963) [-626.759] (-633.337) (-628.607) * [-626.703] (-628.931) (-628.292) (-628.665) -- 0:00:23
102500 -- (-630.969) (-628.507) [-626.243] (-631.337) * (-628.790) (-628.744) [-626.746] (-626.678) -- 0:00:23
103000 -- (-626.561) (-627.081) (-626.067) [-630.637] * (-627.990) [-627.671] (-628.327) (-629.584) -- 0:00:23
103500 -- (-626.796) [-629.208] (-630.281) (-626.999) * (-630.704) [-628.272] (-630.713) (-633.189) -- 0:00:22
104000 -- (-627.149) (-634.251) (-629.235) [-626.515] * (-627.683) (-630.430) [-626.846] (-635.219) -- 0:00:22
104500 -- (-626.326) [-630.684] (-627.211) (-626.114) * [-628.077] (-626.757) (-628.659) (-629.017) -- 0:00:22
105000 -- [-631.353] (-632.498) (-627.242) (-627.928) * (-628.319) (-626.402) (-628.176) [-626.983] -- 0:00:22
Average standard deviation of split frequencies: 0.019790
105500 -- (-631.250) [-629.619] (-629.455) (-631.179) * (-627.080) (-628.163) (-627.603) [-626.692] -- 0:00:26
106000 -- (-629.081) (-626.909) (-629.855) [-631.996] * (-626.772) [-626.405] (-630.766) (-631.806) -- 0:00:26
106500 -- (-627.910) [-628.542] (-628.577) (-629.687) * (-632.358) (-630.820) (-632.608) [-629.681] -- 0:00:25
107000 -- (-627.810) [-626.529] (-629.879) (-627.735) * (-628.169) (-627.126) (-626.281) [-626.477] -- 0:00:25
107500 -- (-628.583) [-627.143] (-629.890) (-626.149) * (-627.636) (-630.569) (-626.134) [-626.699] -- 0:00:25
108000 -- [-627.551] (-626.574) (-627.407) (-630.797) * (-627.966) [-628.897] (-627.330) (-628.795) -- 0:00:25
108500 -- (-629.674) [-627.028] (-627.161) (-627.990) * (-626.658) (-631.040) [-627.841] (-626.043) -- 0:00:25
109000 -- (-631.833) (-629.005) (-627.034) [-627.219] * [-626.711] (-629.134) (-626.982) (-628.294) -- 0:00:25
109500 -- (-631.439) (-628.418) (-631.313) [-626.851] * (-628.165) (-626.088) [-627.106] (-626.690) -- 0:00:24
110000 -- (-628.691) (-628.558) (-630.728) [-630.408] * (-628.651) (-627.155) [-628.399] (-626.530) -- 0:00:24
Average standard deviation of split frequencies: 0.018932
110500 -- (-627.601) [-626.279] (-628.095) (-635.031) * (-630.391) (-626.797) (-628.826) [-627.357] -- 0:00:24
111000 -- (-626.380) [-626.823] (-628.737) (-627.049) * [-630.840] (-631.584) (-629.358) (-629.061) -- 0:00:24
111500 -- (-626.760) (-626.780) [-626.634] (-625.897) * (-629.331) (-626.954) (-628.263) [-626.511] -- 0:00:24
112000 -- [-628.853] (-631.045) (-626.009) (-625.988) * (-633.512) (-629.388) [-626.552] (-630.003) -- 0:00:24
112500 -- (-630.748) (-629.748) [-630.125] (-627.165) * [-627.746] (-634.187) (-628.046) (-630.067) -- 0:00:24
113000 -- (-627.543) (-627.112) (-628.798) [-627.923] * (-630.632) [-629.617] (-626.453) (-628.205) -- 0:00:23
113500 -- (-627.243) [-628.754] (-631.677) (-630.284) * (-626.697) (-629.492) (-629.093) [-627.395] -- 0:00:23
114000 -- [-628.016] (-626.455) (-626.543) (-630.011) * [-627.862] (-626.194) (-627.997) (-627.277) -- 0:00:23
114500 -- [-626.549] (-626.586) (-628.347) (-628.937) * (-627.289) (-629.197) [-629.364] (-627.370) -- 0:00:23
115000 -- (-629.332) [-625.869] (-638.269) (-628.029) * (-625.995) (-627.796) (-630.568) [-626.391] -- 0:00:23
Average standard deviation of split frequencies: 0.020558
115500 -- (-628.035) [-625.869] (-627.390) (-627.187) * [-626.032] (-629.775) (-635.840) (-628.103) -- 0:00:23
116000 -- (-628.406) [-626.033] (-628.654) (-629.694) * (-627.821) (-628.160) (-631.151) [-626.759] -- 0:00:23
116500 -- (-627.334) (-629.182) [-626.361] (-626.950) * (-628.551) (-626.848) [-626.534] (-627.082) -- 0:00:23
117000 -- (-628.533) [-629.893] (-626.537) (-631.168) * (-630.189) (-629.435) [-626.232] (-630.739) -- 0:00:22
117500 -- (-626.251) (-630.572) [-626.105] (-627.892) * (-630.621) [-630.437] (-635.511) (-627.468) -- 0:00:22
118000 -- (-626.373) [-629.628] (-629.518) (-628.181) * [-630.326] (-630.000) (-626.835) (-631.885) -- 0:00:22
118500 -- (-625.791) (-627.293) [-627.325] (-630.761) * (-630.112) (-629.704) (-627.240) [-629.107] -- 0:00:22
119000 -- (-627.451) [-627.319] (-628.045) (-636.056) * (-627.816) (-626.590) (-626.487) [-629.646] -- 0:00:22
119500 -- (-627.981) (-627.974) (-626.233) [-628.357] * (-627.264) [-626.988] (-631.975) (-626.657) -- 0:00:22
120000 -- (-629.144) [-626.550] (-632.253) (-626.520) * [-626.350] (-626.902) (-627.538) (-629.469) -- 0:00:22
Average standard deviation of split frequencies: 0.020401
120500 -- [-626.343] (-628.897) (-627.475) (-629.143) * (-627.661) (-626.073) [-627.569] (-627.934) -- 0:00:22
121000 -- [-629.211] (-627.210) (-628.399) (-631.237) * (-629.042) [-630.013] (-627.150) (-631.316) -- 0:00:21
121500 -- (-628.908) [-626.173] (-628.428) (-628.152) * (-627.290) (-634.669) (-628.165) [-626.484] -- 0:00:21
122000 -- (-629.463) [-627.897] (-628.345) (-626.941) * [-626.983] (-627.401) (-629.397) (-626.071) -- 0:00:24
122500 -- [-632.824] (-628.407) (-627.870) (-627.671) * [-628.234] (-628.293) (-626.996) (-628.848) -- 0:00:24
123000 -- (-628.632) (-626.464) (-630.553) [-627.156] * (-627.337) (-630.392) (-626.223) [-629.553] -- 0:00:24
123500 -- (-628.730) (-626.781) [-627.801] (-627.474) * (-627.445) [-626.148] (-629.589) (-629.034) -- 0:00:24
124000 -- (-626.669) (-628.216) (-626.760) [-626.543] * [-630.478] (-626.815) (-627.866) (-628.050) -- 0:00:24
124500 -- (-630.145) [-627.776] (-627.147) (-627.870) * (-631.285) [-625.727] (-627.894) (-628.473) -- 0:00:24
125000 -- (-626.010) [-628.788] (-628.547) (-628.100) * (-628.255) [-627.449] (-626.474) (-629.646) -- 0:00:24
Average standard deviation of split frequencies: 0.022074
125500 -- [-629.218] (-629.834) (-632.579) (-626.054) * (-626.346) (-628.220) (-627.717) [-628.450] -- 0:00:23
126000 -- [-628.014] (-626.855) (-627.910) (-627.425) * [-627.353] (-627.145) (-626.220) (-629.985) -- 0:00:23
126500 -- [-627.619] (-631.948) (-627.748) (-631.802) * (-628.201) (-630.094) (-627.783) [-630.424] -- 0:00:23
127000 -- [-628.617] (-630.454) (-626.159) (-626.832) * [-629.073] (-634.801) (-627.921) (-628.065) -- 0:00:23
127500 -- (-627.912) (-628.059) (-627.708) [-627.800] * (-626.587) (-629.413) [-627.800] (-628.801) -- 0:00:23
128000 -- (-630.131) (-626.023) (-626.149) [-628.577] * (-631.037) [-626.472] (-627.840) (-626.779) -- 0:00:23
128500 -- [-627.481] (-628.614) (-629.790) (-627.494) * (-637.089) (-630.060) (-626.522) [-626.808] -- 0:00:23
129000 -- (-626.724) (-629.175) [-626.241] (-629.738) * (-628.000) (-626.084) [-627.452] (-626.532) -- 0:00:23
129500 -- (-628.913) [-627.376] (-626.312) (-628.655) * [-629.052] (-626.247) (-625.749) (-628.938) -- 0:00:22
130000 -- (-627.360) (-626.963) [-626.917] (-627.591) * (-627.648) [-625.645] (-627.705) (-629.215) -- 0:00:22
Average standard deviation of split frequencies: 0.022026
130500 -- (-626.866) (-629.332) [-626.869] (-629.592) * [-628.103] (-632.127) (-630.038) (-625.853) -- 0:00:22
131000 -- [-629.503] (-633.379) (-626.799) (-627.175) * (-627.609) (-632.609) [-627.294] (-628.039) -- 0:00:22
131500 -- (-626.467) (-627.817) [-627.783] (-627.873) * (-630.848) (-630.688) (-630.870) [-626.066] -- 0:00:22
132000 -- [-627.889] (-629.800) (-626.567) (-628.234) * [-627.202] (-627.651) (-628.381) (-626.529) -- 0:00:22
132500 -- (-626.874) (-628.634) (-627.259) [-630.155] * (-628.023) (-626.954) (-626.723) [-626.472] -- 0:00:22
133000 -- (-628.133) (-628.992) [-626.992] (-627.885) * (-628.537) (-627.654) (-626.728) [-627.015] -- 0:00:22
133500 -- [-628.521] (-628.079) (-627.112) (-629.580) * (-628.158) (-632.175) [-626.956] (-626.703) -- 0:00:21
134000 -- (-632.487) (-627.146) (-626.434) [-629.300] * (-625.978) (-631.662) (-626.250) [-627.306] -- 0:00:21
134500 -- [-630.088] (-626.576) (-625.819) (-628.313) * (-628.623) (-628.557) [-627.236] (-628.044) -- 0:00:21
135000 -- [-626.992] (-626.985) (-627.049) (-626.969) * [-628.564] (-629.485) (-628.719) (-627.944) -- 0:00:21
Average standard deviation of split frequencies: 0.022074
135500 -- (-627.106) [-626.471] (-637.487) (-627.026) * (-628.558) (-626.347) (-627.992) [-627.372] -- 0:00:21
136000 -- [-626.433] (-627.790) (-629.916) (-627.558) * [-626.527] (-626.945) (-626.290) (-628.616) -- 0:00:21
136500 -- (-628.097) (-627.487) [-627.366] (-626.781) * (-630.060) [-627.130] (-625.888) (-626.623) -- 0:00:21
137000 -- (-627.354) [-631.427] (-626.022) (-627.100) * [-627.831] (-626.516) (-626.862) (-627.455) -- 0:00:21
137500 -- (-627.950) (-629.599) [-627.396] (-628.650) * [-629.154] (-627.756) (-627.896) (-631.609) -- 0:00:21
138000 -- (-626.313) (-626.945) [-628.946] (-628.009) * (-630.276) [-627.857] (-630.900) (-627.487) -- 0:00:20
138500 -- (-627.532) (-629.272) (-627.933) [-629.712] * (-629.416) (-627.339) [-627.161] (-631.787) -- 0:00:20
139000 -- (-627.352) (-637.415) [-627.917] (-626.842) * (-633.606) (-627.991) (-634.996) [-634.023] -- 0:00:23
139500 -- (-628.181) (-630.272) [-626.382] (-625.613) * [-626.104] (-626.929) (-630.912) (-631.260) -- 0:00:23
140000 -- (-628.180) (-628.734) [-626.441] (-628.463) * (-628.369) (-626.536) (-627.043) [-628.616] -- 0:00:23
Average standard deviation of split frequencies: 0.020293
140500 -- [-629.056] (-629.772) (-633.405) (-627.323) * (-629.542) [-627.323] (-626.011) (-627.539) -- 0:00:23
141000 -- [-630.518] (-626.689) (-634.594) (-630.845) * [-627.337] (-626.100) (-628.688) (-627.393) -- 0:00:22
141500 -- (-628.380) (-627.546) [-628.650] (-637.544) * [-627.281] (-629.235) (-627.766) (-628.443) -- 0:00:22
142000 -- (-627.552) (-626.983) [-627.203] (-627.689) * (-629.589) (-630.374) (-628.980) [-627.118] -- 0:00:22
142500 -- [-627.254] (-626.312) (-628.786) (-626.709) * [-629.024] (-630.003) (-632.445) (-627.108) -- 0:00:22
143000 -- (-627.562) [-627.891] (-629.136) (-626.405) * (-626.415) [-626.748] (-628.280) (-626.238) -- 0:00:22
143500 -- (-626.962) (-628.707) [-629.856] (-627.868) * (-630.075) (-628.450) (-627.272) [-631.177] -- 0:00:22
144000 -- [-628.385] (-630.564) (-631.943) (-631.376) * (-632.377) (-627.889) [-627.110] (-630.604) -- 0:00:22
144500 -- (-627.280) [-629.327] (-631.409) (-630.050) * [-630.429] (-627.909) (-628.176) (-628.168) -- 0:00:22
145000 -- [-629.204] (-627.177) (-632.230) (-627.639) * (-632.508) [-627.147] (-628.466) (-626.317) -- 0:00:22
Average standard deviation of split frequencies: 0.016654
145500 -- (-626.342) (-626.769) (-634.049) [-629.723] * (-634.211) [-627.028] (-631.062) (-627.639) -- 0:00:21
146000 -- (-628.834) (-630.063) (-629.016) [-629.685] * (-629.695) (-628.127) (-629.784) [-626.673] -- 0:00:21
146500 -- [-625.926] (-628.928) (-627.177) (-626.047) * (-627.920) (-628.201) [-626.943] (-627.081) -- 0:00:21
147000 -- [-625.734] (-628.074) (-626.534) (-628.549) * (-626.157) [-627.761] (-629.204) (-630.663) -- 0:00:21
147500 -- [-625.944] (-630.842) (-626.715) (-627.536) * (-629.336) (-628.292) [-629.413] (-628.338) -- 0:00:21
148000 -- (-632.798) (-629.776) [-628.791] (-629.341) * [-628.366] (-627.030) (-630.723) (-627.223) -- 0:00:21
148500 -- [-627.708] (-628.003) (-631.894) (-627.713) * [-629.063] (-627.008) (-628.204) (-627.356) -- 0:00:21
149000 -- [-627.748] (-626.533) (-632.209) (-631.088) * [-628.675] (-631.461) (-627.574) (-626.831) -- 0:00:21
149500 -- (-628.305) [-630.796] (-627.180) (-627.911) * (-627.941) (-629.716) [-628.643] (-630.608) -- 0:00:21
150000 -- [-626.690] (-628.197) (-627.213) (-628.304) * (-629.974) (-630.965) (-629.927) [-626.122] -- 0:00:21
Average standard deviation of split frequencies: 0.017208
150500 -- (-626.642) [-626.434] (-625.665) (-630.317) * (-629.204) [-631.374] (-630.731) (-626.689) -- 0:00:20
151000 -- (-633.664) (-627.787) [-629.171] (-629.856) * (-627.344) (-634.315) [-628.702] (-627.252) -- 0:00:20
151500 -- (-631.000) [-628.153] (-628.962) (-629.633) * (-628.100) (-628.585) [-627.591] (-626.947) -- 0:00:20
152000 -- (-626.782) (-629.016) (-627.853) [-628.857] * (-628.225) [-631.449] (-626.436) (-627.045) -- 0:00:20
152500 -- (-627.114) (-630.706) (-627.391) [-627.101] * (-627.529) [-625.819] (-629.826) (-627.185) -- 0:00:20
153000 -- [-626.342] (-626.268) (-631.378) (-626.791) * [-628.314] (-625.701) (-627.634) (-628.443) -- 0:00:20
153500 -- [-626.672] (-627.329) (-629.198) (-626.307) * [-627.878] (-629.147) (-629.109) (-629.796) -- 0:00:20
154000 -- (-629.632) (-629.760) (-629.425) [-626.855] * [-628.746] (-628.504) (-627.674) (-628.510) -- 0:00:20
154500 -- (-626.717) [-625.750] (-627.644) (-627.967) * [-627.789] (-629.249) (-627.430) (-629.661) -- 0:00:20
155000 -- (-628.084) [-626.644] (-629.195) (-626.203) * (-626.326) (-628.511) (-627.606) [-627.489] -- 0:00:20
Average standard deviation of split frequencies: 0.018584
155500 -- (-627.979) (-626.262) [-628.187] (-626.325) * [-630.342] (-627.421) (-626.706) (-628.561) -- 0:00:22
156000 -- (-629.371) (-629.550) [-626.542] (-627.104) * [-626.109] (-627.295) (-627.761) (-628.000) -- 0:00:22
156500 -- (-630.335) (-627.442) (-626.308) [-626.070] * [-627.692] (-628.384) (-628.672) (-626.486) -- 0:00:21
157000 -- (-629.848) (-627.548) [-626.500] (-628.708) * (-627.431) (-629.526) (-627.220) [-629.223] -- 0:00:21
157500 -- (-626.917) (-628.410) [-626.355] (-627.843) * (-626.687) (-633.575) [-627.879] (-627.282) -- 0:00:21
158000 -- (-629.795) [-627.347] (-625.750) (-626.675) * [-628.480] (-626.631) (-628.996) (-625.942) -- 0:00:21
158500 -- [-627.364] (-628.368) (-626.193) (-628.662) * (-629.133) (-632.245) [-628.097] (-627.383) -- 0:00:21
159000 -- (-627.485) [-628.365] (-628.237) (-626.826) * (-628.037) (-626.333) (-628.680) [-626.399] -- 0:00:21
159500 -- (-628.779) (-630.987) [-628.231] (-629.594) * [-630.006] (-627.956) (-626.586) (-631.421) -- 0:00:21
160000 -- (-628.756) (-628.100) (-629.848) [-626.248] * (-632.074) (-629.801) [-626.409] (-628.947) -- 0:00:21
Average standard deviation of split frequencies: 0.019952
160500 -- (-628.805) [-627.408] (-628.331) (-627.245) * [-631.073] (-626.591) (-630.717) (-630.087) -- 0:00:21
161000 -- (-626.622) (-626.208) (-626.274) [-628.812] * (-628.435) [-626.062] (-626.436) (-631.478) -- 0:00:21
161500 -- (-627.686) (-627.753) [-627.180] (-628.808) * (-627.853) (-627.273) (-631.194) [-629.714] -- 0:00:20
162000 -- (-630.856) (-626.888) [-628.184] (-627.695) * (-626.574) (-626.797) [-627.384] (-628.426) -- 0:00:20
162500 -- (-630.357) [-627.729] (-627.573) (-625.804) * (-626.124) [-629.213] (-627.972) (-629.607) -- 0:00:20
163000 -- (-629.715) (-627.867) (-628.532) [-629.969] * (-628.475) (-628.764) [-628.715] (-628.922) -- 0:00:20
163500 -- (-626.898) [-630.660] (-630.310) (-626.833) * (-629.340) (-626.173) (-629.928) [-629.826] -- 0:00:20
164000 -- (-626.251) [-626.304] (-630.405) (-628.603) * (-628.601) (-628.861) [-626.949] (-629.874) -- 0:00:20
164500 -- (-629.764) [-626.784] (-627.817) (-627.551) * (-628.364) (-626.712) (-628.191) [-631.252] -- 0:00:20
165000 -- (-627.636) (-631.132) (-626.862) [-625.777] * [-631.334] (-631.234) (-626.898) (-631.599) -- 0:00:20
Average standard deviation of split frequencies: 0.019879
165500 -- (-626.982) (-630.383) (-626.374) [-629.797] * [-627.475] (-628.199) (-627.318) (-627.872) -- 0:00:20
166000 -- (-628.269) (-626.296) [-631.075] (-626.704) * (-628.877) (-626.209) [-629.235] (-628.668) -- 0:00:20
166500 -- (-628.524) (-626.704) (-628.977) [-626.364] * (-632.483) (-626.423) (-630.413) [-628.144] -- 0:00:20
167000 -- (-628.826) [-628.937] (-626.934) (-627.539) * [-629.318] (-625.698) (-627.470) (-632.931) -- 0:00:19
167500 -- (-627.290) (-625.736) (-627.295) [-626.065] * (-631.178) [-626.261] (-630.372) (-635.559) -- 0:00:19
168000 -- (-629.096) (-628.196) [-627.676] (-626.911) * (-626.902) [-625.589] (-632.313) (-630.698) -- 0:00:19
168500 -- (-628.754) (-627.824) (-633.754) [-629.192] * (-626.622) (-627.276) (-627.050) [-629.412] -- 0:00:19
169000 -- (-628.491) (-628.169) (-628.079) [-626.495] * [-626.803] (-625.968) (-627.912) (-629.875) -- 0:00:19
169500 -- (-628.574) (-629.461) [-628.021] (-625.875) * [-629.274] (-628.969) (-628.170) (-627.791) -- 0:00:19
170000 -- [-626.343] (-628.088) (-626.820) (-626.523) * (-627.376) (-628.582) (-628.446) [-628.493] -- 0:00:19
Average standard deviation of split frequencies: 0.018921
170500 -- [-626.065] (-627.117) (-626.780) (-626.326) * (-627.454) [-627.447] (-628.170) (-631.322) -- 0:00:19
171000 -- (-628.495) [-626.735] (-627.450) (-628.762) * (-626.845) (-628.458) [-628.237] (-633.372) -- 0:00:19
171500 -- (-627.765) (-626.741) (-627.763) [-628.714] * (-628.259) [-630.999] (-632.979) (-631.874) -- 0:00:19
172000 -- (-626.096) (-627.618) (-627.051) [-626.438] * (-628.755) (-627.375) (-630.876) [-628.489] -- 0:00:19
172500 -- [-629.627] (-626.865) (-625.894) (-627.139) * (-627.578) (-625.489) (-629.136) [-630.316] -- 0:00:20
173000 -- (-629.410) (-631.548) [-627.857] (-628.911) * (-628.643) (-630.053) (-629.043) [-630.222] -- 0:00:20
173500 -- (-626.292) (-628.163) [-628.888] (-635.231) * (-629.644) (-629.348) (-630.724) [-629.279] -- 0:00:20
174000 -- (-629.505) (-628.301) [-626.433] (-626.919) * (-626.893) (-627.339) (-630.074) [-627.152] -- 0:00:20
174500 -- (-631.056) (-632.659) (-627.220) [-626.942] * (-629.672) [-627.967] (-628.467) (-629.411) -- 0:00:20
175000 -- (-627.309) [-631.821] (-630.276) (-630.103) * (-627.917) (-629.915) (-627.436) [-628.766] -- 0:00:20
Average standard deviation of split frequencies: 0.018615
175500 -- (-627.098) (-626.915) [-628.622] (-629.000) * (-627.114) (-629.666) [-626.937] (-631.323) -- 0:00:20
176000 -- [-627.014] (-627.169) (-628.111) (-627.732) * (-627.108) (-627.609) [-626.251] (-626.816) -- 0:00:20
176500 -- (-629.871) (-627.052) [-626.902] (-627.280) * (-627.648) (-630.030) [-627.345] (-627.905) -- 0:00:20
177000 -- [-629.401] (-629.664) (-628.908) (-627.321) * [-627.874] (-630.692) (-629.077) (-629.269) -- 0:00:20
177500 -- (-630.738) (-631.592) (-626.879) [-626.248] * (-627.735) (-628.349) [-626.113] (-626.923) -- 0:00:19
178000 -- (-630.004) [-628.706] (-629.140) (-628.118) * [-628.442] (-630.547) (-629.347) (-630.436) -- 0:00:19
178500 -- (-630.735) [-628.137] (-628.658) (-627.160) * (-627.567) (-628.845) [-626.457] (-627.749) -- 0:00:19
179000 -- (-632.129) (-628.306) [-628.498] (-627.444) * (-628.170) (-629.768) (-627.671) [-627.180] -- 0:00:19
179500 -- (-626.111) (-627.762) [-629.704] (-626.526) * (-628.844) (-628.294) [-628.680] (-627.487) -- 0:00:19
180000 -- (-626.424) (-626.097) (-627.056) [-634.326] * [-625.910] (-627.978) (-625.702) (-627.282) -- 0:00:19
Average standard deviation of split frequencies: 0.018656
180500 -- (-626.523) (-629.270) [-626.425] (-628.439) * (-627.123) (-626.959) (-626.159) [-629.338] -- 0:00:19
181000 -- [-630.536] (-629.276) (-628.035) (-629.497) * (-626.501) (-628.935) [-627.547] (-626.337) -- 0:00:19
181500 -- (-628.091) [-626.385] (-625.787) (-626.484) * (-626.029) (-626.983) (-631.001) [-629.234] -- 0:00:19
182000 -- [-627.553] (-627.382) (-627.257) (-629.619) * [-627.066] (-627.259) (-627.063) (-628.313) -- 0:00:19
182500 -- (-625.929) (-629.334) [-627.798] (-626.978) * (-625.870) (-628.522) [-629.885] (-627.116) -- 0:00:19
183000 -- (-630.593) (-627.657) [-629.863] (-628.959) * (-630.853) (-627.847) [-632.965] (-630.734) -- 0:00:19
183500 -- [-629.323] (-626.944) (-627.631) (-627.896) * (-628.399) [-625.970] (-628.642) (-629.497) -- 0:00:18
184000 -- (-630.465) (-628.833) [-628.066] (-632.115) * (-629.202) [-627.468] (-626.148) (-629.807) -- 0:00:18
184500 -- [-628.074] (-627.968) (-628.107) (-630.219) * (-628.622) (-627.750) [-628.877] (-628.828) -- 0:00:18
185000 -- (-626.687) [-626.622] (-627.645) (-628.662) * (-627.672) (-628.705) (-631.557) [-628.126] -- 0:00:18
Average standard deviation of split frequencies: 0.017868
185500 -- [-628.831] (-628.111) (-626.260) (-627.452) * (-630.877) [-628.068] (-631.166) (-627.729) -- 0:00:18
186000 -- (-627.467) (-627.549) [-625.706] (-627.468) * [-628.148] (-626.692) (-632.492) (-627.870) -- 0:00:18
186500 -- [-628.025] (-628.712) (-627.283) (-626.908) * [-629.992] (-629.291) (-629.450) (-628.974) -- 0:00:18
187000 -- (-627.019) (-627.719) [-626.642] (-628.964) * (-627.950) (-628.237) (-629.933) [-629.481] -- 0:00:18
187500 -- (-626.756) (-625.759) [-626.519] (-629.724) * [-629.462] (-626.439) (-631.772) (-626.570) -- 0:00:18
188000 -- (-631.474) (-626.915) (-627.794) [-627.302] * [-628.992] (-627.773) (-630.372) (-626.590) -- 0:00:18
188500 -- [-630.391] (-627.030) (-629.269) (-629.746) * (-630.367) (-630.239) (-628.133) [-628.969] -- 0:00:18
189000 -- (-628.529) (-626.975) [-626.683] (-627.152) * [-628.664] (-628.480) (-631.276) (-628.507) -- 0:00:18
189500 -- (-626.748) (-627.391) [-627.216] (-632.092) * (-628.262) (-629.343) [-628.116] (-627.669) -- 0:00:19
190000 -- (-628.281) [-626.976] (-627.794) (-632.197) * [-628.496] (-627.538) (-626.032) (-627.011) -- 0:00:19
Average standard deviation of split frequencies: 0.020521
190500 -- (-627.031) [-628.470] (-629.020) (-627.406) * (-631.630) [-627.040] (-625.521) (-627.935) -- 0:00:19
191000 -- (-629.764) [-626.733] (-632.119) (-626.474) * [-626.372] (-628.670) (-627.897) (-627.348) -- 0:00:19
191500 -- (-628.989) [-626.474] (-629.805) (-626.429) * (-625.683) (-626.981) [-626.049] (-629.227) -- 0:00:19
192000 -- (-634.419) (-630.314) [-626.543] (-626.578) * (-632.946) (-632.898) (-626.376) [-627.265] -- 0:00:19
192500 -- (-628.858) (-627.766) [-627.225] (-631.440) * (-630.133) (-628.357) [-626.098] (-628.752) -- 0:00:19
193000 -- (-628.563) [-627.537] (-628.013) (-628.649) * (-627.340) (-626.865) (-628.584) [-626.963] -- 0:00:19
193500 -- (-626.910) (-628.019) (-630.258) [-627.870] * (-627.938) (-633.042) [-628.614] (-629.792) -- 0:00:19
194000 -- (-628.145) (-626.233) [-631.295] (-631.602) * (-628.067) (-627.139) [-630.318] (-627.346) -- 0:00:18
194500 -- (-626.776) [-630.409] (-633.371) (-628.777) * [-627.485] (-628.350) (-626.122) (-628.461) -- 0:00:18
195000 -- (-626.931) [-627.137] (-629.192) (-627.050) * (-629.446) (-632.590) (-626.598) [-627.815] -- 0:00:18
Average standard deviation of split frequencies: 0.020564
195500 -- (-626.470) (-627.434) [-627.477] (-629.593) * [-628.017] (-627.657) (-626.239) (-629.611) -- 0:00:18
196000 -- (-626.600) (-629.085) [-626.237] (-630.499) * (-628.310) (-626.627) [-628.031] (-628.394) -- 0:00:18
196500 -- [-626.952] (-629.852) (-628.292) (-628.683) * [-630.407] (-629.209) (-631.082) (-625.826) -- 0:00:18
197000 -- (-634.883) [-627.125] (-633.167) (-628.191) * (-628.280) (-630.126) [-626.815] (-631.118) -- 0:00:18
197500 -- (-630.111) (-625.963) (-628.464) [-627.639] * (-627.024) (-628.897) [-627.781] (-628.787) -- 0:00:18
198000 -- (-629.439) [-626.797] (-641.975) (-627.644) * (-626.501) (-627.678) (-628.268) [-628.293] -- 0:00:18
198500 -- (-629.451) [-628.093] (-628.526) (-626.151) * (-627.627) (-628.348) [-628.760] (-627.308) -- 0:00:18
199000 -- (-627.443) (-627.448) [-630.001] (-626.537) * [-626.873] (-628.145) (-630.180) (-626.726) -- 0:00:18
199500 -- [-625.616] (-627.609) (-628.430) (-627.264) * [-626.558] (-629.660) (-626.919) (-628.630) -- 0:00:18
200000 -- (-628.351) (-630.295) (-628.699) [-627.986] * [-626.458] (-628.950) (-626.872) (-626.389) -- 0:00:18
Average standard deviation of split frequencies: 0.019733
200500 -- (-628.049) (-630.232) (-627.678) [-631.557] * (-627.103) (-628.464) (-627.159) [-626.614] -- 0:00:17
201000 -- (-627.868) [-628.129] (-628.421) (-629.819) * (-625.935) (-627.286) [-627.681] (-626.322) -- 0:00:17
201500 -- (-629.477) (-627.264) [-628.637] (-629.512) * (-625.662) (-626.513) [-630.061] (-627.113) -- 0:00:17
202000 -- (-628.338) [-628.256] (-627.188) (-627.716) * (-626.766) (-627.667) [-631.769] (-626.455) -- 0:00:17
202500 -- [-626.445] (-628.040) (-627.232) (-626.804) * (-628.022) [-627.618] (-631.001) (-627.265) -- 0:00:17
203000 -- (-627.539) [-628.410] (-626.761) (-625.945) * [-626.221] (-627.396) (-633.706) (-626.851) -- 0:00:17
203500 -- [-632.507] (-625.806) (-629.223) (-626.971) * (-628.521) (-628.636) (-627.698) [-627.007] -- 0:00:17
204000 -- (-627.484) (-626.490) [-629.694] (-627.713) * (-629.942) [-628.315] (-627.849) (-628.325) -- 0:00:17
204500 -- (-629.602) (-625.859) (-627.062) [-629.442] * [-626.917] (-627.062) (-630.321) (-627.367) -- 0:00:17
205000 -- (-628.383) (-627.447) [-627.135] (-627.977) * (-627.042) (-626.489) (-630.051) [-628.093] -- 0:00:17
Average standard deviation of split frequencies: 0.020023
205500 -- (-628.251) (-628.135) [-627.197] (-627.058) * [-629.310] (-626.486) (-628.050) (-627.541) -- 0:00:17
206000 -- (-628.375) (-626.995) [-628.470] (-630.315) * (-631.602) [-629.616] (-628.038) (-632.935) -- 0:00:18
206500 -- (-627.740) [-630.845] (-626.012) (-627.341) * (-630.174) [-627.704] (-628.829) (-629.440) -- 0:00:18
207000 -- (-631.146) [-626.750] (-626.071) (-626.078) * (-627.544) (-632.548) (-629.771) [-627.447] -- 0:00:18
207500 -- (-628.056) [-628.582] (-629.688) (-626.352) * (-629.424) (-632.864) (-628.401) [-630.025] -- 0:00:18
208000 -- (-625.708) (-627.948) [-627.911] (-629.357) * (-629.307) [-625.970] (-628.607) (-628.156) -- 0:00:18
208500 -- (-627.394) [-628.767] (-629.362) (-628.592) * (-630.061) [-625.874] (-629.326) (-626.360) -- 0:00:18
209000 -- (-628.112) (-630.506) (-626.590) [-626.311] * (-629.017) (-626.202) (-626.377) [-626.080] -- 0:00:18
209500 -- (-628.013) (-629.880) [-626.242] (-626.141) * (-628.386) (-627.591) [-627.826] (-625.882) -- 0:00:18
210000 -- [-628.391] (-626.833) (-629.910) (-626.311) * [-626.312] (-629.088) (-627.614) (-625.568) -- 0:00:17
Average standard deviation of split frequencies: 0.018573
210500 -- (-629.058) (-628.460) (-631.989) [-626.845] * (-628.361) (-626.616) [-626.247] (-626.002) -- 0:00:17
211000 -- (-626.950) [-628.508] (-628.872) (-628.856) * (-631.454) (-627.088) (-626.515) [-629.841] -- 0:00:17
211500 -- (-628.951) (-629.126) [-627.386] (-628.781) * (-627.248) (-629.555) [-625.993] (-628.209) -- 0:00:17
212000 -- [-627.100] (-631.993) (-626.472) (-627.243) * (-627.979) (-627.500) (-625.763) [-627.622] -- 0:00:17
212500 -- (-626.461) [-630.222] (-626.443) (-630.065) * (-628.124) (-630.943) (-625.750) [-631.567] -- 0:00:17
213000 -- (-626.029) (-628.154) [-627.935] (-628.008) * (-626.476) [-629.706] (-628.200) (-630.842) -- 0:00:17
213500 -- (-628.411) (-629.503) (-632.950) [-628.518] * [-627.051] (-628.381) (-628.368) (-626.737) -- 0:00:17
214000 -- [-627.304] (-630.639) (-626.419) (-625.779) * (-626.116) (-626.314) (-629.255) [-628.248] -- 0:00:17
214500 -- [-625.937] (-630.398) (-628.125) (-627.420) * (-630.508) (-627.275) [-627.312] (-626.515) -- 0:00:17
215000 -- (-629.136) (-627.880) (-626.430) [-630.628] * (-629.853) (-626.750) (-627.374) [-628.158] -- 0:00:17
Average standard deviation of split frequencies: 0.017569
215500 -- (-627.835) (-627.037) [-627.564] (-625.766) * [-628.546] (-629.981) (-627.408) (-625.989) -- 0:00:17
216000 -- (-627.245) (-625.975) [-628.218] (-628.680) * (-631.282) [-631.134] (-626.019) (-628.610) -- 0:00:17
216500 -- [-625.871] (-626.062) (-628.704) (-628.672) * (-627.185) [-628.085] (-625.811) (-625.765) -- 0:00:17
217000 -- (-627.802) [-626.836] (-626.700) (-626.380) * (-627.833) [-626.682] (-628.280) (-627.274) -- 0:00:16
217500 -- (-630.546) (-626.285) [-627.254] (-628.041) * (-626.019) (-626.276) (-628.208) [-626.400] -- 0:00:16
218000 -- [-627.119] (-627.208) (-626.571) (-627.012) * (-626.797) (-630.637) (-630.558) [-627.364] -- 0:00:16
218500 -- [-626.823] (-627.505) (-628.622) (-626.920) * [-629.259] (-626.253) (-632.069) (-627.025) -- 0:00:16
219000 -- [-628.303] (-626.889) (-628.149) (-626.214) * (-630.591) (-627.041) (-629.240) [-628.949] -- 0:00:16
219500 -- (-631.066) (-628.147) [-628.891] (-628.412) * (-627.329) [-626.473] (-627.832) (-629.113) -- 0:00:16
220000 -- (-631.876) (-627.479) (-631.026) [-627.446] * (-628.990) [-627.814] (-626.431) (-630.749) -- 0:00:16
Average standard deviation of split frequencies: 0.017342
220500 -- [-628.485] (-626.881) (-629.056) (-630.992) * (-631.929) (-629.640) [-626.709] (-628.387) -- 0:00:16
221000 -- (-627.679) (-627.766) [-628.033] (-628.533) * (-632.442) [-629.714] (-629.949) (-626.450) -- 0:00:16
221500 -- [-630.581] (-628.230) (-628.427) (-630.417) * (-631.347) [-628.497] (-627.251) (-631.407) -- 0:00:16
222000 -- (-626.631) [-628.152] (-627.746) (-628.764) * (-629.330) (-632.671) [-626.532] (-627.943) -- 0:00:16
222500 -- (-627.509) (-636.275) (-627.074) [-627.651] * (-633.571) (-629.930) (-627.163) [-626.862] -- 0:00:17
223000 -- [-626.044] (-630.308) (-630.136) (-628.115) * (-631.870) (-628.786) (-627.946) [-628.944] -- 0:00:17
223500 -- (-625.742) (-631.287) [-628.704] (-628.859) * (-627.724) (-628.975) (-628.036) [-629.057] -- 0:00:17
224000 -- (-625.865) (-628.245) (-626.944) [-627.083] * [-625.947] (-627.356) (-628.677) (-629.352) -- 0:00:17
224500 -- (-626.291) (-627.933) (-627.328) [-625.785] * (-630.471) [-628.718] (-629.621) (-631.011) -- 0:00:17
225000 -- (-629.534) (-626.723) [-629.542] (-627.697) * (-628.150) [-629.773] (-639.441) (-627.643) -- 0:00:17
Average standard deviation of split frequencies: 0.017126
225500 -- (-630.786) [-626.357] (-626.079) (-630.625) * (-628.653) [-627.794] (-630.460) (-628.951) -- 0:00:17
226000 -- (-628.081) [-626.778] (-625.933) (-627.075) * (-630.958) (-629.548) [-626.781] (-628.975) -- 0:00:16
226500 -- (-627.743) (-627.177) (-629.190) [-626.843] * [-630.835] (-630.157) (-626.897) (-627.435) -- 0:00:16
227000 -- (-627.370) (-630.849) (-630.262) [-630.250] * (-631.640) (-626.878) [-625.913] (-626.857) -- 0:00:16
227500 -- (-626.717) (-629.025) (-626.941) [-628.595] * (-626.519) (-627.912) (-627.421) [-626.238] -- 0:00:16
228000 -- (-629.468) [-627.644] (-630.190) (-629.347) * (-627.646) [-626.480] (-631.093) (-626.254) -- 0:00:16
228500 -- (-626.832) (-630.649) [-628.969] (-627.873) * (-629.268) (-631.944) (-630.872) [-627.000] -- 0:00:16
229000 -- [-628.990] (-627.319) (-626.265) (-627.327) * (-627.132) (-627.975) (-629.624) [-626.815] -- 0:00:16
229500 -- (-628.079) (-630.271) [-628.670] (-626.872) * [-625.967] (-626.116) (-631.829) (-629.807) -- 0:00:16
230000 -- (-629.054) (-629.899) (-627.486) [-627.377] * (-627.730) (-626.151) (-627.276) [-629.622] -- 0:00:16
Average standard deviation of split frequencies: 0.016463
230500 -- (-628.185) (-629.013) [-627.636] (-630.028) * [-625.725] (-627.260) (-628.817) (-629.026) -- 0:00:16
231000 -- (-632.517) (-629.414) (-626.902) [-628.200] * (-627.922) (-627.551) [-625.766] (-631.523) -- 0:00:16
231500 -- (-628.781) (-630.545) [-626.627] (-636.874) * (-627.074) [-628.979] (-626.820) (-631.224) -- 0:00:16
232000 -- (-631.557) (-628.401) (-626.676) [-630.190] * (-627.387) [-626.419] (-627.660) (-628.852) -- 0:00:16
232500 -- [-627.682] (-628.056) (-627.671) (-630.271) * [-625.991] (-629.761) (-626.453) (-629.554) -- 0:00:16
233000 -- (-626.975) (-628.884) [-627.084] (-630.230) * (-628.446) [-627.590] (-626.427) (-628.560) -- 0:00:16
233500 -- (-629.231) (-626.852) (-630.498) [-627.014] * (-628.582) [-627.888] (-627.451) (-628.926) -- 0:00:15
234000 -- (-628.264) (-628.051) (-629.145) [-627.739] * [-627.231] (-627.347) (-627.355) (-628.612) -- 0:00:15
234500 -- (-636.545) [-626.452] (-628.125) (-626.603) * (-628.006) (-627.185) [-627.161] (-625.943) -- 0:00:15
235000 -- (-630.733) (-627.232) (-627.046) [-628.289] * (-627.466) (-629.025) (-628.540) [-629.262] -- 0:00:15
Average standard deviation of split frequencies: 0.016202
235500 -- (-629.353) [-626.952] (-629.327) (-626.461) * (-631.411) (-628.477) (-628.908) [-628.714] -- 0:00:15
236000 -- [-628.438] (-630.044) (-626.964) (-629.950) * (-628.313) (-631.234) [-628.083] (-626.374) -- 0:00:15
236500 -- (-631.875) (-629.110) [-631.432] (-627.945) * (-629.514) (-626.246) (-627.973) [-626.263] -- 0:00:15
237000 -- (-629.576) (-628.149) [-629.721] (-627.216) * [-628.127] (-628.460) (-626.967) (-625.805) -- 0:00:15
237500 -- (-630.524) [-628.016] (-628.717) (-627.069) * (-627.951) (-630.696) (-627.476) [-626.221] -- 0:00:15
238000 -- (-630.508) (-628.091) (-635.741) [-626.314] * (-627.437) (-627.184) [-626.421] (-627.827) -- 0:00:15
238500 -- (-628.168) (-629.455) [-629.800] (-626.809) * (-632.192) (-629.846) (-626.936) [-626.836] -- 0:00:15
239000 -- [-627.853] (-629.684) (-629.059) (-629.828) * [-626.999] (-628.894) (-629.351) (-628.516) -- 0:00:15
239500 -- (-629.930) (-628.971) (-626.663) [-631.981] * (-627.110) (-627.943) [-625.963] (-628.583) -- 0:00:16
240000 -- (-627.010) (-627.964) [-630.142] (-629.695) * (-625.977) (-626.336) [-625.587] (-638.063) -- 0:00:16
Average standard deviation of split frequencies: 0.015670
240500 -- (-628.111) (-626.825) (-629.182) [-630.039] * [-626.540] (-629.409) (-632.643) (-628.134) -- 0:00:16
241000 -- (-627.298) (-628.312) (-630.410) [-626.914] * [-629.030] (-625.981) (-629.830) (-626.607) -- 0:00:16
241500 -- (-627.024) (-626.271) [-626.084] (-626.099) * (-628.948) (-631.744) [-629.783] (-627.761) -- 0:00:16
242000 -- (-627.481) (-629.126) (-627.073) [-627.272] * (-628.438) (-628.453) [-629.429] (-629.947) -- 0:00:15
242500 -- [-627.551] (-628.053) (-627.129) (-630.962) * (-632.355) (-629.674) (-627.236) [-626.577] -- 0:00:15
243000 -- (-628.790) (-626.321) (-626.384) [-628.833] * (-627.427) (-628.591) [-630.064] (-626.292) -- 0:00:15
243500 -- (-627.865) (-629.150) (-630.691) [-626.143] * (-629.727) (-627.613) (-626.118) [-627.678] -- 0:00:15
244000 -- (-626.497) (-628.386) (-628.785) [-627.227] * (-628.366) [-627.403] (-629.351) (-630.386) -- 0:00:15
244500 -- (-626.626) (-630.106) [-628.391] (-626.436) * (-627.876) (-625.731) [-627.462] (-628.476) -- 0:00:15
245000 -- (-628.535) (-627.840) (-625.822) [-626.302] * [-627.281] (-625.977) (-627.076) (-627.871) -- 0:00:15
Average standard deviation of split frequencies: 0.015863
245500 -- (-626.426) (-628.323) [-627.648] (-627.452) * (-626.620) [-628.037] (-628.920) (-630.499) -- 0:00:15
246000 -- (-633.283) (-627.913) (-628.410) [-631.134] * (-629.065) [-626.683] (-626.762) (-626.527) -- 0:00:15
246500 -- (-630.252) (-627.710) [-626.134] (-629.745) * (-628.280) [-625.727] (-628.898) (-625.733) -- 0:00:15
247000 -- (-628.793) [-626.539] (-629.053) (-627.928) * [-627.178] (-628.668) (-627.714) (-627.322) -- 0:00:15
247500 -- (-627.078) (-629.834) (-626.625) [-627.081] * (-628.383) (-628.303) (-632.828) [-630.759] -- 0:00:15
248000 -- (-628.906) [-627.472] (-630.143) (-626.704) * (-625.692) (-627.531) (-630.055) [-626.529] -- 0:00:15
248500 -- (-629.472) (-626.237) [-627.200] (-626.094) * (-628.208) (-628.695) [-626.928] (-627.492) -- 0:00:15
249000 -- (-628.249) (-630.437) [-626.778] (-625.830) * (-630.371) (-627.956) (-627.862) [-629.661] -- 0:00:15
249500 -- (-627.014) (-627.590) [-628.026] (-627.554) * (-635.427) (-627.388) (-626.926) [-629.248] -- 0:00:15
250000 -- (-628.575) (-627.482) [-627.544] (-626.757) * (-629.294) [-626.374] (-627.742) (-627.418) -- 0:00:15
Average standard deviation of split frequencies: 0.015487
250500 -- (-628.801) (-627.887) [-628.859] (-627.498) * (-626.609) (-626.384) (-630.197) [-626.250] -- 0:00:14
251000 -- (-630.187) (-630.243) [-626.980] (-629.205) * (-629.392) (-628.435) (-627.620) [-627.398] -- 0:00:14
251500 -- (-628.009) (-629.595) [-626.981] (-629.553) * (-631.257) (-629.107) (-629.483) [-626.502] -- 0:00:14
252000 -- [-629.400] (-629.272) (-629.266) (-628.040) * (-630.837) (-629.650) [-626.128] (-628.220) -- 0:00:14
252500 -- (-630.756) (-632.854) (-630.846) [-626.532] * [-628.775] (-627.154) (-627.254) (-627.353) -- 0:00:14
253000 -- [-625.878] (-630.006) (-628.899) (-628.298) * (-628.599) (-625.993) [-628.278] (-627.531) -- 0:00:14
253500 -- (-627.386) (-628.755) [-626.096] (-626.400) * [-626.069] (-629.508) (-628.191) (-626.483) -- 0:00:14
254000 -- (-629.313) [-627.205] (-626.616) (-628.111) * (-627.786) (-630.276) [-626.998] (-626.837) -- 0:00:14
254500 -- (-629.800) (-627.573) [-628.520] (-630.537) * (-630.620) (-630.836) (-627.018) [-627.240] -- 0:00:14
255000 -- (-628.364) (-626.169) (-629.566) [-630.723] * (-628.326) (-629.648) (-627.857) [-627.430] -- 0:00:14
Average standard deviation of split frequencies: 0.014948
255500 -- (-626.719) (-627.054) (-628.128) [-626.597] * (-625.726) (-629.595) [-626.983] (-627.767) -- 0:00:14
256000 -- [-626.405] (-626.754) (-633.408) (-627.993) * (-626.394) (-629.743) (-629.069) [-626.805] -- 0:00:14
256500 -- (-628.674) [-631.199] (-628.775) (-630.281) * (-628.585) [-628.826] (-627.262) (-632.843) -- 0:00:15
257000 -- (-626.667) (-627.001) (-627.416) [-631.283] * (-629.223) (-629.757) (-629.453) [-627.330] -- 0:00:15
257500 -- (-626.191) (-629.584) [-628.214] (-630.129) * (-627.581) [-626.031] (-628.048) (-626.083) -- 0:00:15
258000 -- (-625.884) [-630.927] (-628.214) (-629.863) * (-628.477) [-626.946] (-627.690) (-628.145) -- 0:00:15
258500 -- (-626.085) (-629.879) (-627.191) [-626.862] * (-626.842) (-629.004) (-627.982) [-627.148] -- 0:00:14
259000 -- [-636.437] (-628.910) (-626.220) (-628.653) * (-629.641) (-632.457) [-627.994] (-627.197) -- 0:00:14
259500 -- (-626.718) (-628.731) [-626.779] (-627.549) * [-630.448] (-632.449) (-629.491) (-626.282) -- 0:00:14
260000 -- (-628.678) (-633.210) [-628.193] (-634.385) * (-629.887) [-628.791] (-628.406) (-627.503) -- 0:00:14
Average standard deviation of split frequencies: 0.014807
260500 -- (-628.448) (-628.349) [-631.372] (-631.390) * [-628.044] (-628.048) (-628.009) (-631.350) -- 0:00:14
261000 -- (-630.971) (-627.521) (-627.222) [-630.640] * (-631.933) (-629.626) [-627.869] (-633.518) -- 0:00:14
261500 -- (-628.012) [-626.118] (-626.361) (-631.508) * (-627.215) (-628.804) [-626.184] (-628.167) -- 0:00:14
262000 -- (-633.179) (-626.597) (-626.889) [-629.747] * (-630.965) [-627.075] (-628.314) (-634.781) -- 0:00:14
262500 -- (-628.517) (-629.327) (-629.212) [-630.724] * (-631.441) (-626.501) (-629.073) [-628.203] -- 0:00:14
263000 -- [-628.647] (-626.807) (-627.367) (-628.142) * (-626.147) (-627.007) [-632.226] (-625.696) -- 0:00:14
263500 -- [-627.648] (-626.318) (-626.129) (-627.096) * (-625.667) (-630.204) (-630.301) [-626.041] -- 0:00:14
264000 -- (-631.433) [-626.653] (-626.186) (-627.187) * (-625.807) [-629.708] (-627.015) (-626.482) -- 0:00:14
264500 -- (-628.067) [-626.584] (-628.626) (-633.271) * (-625.932) [-627.895] (-626.899) (-626.016) -- 0:00:14
265000 -- [-627.714] (-629.523) (-629.720) (-630.793) * (-626.445) [-627.209] (-627.213) (-626.758) -- 0:00:14
Average standard deviation of split frequencies: 0.013865
265500 -- [-627.249] (-627.912) (-631.209) (-628.379) * (-634.036) [-627.740] (-627.919) (-632.221) -- 0:00:14
266000 -- (-628.354) [-625.904] (-628.149) (-625.628) * (-627.061) (-625.642) (-631.397) [-628.019] -- 0:00:14
266500 -- (-627.293) (-632.714) (-629.064) [-626.095] * (-627.868) [-632.835] (-628.989) (-627.754) -- 0:00:14
267000 -- (-628.090) (-632.886) [-626.069] (-626.095) * (-628.826) (-629.909) [-626.245] (-630.892) -- 0:00:13
267500 -- (-626.261) (-633.820) [-627.937] (-627.226) * (-628.020) (-631.064) [-628.695] (-629.467) -- 0:00:13
268000 -- (-627.754) [-625.525] (-627.665) (-628.355) * (-628.945) [-629.790] (-626.168) (-627.138) -- 0:00:13
268500 -- (-629.464) (-626.093) [-626.283] (-629.273) * (-628.702) (-626.897) (-631.767) [-627.078] -- 0:00:13
269000 -- (-632.094) (-627.366) (-627.517) [-627.700] * (-628.073) [-626.612] (-634.374) (-627.552) -- 0:00:13
269500 -- (-631.477) [-633.244] (-627.237) (-628.691) * (-626.559) (-628.480) [-628.264] (-629.043) -- 0:00:13
270000 -- (-630.560) (-628.854) [-627.578] (-627.831) * (-628.371) (-626.189) [-626.159] (-631.146) -- 0:00:13
Average standard deviation of split frequencies: 0.014753
270500 -- (-628.681) (-628.224) (-629.043) [-626.907] * [-628.016] (-626.349) (-626.011) (-627.353) -- 0:00:13
271000 -- (-626.850) (-627.698) (-626.862) [-627.954] * (-628.978) [-626.141] (-630.256) (-627.487) -- 0:00:13
271500 -- (-630.896) (-628.274) [-627.848] (-630.822) * [-626.282] (-628.595) (-627.198) (-627.233) -- 0:00:13
272000 -- [-625.779] (-626.957) (-627.684) (-625.827) * [-626.469] (-627.380) (-627.049) (-628.038) -- 0:00:13
272500 -- (-628.686) (-626.997) (-628.931) [-626.259] * (-628.623) (-627.069) [-628.742] (-628.545) -- 0:00:13
273000 -- (-626.730) [-626.607] (-626.763) (-627.353) * (-630.822) (-626.775) (-629.442) [-626.897] -- 0:00:13
273500 -- (-626.193) (-627.743) [-629.078] (-627.022) * (-630.261) (-626.870) (-629.967) [-628.203] -- 0:00:14
274000 -- (-626.920) (-627.757) [-628.899] (-635.631) * [-627.055] (-626.991) (-628.217) (-630.564) -- 0:00:14
274500 -- [-626.792] (-628.709) (-629.992) (-627.366) * [-628.483] (-628.538) (-628.712) (-627.206) -- 0:00:13
275000 -- [-626.198] (-628.620) (-629.874) (-626.913) * (-629.308) (-629.473) [-629.950] (-626.769) -- 0:00:13
Average standard deviation of split frequencies: 0.015975
275500 -- (-632.101) (-627.322) [-628.268] (-629.377) * (-628.200) (-627.765) [-631.114] (-625.860) -- 0:00:13
276000 -- (-630.352) [-626.225] (-627.288) (-633.267) * (-627.802) (-627.033) (-630.826) [-627.286] -- 0:00:13
276500 -- (-629.015) (-627.526) (-628.228) [-628.303] * [-626.650] (-626.290) (-626.849) (-627.278) -- 0:00:13
277000 -- (-629.201) [-625.770] (-630.249) (-628.113) * [-626.331] (-628.682) (-629.424) (-626.386) -- 0:00:13
277500 -- (-628.838) [-626.234] (-627.541) (-627.214) * [-627.138] (-628.627) (-626.760) (-625.841) -- 0:00:13
278000 -- (-628.330) [-629.306] (-626.261) (-626.471) * (-627.708) (-626.168) (-628.445) [-627.045] -- 0:00:13
278500 -- (-630.345) [-629.200] (-625.656) (-625.757) * (-627.730) (-627.101) [-628.662] (-628.541) -- 0:00:13
279000 -- (-629.901) (-627.386) [-625.947] (-626.126) * [-627.956] (-632.215) (-628.944) (-629.616) -- 0:00:13
279500 -- (-627.732) [-627.301] (-632.611) (-626.639) * (-627.154) (-630.372) [-631.382] (-631.480) -- 0:00:13
280000 -- (-627.620) (-627.136) (-627.973) [-627.536] * (-626.993) (-629.548) (-626.683) [-627.736] -- 0:00:13
Average standard deviation of split frequencies: 0.015956
280500 -- (-627.801) (-629.822) (-629.991) [-627.102] * (-626.897) (-628.363) [-627.840] (-627.989) -- 0:00:13
281000 -- (-626.958) [-630.313] (-631.020) (-630.060) * (-628.827) (-628.673) (-629.321) [-629.864] -- 0:00:13
281500 -- (-628.774) [-628.715] (-627.440) (-629.167) * (-627.627) (-628.044) [-629.429] (-629.276) -- 0:00:13
282000 -- (-627.909) [-627.935] (-631.441) (-627.264) * [-627.427] (-631.047) (-627.980) (-629.632) -- 0:00:13
282500 -- (-627.741) (-626.086) [-628.471] (-627.872) * [-628.315] (-627.824) (-630.224) (-627.484) -- 0:00:13
283000 -- [-630.841] (-627.611) (-627.274) (-629.588) * (-628.075) (-627.681) (-629.287) [-628.223] -- 0:00:13
283500 -- (-632.503) (-628.567) [-625.582] (-632.094) * (-627.591) [-626.467] (-627.079) (-627.838) -- 0:00:12
284000 -- [-630.059] (-634.617) (-626.275) (-629.749) * (-627.180) [-628.523] (-625.806) (-626.983) -- 0:00:12
284500 -- (-626.749) [-633.663] (-625.934) (-627.134) * (-627.620) (-628.726) (-626.605) [-627.201] -- 0:00:12
285000 -- (-627.239) [-627.218] (-629.342) (-629.288) * (-626.588) (-628.716) [-628.247] (-626.565) -- 0:00:12
Average standard deviation of split frequencies: 0.015707
285500 -- (-627.189) (-629.925) (-632.101) [-629.264] * [-627.330] (-626.649) (-627.769) (-628.739) -- 0:00:12
286000 -- (-628.802) (-630.398) [-629.131] (-626.457) * (-625.882) [-626.379] (-628.850) (-626.520) -- 0:00:12
286500 -- (-628.483) (-627.454) (-628.750) [-625.812] * (-627.109) [-626.293] (-631.317) (-627.281) -- 0:00:12
287000 -- [-630.277] (-628.422) (-626.143) (-626.696) * (-628.760) (-627.477) [-628.065] (-626.438) -- 0:00:12
287500 -- (-626.162) (-627.535) [-626.047] (-631.133) * [-627.506] (-628.104) (-627.577) (-630.007) -- 0:00:12
288000 -- [-627.057] (-626.769) (-626.826) (-631.898) * [-625.985] (-628.182) (-626.080) (-629.595) -- 0:00:12
288500 -- [-627.385] (-627.146) (-627.059) (-634.378) * (-626.700) (-627.812) [-626.265] (-630.086) -- 0:00:12
289000 -- [-629.772] (-628.494) (-627.457) (-630.048) * (-628.498) (-628.897) [-631.149] (-628.144) -- 0:00:12
289500 -- (-632.555) (-629.516) [-627.493] (-634.114) * (-626.486) (-632.470) (-627.331) [-628.227] -- 0:00:12
290000 -- (-627.472) (-629.284) [-626.792] (-633.245) * (-629.467) (-628.506) (-634.652) [-627.444] -- 0:00:12
Average standard deviation of split frequencies: 0.016600
290500 -- (-627.546) [-627.379] (-628.174) (-627.304) * (-629.840) (-626.186) (-632.156) [-627.400] -- 0:00:12
291000 -- (-626.230) (-628.871) [-628.437] (-628.293) * (-633.326) (-628.589) [-627.225] (-630.799) -- 0:00:12
291500 -- [-628.664] (-631.947) (-629.950) (-628.045) * (-630.401) [-627.721] (-634.854) (-630.782) -- 0:00:12
292000 -- (-629.444) (-632.030) [-626.968] (-626.101) * [-627.410] (-628.771) (-626.400) (-627.309) -- 0:00:12
292500 -- [-627.692] (-627.703) (-626.820) (-628.193) * (-630.890) (-626.319) [-626.374] (-626.643) -- 0:00:12
293000 -- (-628.084) (-630.042) (-626.985) [-626.523] * (-634.541) [-626.744] (-632.372) (-626.884) -- 0:00:12
293500 -- (-627.249) (-630.605) (-626.734) [-627.167] * [-627.252] (-629.437) (-628.637) (-626.070) -- 0:00:12
294000 -- (-627.581) [-627.989] (-630.716) (-628.903) * (-626.520) (-627.532) [-628.931] (-629.207) -- 0:00:12
294500 -- [-629.866] (-627.573) (-629.019) (-630.995) * (-626.126) [-627.724] (-627.018) (-629.068) -- 0:00:12
295000 -- (-628.377) (-632.022) (-631.121) [-635.127] * (-626.299) (-632.289) (-628.486) [-629.680] -- 0:00:12
Average standard deviation of split frequencies: 0.016722
295500 -- (-627.941) (-626.908) (-627.516) [-629.459] * [-626.555] (-627.873) (-629.348) (-629.210) -- 0:00:12
296000 -- (-627.101) [-628.299] (-628.475) (-626.344) * (-627.802) [-628.376] (-630.717) (-630.225) -- 0:00:12
296500 -- (-627.169) (-627.102) [-630.044] (-628.095) * (-627.455) (-627.651) (-630.166) [-628.272] -- 0:00:12
297000 -- (-629.745) (-629.099) [-627.396] (-627.280) * (-626.498) (-631.564) [-632.543] (-628.032) -- 0:00:12
297500 -- (-627.058) [-626.033] (-625.991) (-628.068) * (-629.082) (-630.687) [-628.871] (-627.607) -- 0:00:12
298000 -- (-626.199) (-626.370) (-630.052) [-626.912] * (-626.628) (-628.589) [-630.802] (-626.886) -- 0:00:12
298500 -- (-630.899) [-627.167] (-628.965) (-627.447) * (-627.153) (-629.096) [-631.771] (-628.616) -- 0:00:12
299000 -- (-627.248) [-628.303] (-629.752) (-628.225) * [-627.913] (-631.826) (-629.452) (-629.207) -- 0:00:12
299500 -- (-630.766) (-631.380) (-626.088) [-627.165] * (-628.142) (-627.736) [-627.407] (-629.014) -- 0:00:12
300000 -- [-626.388] (-629.268) (-626.438) (-627.788) * (-626.892) [-626.382] (-627.546) (-628.852) -- 0:00:12
Average standard deviation of split frequencies: 0.016659
300500 -- [-629.732] (-627.795) (-626.179) (-627.103) * (-630.248) (-629.669) (-630.061) [-630.114] -- 0:00:11
301000 -- (-627.657) (-627.621) (-633.881) [-629.785] * (-634.518) (-627.532) [-626.025] (-630.467) -- 0:00:11
301500 -- [-626.185] (-626.246) (-626.232) (-630.044) * (-626.741) [-627.106] (-628.656) (-628.724) -- 0:00:11
302000 -- (-627.393) (-626.810) [-627.090] (-627.046) * (-626.466) (-627.715) [-628.902] (-629.117) -- 0:00:11
302500 -- (-627.496) (-628.725) (-627.565) [-626.761] * [-626.613] (-630.702) (-629.262) (-629.965) -- 0:00:11
303000 -- (-627.908) (-627.400) [-625.985] (-630.956) * (-628.969) (-633.212) (-628.683) [-626.201] -- 0:00:11
303500 -- (-626.432) [-628.322] (-627.832) (-627.714) * [-626.264] (-627.642) (-627.445) (-627.194) -- 0:00:11
304000 -- (-626.216) (-629.823) [-627.805] (-629.236) * (-625.815) [-626.849] (-630.428) (-628.108) -- 0:00:11
304500 -- [-626.841] (-626.189) (-628.652) (-627.001) * (-625.599) (-627.179) [-630.460] (-627.465) -- 0:00:11
305000 -- (-628.516) (-629.906) [-627.855] (-632.411) * (-632.651) [-628.908] (-633.481) (-627.826) -- 0:00:11
Average standard deviation of split frequencies: 0.015405
305500 -- (-631.037) (-626.386) [-626.682] (-627.084) * [-626.854] (-632.072) (-631.278) (-627.458) -- 0:00:11
306000 -- (-628.494) (-626.835) (-628.879) [-628.041] * (-627.188) [-625.985] (-628.870) (-630.219) -- 0:00:11
306500 -- (-628.599) (-628.951) (-632.560) [-627.568] * (-625.841) [-631.428] (-627.510) (-630.759) -- 0:00:11
307000 -- (-627.515) (-627.920) [-630.108] (-627.551) * (-626.775) (-627.220) (-626.914) [-627.661] -- 0:00:11
307500 -- (-631.050) [-628.223] (-627.883) (-631.384) * (-628.297) (-628.278) (-627.334) [-626.952] -- 0:00:11
308000 -- [-629.282] (-627.452) (-628.505) (-631.615) * (-631.305) (-626.615) (-626.128) [-627.214] -- 0:00:11
308500 -- (-627.417) (-626.345) [-627.104] (-633.738) * (-627.749) [-632.411] (-627.240) (-626.863) -- 0:00:11
309000 -- [-629.431] (-628.361) (-627.514) (-629.834) * (-627.433) (-632.830) (-629.046) [-631.033] -- 0:00:11
309500 -- (-630.437) (-630.552) [-625.886] (-628.631) * (-626.714) (-632.794) (-627.074) [-629.195] -- 0:00:11
310000 -- (-628.577) [-630.943] (-628.351) (-626.525) * (-627.223) (-626.171) [-628.449] (-630.108) -- 0:00:11
Average standard deviation of split frequencies: 0.015364
310500 -- (-629.117) (-627.442) (-626.237) [-630.302] * (-626.642) (-630.700) [-629.641] (-627.424) -- 0:00:11
311000 -- (-631.752) (-626.432) [-631.771] (-629.894) * (-626.944) [-627.816] (-627.841) (-626.207) -- 0:00:11
311500 -- (-627.427) [-626.878] (-628.843) (-630.665) * (-630.815) (-627.512) [-627.292] (-626.986) -- 0:00:11
312000 -- [-627.408] (-628.697) (-628.225) (-627.677) * [-628.369] (-625.839) (-628.744) (-626.762) -- 0:00:11
312500 -- [-626.914] (-630.702) (-628.225) (-629.229) * (-628.186) [-627.615] (-625.850) (-629.774) -- 0:00:11
313000 -- (-629.742) (-628.040) (-628.732) [-628.017] * [-627.475] (-630.707) (-626.902) (-634.027) -- 0:00:11
313500 -- (-626.685) (-626.693) (-626.826) [-626.397] * (-631.314) (-629.961) [-627.424] (-628.168) -- 0:00:11
314000 -- (-629.004) (-627.293) (-625.724) [-626.875] * (-627.961) [-626.828] (-627.039) (-629.430) -- 0:00:11
314500 -- [-627.612] (-628.275) (-625.778) (-628.901) * (-627.736) (-630.574) (-630.962) [-626.635] -- 0:00:11
315000 -- (-630.203) (-627.412) [-627.561] (-627.253) * (-627.129) [-629.516] (-628.401) (-627.890) -- 0:00:11
Average standard deviation of split frequencies: 0.014731
315500 -- [-628.079] (-630.622) (-627.737) (-626.175) * (-628.045) (-627.729) [-627.233] (-628.671) -- 0:00:11
316000 -- (-628.056) [-630.417] (-628.144) (-628.038) * [-630.047] (-632.358) (-633.663) (-629.954) -- 0:00:11
316500 -- [-628.158] (-626.677) (-627.418) (-628.951) * (-630.701) [-629.193] (-626.378) (-626.669) -- 0:00:11
317000 -- [-629.119] (-632.100) (-627.313) (-628.802) * (-627.500) (-632.622) (-627.532) [-631.916] -- 0:00:10
317500 -- (-626.907) (-634.524) [-627.018] (-630.448) * [-625.677] (-631.371) (-626.610) (-627.169) -- 0:00:10
318000 -- (-626.958) (-631.076) [-626.553] (-627.950) * (-628.156) [-628.281] (-629.694) (-628.091) -- 0:00:10
318500 -- [-626.223] (-629.753) (-627.932) (-627.931) * [-626.979] (-629.316) (-626.432) (-629.662) -- 0:00:10
319000 -- (-628.254) (-630.848) (-631.768) [-627.837] * (-627.276) (-627.224) (-625.851) [-627.581] -- 0:00:10
319500 -- (-627.125) [-627.105] (-630.281) (-628.873) * (-626.410) (-626.934) (-627.111) [-626.658] -- 0:00:10
320000 -- (-631.182) [-627.201] (-627.563) (-628.637) * (-626.393) (-627.145) (-627.540) [-626.475] -- 0:00:10
Average standard deviation of split frequencies: 0.015047
320500 -- (-627.790) [-628.911] (-627.446) (-628.523) * (-625.566) (-628.306) (-625.939) [-627.147] -- 0:00:10
321000 -- (-629.875) [-626.808] (-627.023) (-626.371) * (-630.881) (-626.258) [-627.067] (-626.113) -- 0:00:10
321500 -- (-629.198) (-627.773) [-627.023] (-627.922) * (-629.303) [-628.554] (-627.639) (-627.752) -- 0:00:10
322000 -- (-627.211) (-626.562) (-626.493) [-627.594] * (-628.862) (-629.751) [-629.619] (-638.563) -- 0:00:10
322500 -- (-626.742) (-627.223) [-628.166] (-628.431) * (-626.737) (-627.578) [-628.700] (-631.761) -- 0:00:10
323000 -- [-628.350] (-630.277) (-627.477) (-627.131) * (-628.179) (-627.677) (-632.257) [-629.446] -- 0:00:10
323500 -- (-628.623) [-626.648] (-628.346) (-629.528) * (-631.546) [-627.189] (-629.382) (-627.112) -- 0:00:10
324000 -- [-627.944] (-629.302) (-629.964) (-629.155) * (-629.069) [-629.788] (-625.695) (-627.109) -- 0:00:10
324500 -- (-629.488) (-627.294) [-627.767] (-628.214) * [-629.019] (-630.260) (-628.712) (-626.407) -- 0:00:10
325000 -- (-627.516) (-628.442) (-627.801) [-628.172] * (-628.146) [-628.771] (-629.095) (-628.431) -- 0:00:10
Average standard deviation of split frequencies: 0.014545
325500 -- (-627.195) [-631.510] (-626.792) (-628.547) * [-630.027] (-626.231) (-629.303) (-631.252) -- 0:00:10
326000 -- (-627.879) (-628.299) (-627.345) [-626.172] * [-627.809] (-626.423) (-628.238) (-625.993) -- 0:00:10
326500 -- (-632.009) (-627.516) (-627.376) [-626.534] * (-627.908) [-627.129] (-628.875) (-626.737) -- 0:00:10
327000 -- (-630.492) (-628.241) [-626.107] (-630.415) * (-626.368) [-626.214] (-630.402) (-626.342) -- 0:00:10
327500 -- (-629.599) [-629.156] (-626.719) (-626.838) * (-629.164) (-627.753) [-630.008] (-630.481) -- 0:00:10
328000 -- (-627.104) (-627.444) [-628.977] (-627.393) * (-627.235) [-627.747] (-627.244) (-627.237) -- 0:00:10
328500 -- (-627.786) [-627.689] (-627.891) (-631.919) * (-629.036) (-629.451) [-629.574] (-628.620) -- 0:00:10
329000 -- (-631.679) [-627.301] (-627.357) (-628.100) * (-631.115) (-632.160) [-627.711] (-628.568) -- 0:00:10
329500 -- (-628.232) [-631.631] (-626.430) (-628.684) * (-628.476) (-628.608) [-626.436] (-627.170) -- 0:00:10
330000 -- (-630.414) (-631.153) [-628.048] (-626.472) * (-626.623) (-628.071) (-626.156) [-629.819] -- 0:00:10
Average standard deviation of split frequencies: 0.014256
330500 -- (-627.554) (-627.842) [-626.964] (-629.636) * (-627.989) (-630.402) [-626.694] (-628.688) -- 0:00:10
331000 -- (-630.882) (-632.517) [-626.069] (-629.505) * (-628.305) (-628.810) [-626.278] (-626.822) -- 0:00:10
331500 -- (-629.939) (-629.372) [-628.825] (-630.792) * [-627.122] (-631.586) (-627.116) (-628.177) -- 0:00:10
332000 -- (-627.687) (-628.916) (-630.628) [-630.025] * (-626.876) (-627.611) (-626.868) [-628.366] -- 0:00:10
332500 -- (-631.549) (-633.255) (-628.563) [-626.974] * (-629.081) [-626.957] (-626.457) (-630.306) -- 0:00:10
333000 -- (-628.503) (-628.507) (-634.621) [-626.989] * (-627.082) [-627.758] (-627.373) (-627.168) -- 0:00:10
333500 -- [-628.069] (-629.824) (-628.866) (-629.655) * [-629.702] (-628.218) (-627.315) (-627.991) -- 0:00:09
334000 -- [-627.716] (-626.280) (-627.733) (-638.077) * (-628.546) (-628.664) [-628.536] (-627.639) -- 0:00:09
334500 -- (-625.862) (-628.349) (-627.308) [-631.108] * (-629.551) (-632.967) (-626.967) [-628.636] -- 0:00:09
335000 -- (-628.051) (-628.765) [-627.344] (-626.993) * [-631.268] (-627.882) (-630.186) (-628.658) -- 0:00:09
Average standard deviation of split frequencies: 0.014112
335500 -- [-627.197] (-629.660) (-627.462) (-627.170) * (-626.747) (-629.231) (-627.158) [-627.513] -- 0:00:09
336000 -- (-625.640) (-627.294) [-626.225] (-628.909) * (-628.283) (-630.892) [-628.944] (-630.155) -- 0:00:09
336500 -- (-631.924) (-627.114) [-626.556] (-629.158) * (-626.761) (-629.778) (-627.951) [-629.095] -- 0:00:09
337000 -- (-626.594) [-629.203] (-629.093) (-630.796) * (-626.772) (-627.186) [-629.063] (-629.472) -- 0:00:09
337500 -- [-626.746] (-626.318) (-628.710) (-629.934) * (-630.488) (-626.812) (-628.537) [-628.525] -- 0:00:09
338000 -- (-629.859) (-626.170) [-633.189] (-634.461) * [-628.186] (-625.854) (-629.588) (-628.305) -- 0:00:09
338500 -- (-627.198) [-626.372] (-630.802) (-630.754) * (-626.952) (-628.998) (-629.172) [-628.083] -- 0:00:09
339000 -- (-627.265) (-628.098) (-627.173) [-629.159] * (-634.771) (-628.175) (-631.481) [-628.761] -- 0:00:09
339500 -- (-627.582) (-625.885) [-627.276] (-626.832) * [-626.588] (-626.400) (-627.023) (-627.595) -- 0:00:09
340000 -- [-628.287] (-629.498) (-629.292) (-630.025) * (-626.094) [-630.253] (-627.218) (-626.575) -- 0:00:09
Average standard deviation of split frequencies: 0.013024
340500 -- [-628.347] (-629.494) (-627.800) (-629.846) * (-627.962) (-630.423) [-629.118] (-631.747) -- 0:00:09
341000 -- (-628.666) (-628.725) [-627.555] (-629.224) * (-628.465) [-630.017] (-627.641) (-630.266) -- 0:00:09
341500 -- (-629.241) (-629.331) [-627.450] (-627.370) * (-627.126) (-634.352) [-628.383] (-627.531) -- 0:00:09
342000 -- (-627.468) (-628.308) [-628.254] (-632.852) * (-630.144) (-631.557) (-628.193) [-627.330] -- 0:00:09
342500 -- (-627.712) [-627.889] (-629.985) (-629.684) * (-626.772) (-629.966) (-627.388) [-628.254] -- 0:00:09
343000 -- (-626.821) (-628.007) (-626.467) [-628.136] * [-626.891] (-628.834) (-631.230) (-627.025) -- 0:00:09
343500 -- [-626.837] (-627.275) (-626.494) (-626.798) * (-627.300) [-629.874] (-628.132) (-625.995) -- 0:00:09
344000 -- (-626.780) (-629.359) [-628.142] (-628.602) * (-626.347) (-634.859) [-628.857] (-626.493) -- 0:00:09
344500 -- [-625.724] (-632.435) (-626.863) (-629.400) * (-628.673) (-630.583) (-628.167) [-628.428] -- 0:00:09
345000 -- (-630.620) (-629.285) (-627.429) [-628.050] * (-626.200) (-627.033) [-626.610] (-627.246) -- 0:00:09
Average standard deviation of split frequencies: 0.012422
345500 -- (-628.336) (-630.461) [-628.025] (-627.626) * (-627.233) (-626.265) [-626.260] (-629.201) -- 0:00:09
346000 -- (-627.036) [-629.115] (-626.950) (-628.527) * (-629.891) (-626.536) [-627.142] (-629.525) -- 0:00:09
346500 -- (-627.373) (-627.701) (-627.238) [-628.412] * (-630.146) [-625.577] (-625.929) (-628.334) -- 0:00:09
347000 -- (-627.364) (-627.487) (-628.760) [-626.053] * (-626.844) (-628.481) [-625.862] (-626.232) -- 0:00:09
347500 -- (-629.339) (-627.238) (-628.608) [-626.022] * (-628.178) (-625.850) (-631.407) [-627.780] -- 0:00:09
348000 -- (-626.316) (-629.559) [-625.876] (-633.413) * (-636.333) [-626.797] (-630.346) (-630.583) -- 0:00:09
348500 -- (-625.820) [-627.388] (-628.286) (-627.299) * (-635.216) (-626.820) [-628.235] (-626.992) -- 0:00:09
349000 -- (-631.700) [-630.872] (-630.165) (-625.920) * (-627.370) [-628.166] (-626.793) (-627.465) -- 0:00:09
349500 -- [-627.895] (-628.235) (-627.963) (-626.577) * (-628.095) [-626.206] (-627.877) (-627.657) -- 0:00:09
350000 -- (-628.878) [-627.607] (-626.057) (-627.392) * (-626.511) [-628.180] (-627.591) (-628.198) -- 0:00:09
Average standard deviation of split frequencies: 0.012519
350500 -- (-630.578) (-628.438) (-625.766) [-628.027] * [-626.731] (-629.103) (-628.242) (-628.736) -- 0:00:08
351000 -- (-627.363) (-627.450) [-626.187] (-629.859) * (-630.179) (-627.659) [-627.740] (-628.840) -- 0:00:08
351500 -- (-626.789) (-629.330) [-629.387] (-629.215) * [-628.094] (-631.563) (-630.771) (-628.447) -- 0:00:08
352000 -- (-628.523) (-628.360) (-632.069) [-628.034] * (-628.356) [-626.292] (-628.243) (-630.534) -- 0:00:08
352500 -- (-627.823) (-628.736) [-627.123] (-628.084) * [-627.436] (-629.576) (-631.377) (-628.349) -- 0:00:08
353000 -- (-629.183) [-627.475] (-629.940) (-626.926) * (-627.803) (-626.800) [-628.854] (-629.018) -- 0:00:08
353500 -- (-628.068) [-628.719] (-628.568) (-628.963) * [-627.930] (-629.115) (-628.790) (-627.583) -- 0:00:08
354000 -- (-633.802) [-629.119] (-626.356) (-627.502) * (-625.966) [-626.308] (-630.324) (-627.882) -- 0:00:08
354500 -- (-629.075) [-636.805] (-631.538) (-627.556) * [-627.444] (-628.954) (-633.073) (-630.278) -- 0:00:08
355000 -- [-629.983] (-627.536) (-634.280) (-626.315) * (-631.230) [-627.137] (-629.294) (-629.878) -- 0:00:08
Average standard deviation of split frequencies: 0.013159
355500 -- [-627.433] (-626.848) (-627.114) (-626.125) * (-631.129) [-626.083] (-630.032) (-630.126) -- 0:00:08
356000 -- (-625.955) (-629.481) (-628.098) [-627.358] * (-636.075) [-629.415] (-631.504) (-632.346) -- 0:00:08
356500 -- [-626.632] (-627.307) (-628.891) (-627.621) * (-628.851) (-626.292) [-630.497] (-627.379) -- 0:00:08
357000 -- (-626.856) (-627.683) [-625.615] (-631.599) * [-626.759] (-626.292) (-629.830) (-628.695) -- 0:00:08
357500 -- (-627.315) [-627.092] (-630.130) (-629.566) * (-628.728) [-626.593] (-632.832) (-627.364) -- 0:00:08
358000 -- [-627.623] (-626.529) (-626.356) (-628.962) * (-631.151) (-627.253) (-629.470) [-627.048] -- 0:00:08
358500 -- (-628.950) [-626.500] (-629.321) (-628.080) * [-630.194] (-628.845) (-627.594) (-629.123) -- 0:00:08
359000 -- (-631.208) [-627.292] (-627.247) (-626.682) * [-627.347] (-626.538) (-626.875) (-627.421) -- 0:00:08
359500 -- (-626.110) [-627.484] (-626.788) (-626.645) * [-628.289] (-626.408) (-628.051) (-630.082) -- 0:00:08
360000 -- (-626.221) [-629.892] (-634.276) (-627.369) * (-629.297) (-628.907) (-627.697) [-630.715] -- 0:00:08
Average standard deviation of split frequencies: 0.012907
360500 -- (-628.865) [-626.909] (-628.796) (-626.802) * (-629.569) [-628.558] (-626.516) (-626.933) -- 0:00:08
361000 -- (-629.014) (-627.806) (-627.813) [-627.086] * (-626.771) (-625.545) [-626.651] (-627.297) -- 0:00:08
361500 -- (-627.840) (-626.440) [-630.721] (-628.818) * (-628.323) (-626.683) (-628.559) [-626.984] -- 0:00:08
362000 -- [-626.762] (-626.583) (-627.219) (-627.713) * (-629.235) (-627.392) (-628.175) [-626.429] -- 0:00:08
362500 -- (-630.818) (-626.527) (-628.542) [-632.456] * (-628.592) (-626.366) (-625.998) [-626.280] -- 0:00:08
363000 -- (-628.750) (-626.918) [-627.466] (-626.984) * [-627.274] (-631.286) (-626.841) (-630.257) -- 0:00:08
363500 -- [-627.830] (-625.756) (-627.103) (-627.723) * (-627.578) [-630.065] (-627.957) (-629.061) -- 0:00:08
364000 -- [-630.458] (-628.208) (-627.673) (-626.550) * [-626.946] (-627.398) (-629.169) (-628.383) -- 0:00:08
364500 -- (-628.595) (-626.498) [-626.213] (-627.268) * [-628.225] (-628.636) (-629.824) (-637.335) -- 0:00:08
365000 -- [-628.937] (-627.892) (-626.543) (-629.206) * (-626.571) [-628.056] (-629.534) (-629.881) -- 0:00:08
Average standard deviation of split frequencies: 0.012804
365500 -- (-626.614) (-627.253) (-625.825) [-627.901] * (-627.168) [-628.161] (-628.476) (-626.363) -- 0:00:08
366000 -- (-631.604) [-628.142] (-628.919) (-625.724) * [-628.415] (-630.154) (-627.704) (-629.585) -- 0:00:08
366500 -- (-627.005) (-628.042) [-630.370] (-628.378) * [-627.496] (-633.381) (-629.223) (-630.557) -- 0:00:08
367000 -- (-627.429) (-626.265) (-628.150) [-629.059] * (-631.342) (-627.281) (-626.346) [-627.516] -- 0:00:07
367500 -- [-626.276] (-627.126) (-629.564) (-631.897) * (-628.296) [-628.837] (-625.597) (-627.547) -- 0:00:07
368000 -- (-626.595) (-628.405) [-626.894] (-630.356) * (-627.724) (-627.635) [-625.595] (-630.922) -- 0:00:07
368500 -- (-629.342) [-626.263] (-629.982) (-627.563) * (-628.619) (-627.591) [-628.919] (-626.256) -- 0:00:07
369000 -- (-628.365) [-629.917] (-627.437) (-626.598) * [-630.438] (-630.810) (-626.436) (-626.938) -- 0:00:07
369500 -- (-627.906) (-626.209) (-627.407) [-627.018] * [-627.007] (-627.244) (-627.472) (-628.597) -- 0:00:07
370000 -- (-628.440) (-626.631) [-629.081] (-629.300) * [-629.788] (-627.704) (-628.002) (-629.182) -- 0:00:07
Average standard deviation of split frequencies: 0.011923
370500 -- (-628.227) [-627.827] (-628.576) (-627.565) * (-629.750) (-628.770) (-629.324) [-628.099] -- 0:00:07
371000 -- (-627.546) [-630.230] (-628.547) (-628.415) * (-627.281) (-630.179) [-626.616] (-627.715) -- 0:00:07
371500 -- (-626.963) (-629.922) [-626.000] (-628.944) * (-634.501) [-628.400] (-627.347) (-630.056) -- 0:00:07
372000 -- (-628.018) (-630.076) [-627.957] (-627.193) * [-625.828] (-628.097) (-627.630) (-627.653) -- 0:00:07
372500 -- [-627.196] (-629.501) (-628.402) (-632.201) * (-628.921) (-630.227) (-626.934) [-626.006] -- 0:00:07
373000 -- (-626.145) [-628.923] (-626.930) (-627.508) * (-630.974) [-626.046] (-626.847) (-627.988) -- 0:00:07
373500 -- (-627.389) (-629.699) [-626.271] (-627.212) * (-628.295) (-628.231) (-630.767) [-627.224] -- 0:00:07
374000 -- [-626.355] (-628.112) (-630.578) (-630.721) * (-629.617) (-628.394) [-627.620] (-626.808) -- 0:00:07
374500 -- [-626.736] (-627.563) (-627.494) (-632.039) * (-631.411) (-627.636) [-628.061] (-626.318) -- 0:00:07
375000 -- (-626.338) (-627.517) [-629.304] (-633.451) * (-626.576) (-628.728) (-627.187) [-628.085] -- 0:00:07
Average standard deviation of split frequencies: 0.012459
375500 -- (-626.091) (-626.613) (-628.237) [-631.853] * (-628.357) (-627.348) [-626.972] (-627.644) -- 0:00:07
376000 -- (-626.921) (-626.396) [-626.915] (-626.649) * (-626.758) (-627.641) (-626.652) [-627.139] -- 0:00:07
376500 -- [-626.495] (-632.593) (-630.095) (-626.910) * (-629.970) (-628.761) [-626.271] (-628.860) -- 0:00:07
377000 -- [-628.028] (-628.152) (-627.335) (-627.259) * [-628.377] (-628.168) (-626.373) (-626.785) -- 0:00:07
377500 -- [-627.958] (-628.891) (-629.809) (-628.278) * (-630.281) [-627.299] (-626.310) (-625.664) -- 0:00:07
378000 -- (-626.176) (-627.695) [-630.283] (-626.708) * (-625.891) (-626.268) (-627.749) [-626.168] -- 0:00:07
378500 -- (-630.952) (-630.567) (-626.846) [-627.285] * (-627.100) (-627.550) [-626.838] (-625.781) -- 0:00:07
379000 -- (-626.833) (-629.338) (-628.317) [-626.185] * (-628.209) (-628.153) (-626.459) [-626.270] -- 0:00:07
379500 -- (-629.987) (-630.491) [-629.247] (-630.601) * (-629.010) (-638.589) [-629.437] (-627.982) -- 0:00:07
380000 -- [-626.990] (-626.297) (-626.800) (-629.787) * (-628.746) [-629.867] (-631.634) (-628.543) -- 0:00:07
Average standard deviation of split frequencies: 0.011842
380500 -- (-628.533) (-631.482) (-625.876) [-627.555] * (-629.884) (-631.447) (-626.676) [-626.406] -- 0:00:07
381000 -- (-626.296) (-627.690) [-625.979] (-626.715) * (-627.190) (-627.021) (-626.387) [-626.433] -- 0:00:07
381500 -- (-626.250) (-627.781) [-626.741] (-627.287) * (-627.578) [-632.033] (-627.285) (-627.233) -- 0:00:07
382000 -- (-628.137) (-627.575) (-628.797) [-626.333] * (-628.719) (-627.577) [-631.289] (-626.490) -- 0:00:07
382500 -- (-626.292) [-626.423] (-632.628) (-627.464) * (-631.411) (-629.433) (-626.986) [-628.713] -- 0:00:07
383000 -- (-629.897) [-628.173] (-631.926) (-627.837) * (-630.152) (-626.726) (-632.156) [-626.534] -- 0:00:07
383500 -- (-626.331) [-627.175] (-637.121) (-631.285) * [-626.789] (-626.645) (-631.744) (-630.073) -- 0:00:06
384000 -- (-626.458) [-628.886] (-629.411) (-628.966) * (-631.028) (-625.708) (-632.691) [-628.268] -- 0:00:06
384500 -- [-628.092] (-631.796) (-627.483) (-629.037) * [-629.344] (-625.844) (-630.371) (-626.756) -- 0:00:06
385000 -- (-627.792) (-629.004) [-627.491] (-629.038) * (-627.605) (-630.743) [-627.048] (-628.246) -- 0:00:06
Average standard deviation of split frequencies: 0.013003
385500 -- (-627.461) (-630.544) (-630.539) [-627.910] * (-630.346) [-628.444] (-628.253) (-628.694) -- 0:00:06
386000 -- (-626.355) (-626.527) [-628.018] (-631.106) * (-627.785) [-628.386] (-629.088) (-626.236) -- 0:00:06
386500 -- (-626.207) (-629.237) (-627.866) [-629.018] * [-628.848] (-627.323) (-630.654) (-626.435) -- 0:00:06
387000 -- (-629.565) [-628.523] (-626.434) (-626.962) * [-630.991] (-629.757) (-626.416) (-626.251) -- 0:00:06
387500 -- [-627.798] (-628.249) (-626.743) (-627.595) * (-633.063) (-630.788) (-630.869) [-627.062] -- 0:00:06
388000 -- (-627.160) [-626.423] (-627.085) (-626.657) * (-631.344) (-627.299) (-629.817) [-626.171] -- 0:00:06
388500 -- (-626.207) (-628.728) [-627.846] (-627.494) * (-627.542) (-628.857) [-627.287] (-628.437) -- 0:00:06
389000 -- [-626.779] (-627.926) (-628.834) (-628.165) * (-628.115) [-630.208] (-629.814) (-627.983) -- 0:00:06
389500 -- (-628.919) [-627.692] (-627.658) (-630.262) * (-630.161) (-631.432) (-638.528) [-629.844] -- 0:00:06
390000 -- (-628.890) (-627.183) [-626.301] (-630.934) * [-630.513] (-628.553) (-629.373) (-629.576) -- 0:00:06
Average standard deviation of split frequencies: 0.012564
390500 -- (-626.948) [-629.150] (-626.098) (-626.556) * (-626.074) (-632.575) [-627.170] (-628.466) -- 0:00:06
391000 -- (-626.461) [-629.847] (-627.750) (-629.338) * (-625.913) (-629.470) (-628.394) [-627.829] -- 0:00:06
391500 -- (-626.340) (-632.098) [-633.669] (-628.694) * (-628.426) (-628.424) [-626.933] (-631.940) -- 0:00:06
392000 -- (-626.361) (-633.000) (-631.609) [-630.380] * (-627.922) (-633.323) [-626.199] (-628.300) -- 0:00:06
392500 -- (-626.669) (-626.136) [-631.697] (-629.084) * (-632.205) (-627.684) [-628.335] (-627.387) -- 0:00:06
393000 -- [-626.626] (-626.099) (-630.749) (-629.793) * (-626.346) (-630.491) [-628.156] (-626.833) -- 0:00:06
393500 -- (-627.630) (-627.223) (-627.185) [-627.793] * [-630.334] (-636.313) (-631.245) (-626.225) -- 0:00:06
394000 -- (-629.338) (-629.257) (-626.897) [-628.597] * (-633.139) (-628.901) (-632.505) [-627.226] -- 0:00:06
394500 -- (-626.237) (-633.377) [-627.183] (-626.748) * (-627.917) (-626.603) (-628.590) [-629.274] -- 0:00:06
395000 -- (-628.104) (-627.940) (-626.935) [-628.025] * (-628.689) (-628.527) (-631.343) [-628.587] -- 0:00:06
Average standard deviation of split frequencies: 0.013095
395500 -- (-626.796) [-629.790] (-627.723) (-628.082) * (-627.660) (-629.851) [-625.951] (-627.726) -- 0:00:06
396000 -- [-631.465] (-629.675) (-629.117) (-626.985) * (-627.971) (-628.622) (-629.484) [-629.868] -- 0:00:06
396500 -- (-634.333) (-628.184) (-627.951) [-626.276] * (-626.617) (-627.343) (-631.072) [-628.285] -- 0:00:06
397000 -- [-629.936] (-630.099) (-627.436) (-626.001) * (-627.263) [-627.569] (-631.714) (-630.309) -- 0:00:06
397500 -- [-629.328] (-631.941) (-628.716) (-634.262) * (-625.977) (-626.992) [-631.013] (-627.160) -- 0:00:06
398000 -- [-628.336] (-626.079) (-626.781) (-627.411) * [-626.595] (-626.755) (-630.312) (-628.694) -- 0:00:06
398500 -- (-628.572) (-627.661) (-627.225) [-627.733] * (-627.719) [-630.342] (-628.082) (-628.787) -- 0:00:06
399000 -- (-627.118) (-628.939) (-628.583) [-626.705] * [-627.318] (-628.419) (-629.340) (-629.035) -- 0:00:06
399500 -- (-626.459) (-632.064) [-630.831] (-629.907) * (-628.620) (-626.249) (-625.966) [-627.740] -- 0:00:06
400000 -- [-627.469] (-630.103) (-628.871) (-627.939) * (-628.718) [-629.117] (-627.304) (-627.926) -- 0:00:06
Average standard deviation of split frequencies: 0.013773
400500 -- (-625.951) (-628.785) [-628.436] (-627.175) * (-629.286) [-627.049] (-628.073) (-631.388) -- 0:00:05
401000 -- (-626.912) [-626.563] (-628.977) (-627.977) * (-627.789) (-626.815) [-629.137] (-628.540) -- 0:00:05
401500 -- [-631.045] (-625.684) (-627.588) (-627.089) * (-626.916) (-626.837) [-628.351] (-627.184) -- 0:00:05
402000 -- (-626.998) (-627.739) [-627.773] (-628.730) * [-629.381] (-634.053) (-627.900) (-626.506) -- 0:00:05
402500 -- (-628.933) [-626.905] (-626.789) (-626.418) * [-628.070] (-629.961) (-628.349) (-626.504) -- 0:00:05
403000 -- (-630.250) (-625.929) (-627.150) [-626.907] * [-627.532] (-629.281) (-629.835) (-629.855) -- 0:00:05
403500 -- (-626.568) (-626.851) (-625.941) [-627.748] * [-626.061] (-627.347) (-627.471) (-628.208) -- 0:00:05
404000 -- (-627.269) [-629.458] (-629.317) (-633.262) * (-628.648) (-632.877) [-628.552] (-628.065) -- 0:00:05
404500 -- (-627.590) [-628.581] (-629.746) (-628.771) * (-629.485) (-635.570) (-628.868) [-626.724] -- 0:00:05
405000 -- (-627.818) [-630.128] (-626.963) (-631.720) * (-627.671) (-627.941) [-627.508] (-626.975) -- 0:00:05
Average standard deviation of split frequencies: 0.013592
405500 -- (-627.507) (-628.427) (-627.783) [-627.404] * [-627.720] (-626.784) (-628.918) (-633.277) -- 0:00:05
406000 -- (-627.645) [-626.842] (-628.550) (-626.542) * [-626.726] (-628.047) (-629.918) (-626.273) -- 0:00:05
406500 -- (-626.626) (-631.085) (-628.456) [-626.986] * (-626.421) [-627.751] (-627.621) (-626.052) -- 0:00:05
407000 -- [-626.133] (-626.139) (-630.079) (-626.395) * (-628.895) [-630.925] (-628.341) (-626.104) -- 0:00:05
407500 -- (-625.861) [-625.745] (-627.988) (-633.984) * (-627.023) (-629.176) [-627.390] (-629.256) -- 0:00:05
408000 -- (-628.265) (-626.236) [-628.200] (-634.260) * (-627.057) (-627.476) (-628.104) [-626.960] -- 0:00:05
408500 -- (-626.739) (-626.622) [-630.356] (-638.120) * (-628.496) [-625.953] (-627.612) (-627.400) -- 0:00:05
409000 -- (-626.175) (-627.356) [-625.900] (-628.122) * (-630.905) (-627.521) (-629.151) [-630.503] -- 0:00:05
409500 -- (-627.120) (-628.432) [-628.300] (-630.094) * (-628.114) [-629.376] (-627.471) (-630.931) -- 0:00:05
410000 -- (-629.582) [-630.586] (-629.590) (-633.916) * (-627.034) [-627.029] (-626.182) (-627.476) -- 0:00:05
Average standard deviation of split frequencies: 0.013707
410500 -- (-629.851) [-627.433] (-632.999) (-632.645) * (-632.322) (-628.054) (-627.116) [-628.134] -- 0:00:05
411000 -- (-632.346) (-628.300) (-628.019) [-626.213] * [-628.169] (-632.368) (-630.140) (-627.990) -- 0:00:05
411500 -- (-629.778) (-630.798) [-627.315] (-629.255) * (-627.102) (-627.950) [-627.275] (-627.156) -- 0:00:05
412000 -- (-631.622) (-628.667) [-628.393] (-628.266) * (-626.515) (-630.513) (-627.352) [-627.707] -- 0:00:05
412500 -- [-627.268] (-626.792) (-630.290) (-633.919) * (-628.024) (-627.262) [-627.961] (-626.112) -- 0:00:05
413000 -- (-628.421) (-630.303) [-627.899] (-629.651) * (-633.126) (-627.638) [-628.002] (-626.993) -- 0:00:05
413500 -- [-626.507] (-630.828) (-628.635) (-629.074) * (-627.951) (-627.074) [-629.368] (-626.276) -- 0:00:05
414000 -- (-626.175) (-627.904) (-628.419) [-626.129] * (-627.222) (-627.051) [-627.632] (-627.376) -- 0:00:05
414500 -- (-627.627) [-628.877] (-627.829) (-625.989) * [-632.370] (-631.248) (-628.019) (-628.047) -- 0:00:05
415000 -- (-629.425) [-628.298] (-631.046) (-626.690) * (-628.536) (-627.168) [-627.335] (-626.739) -- 0:00:05
Average standard deviation of split frequencies: 0.012798
415500 -- [-627.277] (-629.382) (-628.344) (-626.706) * (-627.123) (-629.470) (-625.597) [-628.970] -- 0:00:05
416000 -- (-629.266) (-628.439) [-627.852] (-627.676) * (-628.095) (-626.593) [-628.855] (-629.783) -- 0:00:05
416500 -- (-630.795) [-629.278] (-628.758) (-631.533) * (-628.586) (-627.210) (-627.332) [-626.011] -- 0:00:05
417000 -- (-626.741) (-626.374) (-630.248) [-628.547] * (-633.510) (-627.737) [-626.473] (-626.014) -- 0:00:04
417500 -- (-626.943) [-628.836] (-630.735) (-627.199) * (-629.092) (-626.238) [-627.369] (-628.219) -- 0:00:04
418000 -- [-626.817] (-626.828) (-629.622) (-627.406) * (-633.713) (-628.445) [-626.587] (-629.830) -- 0:00:04
418500 -- (-629.881) (-628.924) [-630.038] (-629.917) * (-630.155) (-627.521) [-626.949] (-628.693) -- 0:00:04
419000 -- (-629.274) (-628.352) (-630.877) [-629.090] * (-629.995) (-627.027) [-627.881] (-630.657) -- 0:00:04
419500 -- (-628.282) (-628.519) (-627.315) [-626.612] * (-629.433) [-627.836] (-628.249) (-628.022) -- 0:00:04
420000 -- (-628.602) (-628.787) (-626.746) [-627.582] * (-627.502) (-628.908) [-626.330] (-627.086) -- 0:00:04
Average standard deviation of split frequencies: 0.012459
420500 -- (-630.594) (-626.510) [-626.673] (-628.953) * (-630.695) (-630.386) [-628.837] (-626.691) -- 0:00:04
421000 -- [-630.386] (-625.920) (-626.799) (-631.535) * (-628.717) (-625.958) (-627.839) [-627.002] -- 0:00:04
421500 -- (-626.888) (-626.329) (-630.123) [-626.220] * [-625.836] (-630.032) (-629.143) (-628.908) -- 0:00:04
422000 -- (-628.248) (-626.711) (-627.496) [-627.536] * (-626.258) [-630.595] (-627.244) (-626.832) -- 0:00:04
422500 -- (-630.741) (-627.220) [-627.051] (-628.240) * (-626.665) [-630.053] (-627.030) (-629.531) -- 0:00:04
423000 -- [-629.818] (-627.616) (-626.312) (-628.472) * [-632.685] (-626.967) (-627.611) (-626.176) -- 0:00:04
423500 -- (-628.718) [-628.557] (-625.780) (-627.166) * [-626.087] (-626.764) (-626.942) (-629.456) -- 0:00:04
424000 -- (-629.171) (-631.156) (-631.243) [-626.855] * [-626.525] (-626.443) (-628.542) (-626.274) -- 0:00:04
424500 -- (-629.964) (-630.420) (-626.247) [-627.587] * (-628.557) (-627.190) [-626.385] (-627.001) -- 0:00:04
425000 -- (-629.727) (-628.330) [-627.911] (-627.474) * [-627.265] (-627.140) (-635.419) (-628.392) -- 0:00:04
Average standard deviation of split frequencies: 0.012888
425500 -- (-629.910) [-634.351] (-631.173) (-625.866) * [-627.671] (-626.316) (-628.374) (-631.481) -- 0:00:04
426000 -- (-631.939) (-628.854) [-627.945] (-628.512) * (-633.299) (-627.326) [-626.244] (-626.469) -- 0:00:04
426500 -- [-626.945] (-625.620) (-626.561) (-628.934) * (-628.043) [-626.891] (-630.360) (-626.355) -- 0:00:04
427000 -- (-629.469) (-627.073) (-626.673) [-627.400] * [-627.063] (-627.390) (-627.622) (-627.019) -- 0:00:04
427500 -- (-626.867) [-627.203] (-626.298) (-631.358) * (-628.588) [-626.847] (-628.793) (-628.074) -- 0:00:04
428000 -- (-627.794) (-630.282) (-629.685) [-627.483] * (-628.676) [-626.555] (-631.336) (-634.307) -- 0:00:04
428500 -- (-627.316) [-632.179] (-628.655) (-626.211) * (-626.031) (-626.927) (-627.752) [-627.759] -- 0:00:04
429000 -- [-628.995] (-630.112) (-629.103) (-627.237) * (-626.509) (-626.417) [-627.715] (-628.991) -- 0:00:04
429500 -- [-629.586] (-627.098) (-627.377) (-629.030) * (-627.759) (-628.630) (-629.123) [-628.192] -- 0:00:04
430000 -- (-625.893) (-628.485) (-626.594) [-626.307] * (-627.202) [-629.349] (-630.172) (-633.980) -- 0:00:04
Average standard deviation of split frequencies: 0.012620
430500 -- (-629.809) (-631.620) [-626.301] (-627.475) * (-627.024) (-629.844) [-628.741] (-632.981) -- 0:00:04
431000 -- [-629.500] (-631.231) (-626.401) (-630.112) * (-627.079) (-630.046) [-629.973] (-629.163) -- 0:00:04
431500 -- (-626.089) (-628.033) (-629.075) [-627.238] * [-627.793] (-631.139) (-626.869) (-629.917) -- 0:00:04
432000 -- (-629.084) (-626.206) (-626.511) [-627.662] * (-630.124) [-628.916] (-626.115) (-626.768) -- 0:00:04
432500 -- (-628.345) (-628.116) (-627.713) [-628.091] * (-625.976) (-627.538) (-628.365) [-626.489] -- 0:00:04
433000 -- (-627.500) (-633.514) [-626.423] (-628.111) * (-631.164) (-630.666) (-626.419) [-627.402] -- 0:00:04
433500 -- (-627.408) (-625.554) (-628.348) [-630.419] * (-627.447) (-628.483) (-626.134) [-627.844] -- 0:00:03
434000 -- [-629.207] (-627.864) (-626.411) (-629.793) * [-626.938] (-625.860) (-628.812) (-627.701) -- 0:00:03
434500 -- [-627.021] (-626.767) (-629.416) (-627.215) * (-630.788) [-627.341] (-627.261) (-629.429) -- 0:00:03
435000 -- (-626.938) (-630.231) (-630.261) [-627.869] * (-630.955) [-626.321] (-626.361) (-626.115) -- 0:00:03
Average standard deviation of split frequencies: 0.012020
435500 -- (-627.433) (-629.816) [-626.133] (-629.994) * (-626.236) (-626.750) [-629.087] (-627.472) -- 0:00:03
436000 -- (-629.953) (-628.182) [-627.345] (-629.185) * (-627.425) [-628.305] (-628.055) (-627.771) -- 0:00:03
436500 -- (-628.368) (-627.060) (-626.780) [-627.775] * (-634.872) (-628.407) (-627.029) [-627.647] -- 0:00:03
437000 -- [-627.063] (-632.823) (-633.562) (-626.802) * (-626.989) [-627.899] (-626.328) (-628.849) -- 0:00:03
437500 -- (-628.865) (-632.260) [-627.640] (-627.257) * (-626.307) [-627.998] (-626.397) (-629.574) -- 0:00:03
438000 -- (-629.490) (-626.103) [-626.424] (-632.294) * (-628.020) (-626.706) (-629.083) [-626.797] -- 0:00:03
438500 -- (-626.524) (-626.103) (-632.862) [-626.082] * (-626.946) (-628.032) [-626.913] (-628.526) -- 0:00:03
439000 -- (-625.952) (-627.628) [-627.098] (-627.984) * (-628.577) [-627.158] (-630.901) (-627.171) -- 0:00:03
439500 -- (-629.069) (-633.140) [-630.094] (-628.292) * (-631.520) (-626.104) [-629.572] (-628.345) -- 0:00:03
440000 -- (-631.395) (-629.624) (-630.042) [-626.488] * (-629.881) [-627.799] (-627.953) (-627.165) -- 0:00:03
Average standard deviation of split frequencies: 0.012035
440500 -- (-631.252) (-627.494) (-631.088) [-627.489] * (-628.338) (-627.490) (-628.130) [-627.033] -- 0:00:03
441000 -- [-627.445] (-629.617) (-637.259) (-630.003) * [-629.356] (-626.818) (-627.174) (-625.814) -- 0:00:03
441500 -- (-631.824) (-628.278) [-626.796] (-629.628) * (-629.487) (-629.456) (-628.995) [-627.993] -- 0:00:03
442000 -- (-629.490) [-627.987] (-626.707) (-626.765) * [-627.968] (-626.391) (-632.637) (-629.070) -- 0:00:03
442500 -- (-629.413) (-628.147) (-626.277) [-626.366] * [-626.569] (-626.863) (-629.685) (-629.857) -- 0:00:03
443000 -- (-625.875) (-630.100) [-627.060] (-627.054) * [-625.897] (-631.944) (-630.852) (-626.400) -- 0:00:03
443500 -- (-626.298) [-627.308] (-628.729) (-627.878) * (-627.417) [-627.839] (-628.317) (-632.830) -- 0:00:03
444000 -- (-632.306) [-627.970] (-626.579) (-627.071) * (-627.981) (-626.876) [-627.439] (-626.091) -- 0:00:03
444500 -- (-633.777) (-627.991) (-626.723) [-630.892] * (-628.670) (-628.208) (-626.677) [-626.396] -- 0:00:03
445000 -- (-628.039) [-627.539] (-628.239) (-629.538) * (-629.412) (-631.122) (-628.623) [-628.730] -- 0:00:03
Average standard deviation of split frequencies: 0.013367
445500 -- (-632.056) [-626.188] (-629.902) (-632.405) * (-627.051) [-629.659] (-628.804) (-628.414) -- 0:00:03
446000 -- (-630.397) (-626.721) [-630.438] (-629.139) * (-626.685) (-627.439) [-629.000] (-631.379) -- 0:00:03
446500 -- (-627.534) (-626.355) (-627.486) [-628.290] * [-629.341] (-627.248) (-633.432) (-631.702) -- 0:00:03
447000 -- (-627.724) (-626.994) [-628.802] (-626.576) * (-629.378) (-626.757) (-629.106) [-631.751] -- 0:00:03
447500 -- (-628.692) (-626.613) [-628.117] (-629.457) * [-626.457] (-626.904) (-628.662) (-629.706) -- 0:00:03
448000 -- [-627.319] (-628.422) (-627.195) (-628.386) * (-626.590) (-632.611) [-626.124] (-625.936) -- 0:00:03
448500 -- (-630.878) [-626.532] (-627.372) (-629.626) * [-631.791] (-628.469) (-626.644) (-626.896) -- 0:00:03
449000 -- (-628.717) (-626.494) [-627.255] (-626.813) * (-626.537) [-628.104] (-626.104) (-627.974) -- 0:00:03
449500 -- (-626.185) (-627.875) (-627.949) [-628.800] * (-627.754) [-626.369] (-629.299) (-629.851) -- 0:00:03
450000 -- (-626.332) (-625.837) [-626.646] (-626.752) * (-626.045) [-626.666] (-626.444) (-627.415) -- 0:00:03
Average standard deviation of split frequencies: 0.013206
450500 -- (-626.244) (-631.282) [-627.061] (-626.038) * (-628.827) (-627.843) (-628.934) [-625.826] -- 0:00:02
451000 -- [-628.144] (-627.948) (-626.198) (-627.551) * (-629.179) (-628.515) (-626.159) [-626.295] -- 0:00:02
451500 -- [-632.071] (-627.008) (-628.986) (-626.673) * (-627.853) [-626.854] (-626.224) (-626.325) -- 0:00:02
452000 -- (-628.227) (-627.449) (-628.035) [-627.051] * (-626.755) (-626.191) [-626.146] (-629.698) -- 0:00:02
452500 -- (-631.386) (-628.408) [-628.294] (-629.796) * (-627.189) (-632.203) [-627.287] (-626.564) -- 0:00:02
453000 -- (-629.820) [-630.670] (-629.455) (-627.223) * (-625.708) (-630.090) (-627.963) [-630.188] -- 0:00:02
453500 -- (-634.320) [-626.669] (-625.744) (-628.750) * (-629.037) [-626.970] (-629.268) (-628.632) -- 0:00:02
454000 -- [-626.012] (-632.546) (-627.208) (-628.426) * (-629.425) (-628.157) [-628.481] (-633.094) -- 0:00:02
454500 -- [-627.288] (-631.759) (-626.775) (-629.909) * (-629.004) [-628.663] (-627.353) (-626.188) -- 0:00:02
455000 -- (-627.760) [-627.086] (-630.126) (-629.451) * (-630.710) [-626.844] (-625.604) (-626.738) -- 0:00:02
Average standard deviation of split frequencies: 0.013439
455500 -- (-628.785) (-628.082) (-627.746) [-627.133] * (-628.873) [-626.663] (-625.777) (-625.878) -- 0:00:02
456000 -- (-625.974) (-627.211) (-628.587) [-625.744] * [-629.961] (-627.215) (-626.476) (-630.597) -- 0:00:02
456500 -- (-626.653) (-626.903) (-626.692) [-626.012] * (-627.067) [-626.950] (-626.904) (-632.008) -- 0:00:02
457000 -- [-626.862] (-627.878) (-625.979) (-629.597) * [-626.083] (-629.210) (-626.922) (-628.828) -- 0:00:02
457500 -- [-627.811] (-626.282) (-627.743) (-628.091) * (-629.001) [-627.233] (-628.083) (-625.952) -- 0:00:02
458000 -- (-630.145) [-627.105] (-628.064) (-628.059) * (-627.439) [-628.361] (-631.290) (-628.780) -- 0:00:02
458500 -- (-627.603) (-627.386) (-630.039) [-628.261] * (-629.126) [-626.599] (-626.314) (-627.203) -- 0:00:02
459000 -- (-628.941) [-626.376] (-630.189) (-631.857) * (-628.874) [-627.826] (-627.263) (-626.058) -- 0:00:02
459500 -- (-636.106) (-627.311) [-629.018] (-628.390) * (-629.616) (-627.398) [-629.412] (-627.532) -- 0:00:02
460000 -- [-629.466] (-627.526) (-626.812) (-626.107) * (-627.803) [-627.363] (-630.932) (-627.536) -- 0:00:02
Average standard deviation of split frequencies: 0.013905
460500 -- (-628.787) (-628.943) (-629.294) [-630.110] * (-626.716) [-630.093] (-635.192) (-628.923) -- 0:00:02
461000 -- (-627.115) (-628.922) [-626.843] (-627.225) * (-632.243) (-626.649) [-626.850] (-627.960) -- 0:00:02
461500 -- (-628.016) (-630.392) (-626.086) [-627.855] * (-630.314) [-626.933] (-626.560) (-627.998) -- 0:00:02
462000 -- (-628.887) [-630.278] (-626.489) (-628.115) * (-629.160) (-629.783) (-627.225) [-629.070] -- 0:00:02
462500 -- [-627.315] (-630.468) (-627.017) (-628.648) * [-628.642] (-628.627) (-632.876) (-627.753) -- 0:00:02
463000 -- (-630.677) (-628.033) (-627.523) [-627.631] * (-628.491) (-635.622) (-636.772) [-628.328] -- 0:00:02
463500 -- (-632.595) [-627.863] (-628.395) (-627.741) * (-626.828) (-625.634) (-631.196) [-631.294] -- 0:00:02
464000 -- (-628.665) [-626.162] (-629.562) (-626.306) * (-627.888) [-626.276] (-632.514) (-628.342) -- 0:00:02
464500 -- (-629.437) (-630.179) (-627.680) [-629.417] * [-626.839] (-627.027) (-628.209) (-627.083) -- 0:00:02
465000 -- (-627.530) [-628.357] (-627.158) (-630.396) * (-630.098) (-628.106) (-626.381) [-627.612] -- 0:00:02
Average standard deviation of split frequencies: 0.013567
465500 -- [-628.083] (-628.125) (-628.022) (-627.282) * [-626.267] (-626.949) (-629.998) (-627.293) -- 0:00:02
466000 -- (-628.042) [-627.243] (-629.607) (-626.353) * (-627.903) [-628.209] (-627.868) (-625.943) -- 0:00:02
466500 -- (-629.490) (-631.216) (-628.638) [-626.355] * [-629.187] (-628.950) (-625.988) (-630.715) -- 0:00:02
467000 -- (-627.777) (-626.770) [-629.723] (-626.741) * (-628.531) (-626.293) (-626.263) [-630.123] -- 0:00:01
467500 -- (-628.387) (-628.230) [-626.875] (-627.451) * (-629.545) (-627.613) [-628.753] (-627.250) -- 0:00:01
468000 -- (-627.430) (-626.524) (-627.086) [-626.239] * (-627.203) (-627.009) (-627.202) [-627.492] -- 0:00:01
468500 -- (-633.012) (-626.431) (-627.535) [-626.404] * (-626.717) [-625.950] (-629.143) (-626.997) -- 0:00:01
469000 -- (-628.515) (-628.785) [-627.650] (-628.355) * (-627.257) (-631.473) [-627.471] (-626.940) -- 0:00:01
469500 -- (-626.847) (-626.541) (-631.661) [-628.096] * (-627.975) [-628.218] (-630.137) (-630.080) -- 0:00:01
470000 -- (-629.072) (-627.519) (-628.593) [-632.167] * [-626.785] (-626.931) (-628.569) (-630.346) -- 0:00:01
Average standard deviation of split frequencies: 0.012490
470500 -- (-626.858) [-628.908] (-629.499) (-631.496) * (-629.151) [-628.331] (-627.949) (-627.697) -- 0:00:01
471000 -- (-626.841) (-628.001) (-627.460) [-627.954] * (-629.705) (-626.705) (-627.475) [-629.421] -- 0:00:01
471500 -- (-627.450) [-628.620] (-629.805) (-628.123) * (-627.116) (-628.778) [-628.395] (-633.063) -- 0:00:01
472000 -- (-627.497) (-628.511) (-627.241) [-627.724] * (-627.670) [-631.809] (-630.641) (-628.880) -- 0:00:01
472500 -- (-629.300) (-628.544) (-630.887) [-630.013] * (-628.006) [-629.001] (-627.319) (-627.318) -- 0:00:01
473000 -- (-632.626) (-627.823) (-627.531) [-628.933] * (-630.751) (-628.120) [-627.575] (-629.217) -- 0:00:01
473500 -- (-627.651) (-627.216) [-626.016] (-628.505) * (-632.014) [-629.898] (-631.480) (-626.509) -- 0:00:01
474000 -- (-628.312) (-629.453) (-632.727) [-627.943] * (-629.568) (-628.435) [-629.041] (-626.631) -- 0:00:01
474500 -- (-631.101) (-626.407) [-627.619] (-628.765) * [-629.419] (-627.933) (-628.844) (-625.819) -- 0:00:01
475000 -- (-629.207) [-626.292] (-629.626) (-627.717) * (-627.130) (-626.586) [-626.568] (-630.145) -- 0:00:01
Average standard deviation of split frequencies: 0.012292
475500 -- (-632.056) (-625.628) [-631.904] (-628.301) * (-626.073) (-625.815) [-626.797] (-630.366) -- 0:00:01
476000 -- [-627.534] (-627.268) (-633.791) (-629.365) * (-633.688) (-631.633) [-626.028] (-629.540) -- 0:00:01
476500 -- (-626.410) (-627.355) [-630.970] (-631.393) * (-630.496) (-628.564) [-627.030] (-627.982) -- 0:00:01
477000 -- [-627.475] (-630.360) (-626.701) (-628.220) * (-628.407) (-626.968) (-627.843) [-627.653] -- 0:00:01
477500 -- (-626.444) (-628.563) (-627.817) [-627.093] * (-629.497) [-628.262] (-627.338) (-631.176) -- 0:00:01
478000 -- [-626.271] (-628.637) (-628.726) (-628.064) * [-628.368] (-627.470) (-626.667) (-627.100) -- 0:00:01
478500 -- [-627.266] (-634.287) (-627.625) (-627.659) * (-626.781) (-628.062) (-625.797) [-628.665] -- 0:00:01
479000 -- (-628.580) (-628.430) (-626.981) [-626.849] * [-629.964] (-627.899) (-627.339) (-627.348) -- 0:00:01
479500 -- (-629.412) [-627.424] (-628.579) (-626.403) * (-630.406) (-626.327) [-626.444] (-628.425) -- 0:00:01
480000 -- (-626.695) [-627.040] (-627.501) (-631.190) * (-628.378) (-628.963) (-626.724) [-627.468] -- 0:00:01
Average standard deviation of split frequencies: 0.011884
480500 -- (-626.950) (-629.767) [-628.835] (-626.379) * (-630.991) [-627.769] (-626.150) (-627.447) -- 0:00:01
481000 -- (-627.014) (-628.711) (-630.552) [-627.425] * (-626.790) [-627.815] (-629.784) (-630.188) -- 0:00:01
481500 -- (-628.878) (-627.437) [-627.943] (-629.816) * (-627.381) (-628.407) [-627.039] (-628.630) -- 0:00:01
482000 -- (-627.319) [-626.638] (-630.195) (-630.388) * (-628.940) (-627.487) [-631.236] (-630.249) -- 0:00:01
482500 -- (-628.589) [-626.371] (-629.741) (-627.650) * [-631.505] (-627.271) (-628.559) (-628.411) -- 0:00:01
483000 -- (-630.680) [-627.063] (-629.996) (-628.324) * (-629.896) (-627.196) (-632.343) [-625.623] -- 0:00:01
483500 -- [-627.537] (-628.814) (-629.086) (-626.542) * (-631.104) (-629.021) (-629.757) [-625.980] -- 0:00:00
484000 -- (-629.293) (-628.673) (-627.486) [-626.479] * (-629.091) (-626.837) (-626.073) [-626.480] -- 0:00:00
484500 -- (-629.836) [-627.825] (-629.771) (-627.907) * (-627.181) (-626.867) [-626.839] (-626.725) -- 0:00:00
485000 -- [-628.461] (-631.534) (-625.778) (-626.897) * (-627.410) (-626.739) [-627.063] (-629.144) -- 0:00:00
Average standard deviation of split frequencies: 0.012096
485500 -- [-627.090] (-629.074) (-628.275) (-628.628) * (-627.773) (-626.609) [-626.583] (-627.119) -- 0:00:00
486000 -- (-627.453) (-628.886) [-630.711] (-626.485) * (-628.705) [-629.415] (-627.573) (-627.787) -- 0:00:00
486500 -- (-627.494) (-628.642) (-625.648) [-626.943] * (-628.430) (-630.245) (-626.691) [-630.821] -- 0:00:00
487000 -- (-626.274) [-625.849] (-630.279) (-626.885) * (-630.944) [-629.732] (-632.420) (-627.896) -- 0:00:00
487500 -- (-627.140) [-626.246] (-628.677) (-625.775) * (-627.036) (-627.247) [-629.979] (-626.560) -- 0:00:00
488000 -- (-626.398) (-628.019) [-626.961] (-628.972) * (-627.797) [-628.504] (-626.355) (-626.841) -- 0:00:00
488500 -- (-630.130) (-628.131) (-628.334) [-626.636] * (-628.099) (-629.713) [-629.931] (-632.462) -- 0:00:00
489000 -- [-627.032] (-627.987) (-627.494) (-627.686) * [-626.911] (-627.582) (-627.603) (-629.873) -- 0:00:00
489500 -- (-628.509) (-625.950) [-628.297] (-627.834) * (-629.614) (-628.238) [-628.128] (-625.800) -- 0:00:00
490000 -- [-628.494] (-628.409) (-627.990) (-627.027) * (-632.652) (-628.825) [-626.547] (-626.971) -- 0:00:00
Average standard deviation of split frequencies: 0.011755
490500 -- (-628.331) (-629.406) (-630.354) [-629.824] * (-628.338) [-629.862] (-627.508) (-628.914) -- 0:00:00
491000 -- (-628.480) (-628.152) (-627.960) [-626.944] * (-627.688) [-629.214] (-630.662) (-627.546) -- 0:00:00
491500 -- (-633.178) (-629.184) [-628.425] (-628.932) * (-630.187) (-628.599) (-628.821) [-631.876] -- 0:00:00
492000 -- [-631.889] (-626.897) (-628.533) (-628.431) * [-629.696] (-627.179) (-627.980) (-627.546) -- 0:00:00
492500 -- (-628.666) [-626.041] (-627.919) (-626.294) * [-627.706] (-630.490) (-626.092) (-627.401) -- 0:00:00
493000 -- [-628.058] (-627.530) (-629.657) (-626.519) * (-626.339) [-625.802] (-632.806) (-629.835) -- 0:00:00
493500 -- (-627.250) (-629.582) (-630.442) [-626.458] * [-629.905] (-625.755) (-628.750) (-634.727) -- 0:00:00
494000 -- (-625.785) (-632.087) (-628.651) [-626.836] * [-628.433] (-626.770) (-630.362) (-630.935) -- 0:00:00
494500 -- (-627.487) (-628.793) (-628.039) [-628.133] * (-630.867) (-626.194) (-629.637) [-629.523] -- 0:00:00
495000 -- (-629.174) (-626.456) [-627.122] (-632.021) * (-628.092) (-631.791) (-628.925) [-627.764] -- 0:00:00
Average standard deviation of split frequencies: 0.011629
495500 -- (-628.279) (-631.381) (-626.437) [-626.098] * (-626.940) (-627.753) (-636.048) [-628.368] -- 0:00:00
496000 -- [-626.231] (-626.279) (-626.521) (-626.679) * (-631.378) (-627.046) (-629.737) [-627.299] -- 0:00:00
496500 -- (-628.135) [-625.809] (-628.331) (-627.263) * [-628.188] (-628.338) (-628.962) (-628.819) -- 0:00:00
497000 -- (-627.628) [-625.611] (-628.029) (-627.046) * (-628.395) (-628.483) [-626.675] (-628.927) -- 0:00:00
497500 -- [-626.555] (-628.886) (-629.240) (-626.883) * (-629.133) [-627.621] (-626.302) (-627.583) -- 0:00:00
498000 -- (-629.603) (-628.748) (-628.006) [-627.274] * (-628.929) [-631.159] (-627.568) (-627.904) -- 0:00:00
498500 -- (-632.048) (-633.108) [-628.860] (-627.186) * (-629.632) (-627.267) [-627.830] (-627.004) -- 0:00:00
499000 -- (-630.865) [-627.444] (-626.312) (-629.452) * [-629.966] (-627.484) (-628.046) (-631.124) -- 0:00:00
499500 -- [-629.818] (-627.379) (-629.646) (-627.986) * (-625.797) (-628.400) (-627.097) [-629.978] -- 0:00:00
500000 -- (-628.298) (-627.762) [-629.257] (-627.278) * (-629.526) (-626.299) (-628.322) [-632.116] -- 0:00:00
Average standard deviation of split frequencies: 0.011132
Analysis completed in 30 seconds
Analysis used 29.57 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -625.46
Likelihood of best state for "cold" chain of run 2 was -625.49
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.5 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.1 % ( 28 %) Dirichlet(Pi{all})
39.5 % ( 27 %) Slider(Pi{all})
88.8 % ( 82 %) Multiplier(Alpha{1,2})
87.7 % ( 86 %) Multiplier(Alpha{3})
21.5 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 89 %) ParsSPR(Tau{all},V{all})
30.7 % ( 21 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
36.2 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
79.0 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
37.1 % ( 33 %) Dirichlet(Pi{all})
39.1 % ( 35 %) Slider(Pi{all})
88.0 % ( 87 %) Multiplier(Alpha{1,2})
88.3 % ( 86 %) Multiplier(Alpha{3})
22.9 % ( 26 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 93 %) ParsSPR(Tau{all},V{all})
30.6 % ( 19 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
35.5 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83849 0.82 0.67
3 | 83377 83199 0.83
4 | 83525 82951 83099
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83556 0.82 0.67
3 | 83609 82891 0.84
4 | 83383 83554 83007
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -627.02
| 2 1 2 1 2 |
| 1 1 1 2 2 2 2 1 1|
| 2 211 1 * * 21 2 1 1 |
| 1 1 2 2 2 2 11 1 2 1 1 2*2 12 2 |
|* 21 1 * 1 21 2 1 1 1 |
| 2 22 1 22*11 2 1 12*2 12 |
| 111221 1 1 22 1 2 |
| 2 2 2 2 1 2 1 |
| 2 2 1 2 11 1 |
| 2 2 1 1 1 2 22|
| 1 1 2 2 |
| 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -629.81
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -627.18 -631.12
2 -627.22 -629.51
--------------------------------------
TOTAL -627.20 -630.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888361 0.090530 0.342836 1.479037 0.863685 751.00 751.00 1.000
r(A<->C){all} 0.193055 0.025282 0.000174 0.524495 0.152426 39.35 56.82 1.000
r(A<->G){all} 0.150560 0.016257 0.000028 0.409664 0.116375 43.43 90.02 1.000
r(A<->T){all} 0.159005 0.019734 0.000111 0.456692 0.120616 80.35 142.32 1.013
r(C<->G){all} 0.184289 0.024069 0.000097 0.500157 0.144644 57.67 100.13 1.008
r(C<->T){all} 0.161776 0.019158 0.000251 0.442994 0.122052 25.66 71.95 1.004
r(G<->T){all} 0.151315 0.016023 0.000095 0.397249 0.114873 93.36 189.67 1.020
pi(A){all} 0.240276 0.000388 0.203969 0.281146 0.239585 584.34 667.67 1.000
pi(C){all} 0.299558 0.000441 0.259934 0.341155 0.298652 751.00 751.00 1.000
pi(G){all} 0.291989 0.000438 0.253645 0.334228 0.291471 593.08 666.61 1.000
pi(T){all} 0.168177 0.000295 0.135104 0.201422 0.167685 591.79 632.99 0.999
alpha{1,2} 0.448899 0.234757 0.000182 1.487835 0.266943 266.31 407.80 1.004
alpha{3} 0.453577 0.276592 0.000291 1.478553 0.283038 362.78 447.61 1.000
pinvar{all} 0.996494 0.000016 0.989182 0.999993 0.997817 414.96 498.16 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- ..**..
9 -- ..*.*.
10 -- ...**.
11 -- .*.*..
12 -- .*...*
13 -- ..****
14 -- .****.
15 -- .*.***
16 -- .***.*
17 -- ..*..*
18 -- .**...
19 -- .**.**
20 -- .*..*.
21 -- ...*.*
22 -- .***..
23 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 250 0.166445 0.003766 0.163782 0.169108 2
8 229 0.152463 0.000942 0.151798 0.153129 2
9 223 0.148469 0.000942 0.147803 0.149134 2
10 219 0.145806 0.019773 0.131824 0.159787 2
11 215 0.143142 0.012240 0.134487 0.151798 2
12 214 0.142477 0.015065 0.131824 0.153129 2
13 213 0.141811 0.002825 0.139814 0.143808 2
14 211 0.140479 0.002825 0.138482 0.142477 2
15 210 0.139814 0.024480 0.122503 0.157124 2
16 209 0.139148 0.016006 0.127830 0.150466 2
17 209 0.139148 0.023539 0.122503 0.155792 2
18 208 0.138482 0.003766 0.135819 0.141145 2
19 207 0.137816 0.002825 0.135819 0.139814 2
20 206 0.137150 0.013182 0.127830 0.146471 2
21 200 0.133156 0.013182 0.123835 0.142477 2
22 154 0.102530 0.016948 0.090546 0.114514 2
23 134 0.089214 0.016948 0.077230 0.101198 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.094415 0.009134 0.000032 0.278770 0.066232 1.000 2
length{all}[2] 0.105319 0.010638 0.000006 0.311175 0.074343 1.000 2
length{all}[3] 0.102571 0.010315 0.000074 0.304682 0.069742 1.000 2
length{all}[4] 0.100790 0.010861 0.000018 0.314150 0.068524 1.000 2
length{all}[5] 0.097259 0.009840 0.000008 0.294593 0.066041 0.999 2
length{all}[6] 0.093726 0.008290 0.000014 0.277212 0.064833 1.000 2
length{all}[7] 0.102940 0.010922 0.001215 0.321579 0.067329 1.011 2
length{all}[8] 0.102079 0.012949 0.000354 0.323629 0.066381 1.011 2
length{all}[9] 0.113570 0.013375 0.000304 0.328151 0.078950 0.997 2
length{all}[10] 0.096276 0.008860 0.000016 0.244188 0.072312 1.006 2
length{all}[11] 0.099826 0.011005 0.000397 0.295800 0.069181 1.001 2
length{all}[12] 0.085876 0.006131 0.000307 0.223403 0.066611 0.996 2
length{all}[13] 0.096546 0.011702 0.000856 0.284739 0.072834 0.999 2
length{all}[14] 0.097181 0.008845 0.000902 0.267274 0.068732 0.999 2
length{all}[15] 0.101981 0.010515 0.000196 0.323123 0.066471 0.996 2
length{all}[16] 0.101394 0.008977 0.000086 0.295465 0.074669 0.997 2
length{all}[17] 0.096812 0.010063 0.001254 0.309788 0.063051 0.997 2
length{all}[18] 0.105114 0.010680 0.000285 0.302807 0.081743 0.997 2
length{all}[19] 0.095134 0.008489 0.000514 0.269444 0.065425 0.999 2
length{all}[20] 0.087185 0.007866 0.000502 0.269373 0.059348 0.999 2
length{all}[21] 0.107251 0.013708 0.000732 0.317815 0.068153 1.003 2
length{all}[22] 0.098513 0.008864 0.000034 0.289675 0.070936 0.994 2
length{all}[23] 0.085375 0.005829 0.000665 0.234372 0.071293 0.995 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.011132
Maximum standard deviation of split frequencies = 0.024480
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 43 trees
90 % credible set contains 89 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 459
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 153 / 153 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 153 / 153 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093539 0.087777 0.065152 0.097893 0.101522 0.068493 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -686.368443
Iterating by ming2
Initial: fx= 686.368443
x= 0.09354 0.08778 0.06515 0.09789 0.10152 0.06849 0.30000 1.30000
1 h-m-p 0.0000 0.0004 366.8400 +++ 627.709531 m 0.0004 14 | 1/8
2 h-m-p 0.0071 0.0989 20.3637 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 338.3756 ++ 625.161780 m 0.0000 47 | 2/8
4 h-m-p 0.0003 0.1103 26.0162 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 302.5482 ++ 613.351373 m 0.0001 77 | 3/8
6 h-m-p 0.0015 0.1358 22.8715 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 262.7663 ++ 610.689466 m 0.0000 108 | 4/8
8 h-m-p 0.0004 0.1768 19.6917 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 214.6833 ++ 609.346168 m 0.0000 139 | 5/8
10 h-m-p 0.0005 0.2634 13.7278 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 151.8697 ++ 608.785495 m 0.0000 170 | 6/8
12 h-m-p 0.5277 8.0000 0.0000 --Y 608.785495 0 0.0082 183 | 6/8
13 h-m-p 1.2782 8.0000 0.0000 ---Y 608.785495 0 0.0039 199
Out..
lnL = -608.785495
200 lfun, 200 eigenQcodon, 1200 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068843 0.106873 0.025751 0.087469 0.048730 0.076110 0.300105 0.637182 0.367073
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.168294
np = 9
lnL0 = -669.531701
Iterating by ming2
Initial: fx= 669.531701
x= 0.06884 0.10687 0.02575 0.08747 0.04873 0.07611 0.30010 0.63718 0.36707
1 h-m-p 0.0000 0.0002 349.5737 +++ 647.444949 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0005 227.9344 ++ 630.411143 m 0.0005 27 | 2/9
3 h-m-p 0.0000 0.0000 2165.1525 ++ 618.780669 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0002 244.4736 ++ 615.124757 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 62754.7095 ++ 611.520322 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 715925.8146 ++ 609.516130 m 0.0000 75 | 6/9
7 h-m-p 0.0040 0.0854 4.2860 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 150.3316 ++ 608.785471 m 0.0000 109 | 7/9
9 h-m-p 0.1642 8.0000 0.0000 +++ 608.785471 m 8.0000 122 | 7/9
10 h-m-p 0.0160 8.0000 0.0018 -------------.. | 7/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 608.785471 m 8.0000 164 | 7/9
12 h-m-p 0.0038 1.9149 0.3496 --------Y 608.785471 0 0.0000 186 | 7/9
13 h-m-p 0.0160 8.0000 0.0009 +++++ 608.785471 m 8.0000 203 | 7/9
14 h-m-p 0.0227 2.1886 0.3116 ---------Y 608.785471 0 0.0000 226 | 7/9
15 h-m-p 0.0160 8.0000 0.0005 +++++ 608.785470 m 8.0000 243 | 7/9
16 h-m-p 0.0126 2.1106 0.3223 ---------Y 608.785470 0 0.0000 266 | 7/9
17 h-m-p 0.0160 8.0000 0.0001 ---Y 608.785470 0 0.0001 283 | 7/9
18 h-m-p 0.0003 0.1274 2.5385 +++++ 608.785433 m 0.1274 300 | 8/9
19 h-m-p 1.0822 8.0000 0.0374 ++ 608.785420 m 8.0000 312 | 8/9
20 h-m-p 0.2884 8.0000 1.0364 -------------Y 608.785420 0 0.0000 338 | 8/9
21 h-m-p 0.0275 8.0000 0.0000 --Y 608.785420 0 0.0004 352 | 8/9
22 h-m-p 0.0283 8.0000 0.0000 ------------Y 608.785420 0 0.0000 377
Out..
lnL = -608.785420
378 lfun, 1134 eigenQcodon, 4536 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101363 0.089912 0.054706 0.103913 0.097061 0.041542 0.025300 1.321615 0.301220 0.149262 1.368496
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.680830
np = 11
lnL0 = -675.764459
Iterating by ming2
Initial: fx= 675.764459
x= 0.10136 0.08991 0.05471 0.10391 0.09706 0.04154 0.02530 1.32161 0.30122 0.14926 1.36850
1 h-m-p 0.0000 0.0003 305.8592 +++ 643.582753 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0003 224.5004 ++ 634.151758 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0000 8801.7686 ++ 619.327080 m 0.0000 45 | 3/11
4 h-m-p 0.0005 0.0027 15.0701 -----------.. | 3/11
5 h-m-p 0.0000 0.0001 287.4782 ++ 613.855754 m 0.0001 82 | 4/11
6 h-m-p 0.0016 0.0080 6.1054 -----------.. | 4/11
7 h-m-p 0.0000 0.0001 255.4896 ++ 610.539634 m 0.0001 119 | 5/11
8 h-m-p 0.0035 0.0266 3.0102 ------------.. | 5/11
9 h-m-p 0.0000 0.0000 211.9812 ++ 609.188610 m 0.0000 157 | 6/11
10 h-m-p 0.0154 7.6764 1.5609 -------------.. | 6/11
11 h-m-p 0.0000 0.0000 150.9254 ++ 608.785480 m 0.0000 196 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785480 m 8.0000 213 | 7/11
13 h-m-p 0.0923 8.0000 0.0004 ++++ 608.785480 m 8.0000 233 | 7/11
14 h-m-p 0.0000 0.0001 212.0842 -------C 608.785480 0 0.0000 258 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785480 m 8.0000 275 | 7/11
16 h-m-p 0.0247 8.0000 0.0012 +++++ 608.785480 m 8.0000 296 | 7/11
17 h-m-p 0.0142 0.2416 0.6495 -------C 608.785480 0 0.0000 321 | 7/11
18 h-m-p 0.0160 8.0000 0.0002 ---------Y 608.785480 0 0.0000 348 | 7/11
19 h-m-p 0.0160 8.0000 0.0001 +++++ 608.785480 m 8.0000 369 | 7/11
20 h-m-p 0.0032 1.5899 0.2928 ---------N 608.785480 0 0.0000 396 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 Y 608.785480 0 0.0040 414 | 7/11
22 h-m-p 0.0160 8.0000 0.0000 C 608.785480 0 0.0160 432 | 7/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 608.785480 m 8.0000 453 | 7/11
24 h-m-p 0.0160 8.0000 0.3583 -------C 608.785480 0 0.0000 478 | 7/11
25 h-m-p 0.0160 8.0000 0.0001 ---------Y 608.785480 0 0.0000 505 | 7/11
26 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785480 m 8.0000 555 | 7/11
28 h-m-p 0.0031 1.5317 0.6133 +++++ 608.785464 m 1.5317 576 | 8/11
29 h-m-p 1.3438 8.0000 0.6386 Y 608.785460 0 1.3438 594 | 8/11
30 h-m-p 1.6000 8.0000 0.0952 C 608.785460 0 1.4939 611 | 8/11
31 h-m-p 1.6000 8.0000 0.0089 Y 608.785460 0 1.2616 628 | 8/11
32 h-m-p 1.6000 8.0000 0.0001 ++ 608.785460 m 8.0000 645 | 8/11
33 h-m-p 0.0160 8.0000 0.1556 +++Y 608.785459 0 2.0165 665 | 8/11
34 h-m-p 1.6000 8.0000 0.0256 ++ 608.785457 m 8.0000 682 | 8/11
35 h-m-p 0.1687 8.0000 1.2142 ---------------.. | 8/11
36 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785457 m 8.0000 729 | 8/11
37 h-m-p 0.0271 8.0000 0.0037 +++++ 608.785457 m 8.0000 749 | 8/11
38 h-m-p 0.0264 8.0000 1.1325 -------------.. | 8/11
39 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785457 m 8.0000 794 | 8/11
40 h-m-p 0.0160 8.0000 0.0095 -------C 608.785457 0 0.0000 818 | 8/11
41 h-m-p 0.0160 8.0000 0.0000 -------Y 608.785457 0 0.0000 842 | 8/11
42 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785457 m 8.0000 862 | 8/11
43 h-m-p 0.0160 8.0000 0.3827 --------N 608.785457 0 0.0000 887 | 8/11
44 h-m-p 0.0160 8.0000 0.0004 +++++ 608.785457 m 8.0000 907 | 8/11
45 h-m-p 0.0160 8.0000 3.6168 ----------Y 608.785457 0 0.0000 934 | 8/11
46 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785457 m 8.0000 951 | 8/11
47 h-m-p 0.0160 8.0000 0.0758 +++++ 608.785454 m 8.0000 971 | 8/11
48 h-m-p 0.5026 8.0000 1.2063 ++ 608.785450 m 8.0000 988 | 8/11
49 h-m-p 1.6000 8.0000 0.0880 ++ 608.785450 m 8.0000 1002 | 8/11
50 h-m-p 0.9738 8.0000 0.7227 ++ 608.785450 m 8.0000 1019 | 8/11
51 h-m-p 0.0054 0.0761 1080.6664 ++ 608.785448 m 0.0761 1036 | 8/11
52 h-m-p 0.0367 0.1836 1112.1902 -----------C 608.785448 0 0.0000 1061 | 8/11
53 h-m-p 0.0002 0.0965 2115.0803 --------C 608.785448 0 0.0000 1083 | 8/11
54 h-m-p 0.0160 8.0000 0.0002 Y 608.785448 0 0.0160 1097 | 8/11
55 h-m-p 0.0160 8.0000 0.0003 ----Y 608.785448 0 0.0000 1118
Out..
lnL = -608.785448
1119 lfun, 4476 eigenQcodon, 20142 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -608.810662 S = -608.785955 -0.009487
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:06
did 20 / 50 patterns 0:06
did 30 / 50 patterns 0:06
did 40 / 50 patterns 0:06
did 50 / 50 patterns 0:07
Time used: 0:07
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.071043 0.097882 0.012329 0.048132 0.022110 0.041120 0.891602 0.933748 0.039668 0.649954 1.534760 2.727550
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 5.033291
np = 12
lnL0 = -651.202285
Iterating by ming2
Initial: fx= 651.202285
x= 0.07104 0.09788 0.01233 0.04813 0.02211 0.04112 0.89160 0.93375 0.03967 0.64995 1.53476 2.72755
1 h-m-p 0.0000 0.0001 341.2648 ++ 640.862575 m 0.0001 17 | 1/12
2 h-m-p 0.0004 0.0019 69.4059 ++ 632.709870 m 0.0019 32 | 2/12
3 h-m-p 0.0001 0.0003 300.1331 ++ 622.113110 m 0.0003 47 | 3/12
4 h-m-p 0.0002 0.0008 128.6355 ++ 618.823388 m 0.0008 62 | 4/12
5 h-m-p 0.0000 0.0000 5667.6243 ++ 612.321291 m 0.0000 77 | 5/12
6 h-m-p 0.0000 0.0000 12533.2017 ++ 609.835430 m 0.0000 92 | 6/12
7 h-m-p 0.0161 0.9616 3.9452 -------------.. | 6/12
8 h-m-p 0.0000 0.0000 150.0387 ++ 608.785480 m 0.0000 133 | 7/12
9 h-m-p 0.0358 8.0000 0.0000 ++++ 608.785480 m 8.0000 150 | 7/12
10 h-m-p 0.0160 8.0000 0.0057 +++++ 608.785479 m 8.0000 173 | 7/12
11 h-m-p 0.0085 1.3546 5.3417 ++++ 608.785451 m 1.3546 195 | 8/12
12 h-m-p 1.6000 8.0000 2.7115 ++ 608.785433 m 8.0000 210 | 8/12
13 h-m-p 1.6000 8.0000 6.3417 ++ 608.785425 m 8.0000 225 | 8/12
14 h-m-p 1.6000 8.0000 13.7448 ++ 608.785421 m 8.0000 240 | 8/12
15 h-m-p 0.2240 1.1200 27.4734 ++ 608.785421 m 1.1200 255 | 8/12
16 h-m-p -0.0000 -0.0000 224.4056
h-m-p: -0.00000000e+00 -0.00000000e+00 2.24405646e+02 608.785421
.. | 8/12
17 h-m-p 0.0160 8.0000 0.0000 C 608.785421 0 0.0160 282 | 8/12
18 h-m-p 0.0160 8.0000 0.0000 N 608.785421 0 0.0040 301
Out..
lnL = -608.785421
302 lfun, 1208 eigenQcodon, 5436 P(t)
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029601 0.050524 0.084745 0.104467 0.080190 0.033096 175.411201 1.108635 1.499719
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.162629
np = 9
lnL0 = -664.128616
Iterating by ming2
Initial: fx= 664.128616
x= 0.02960 0.05052 0.08475 0.10447 0.08019 0.03310 175.41120 1.10863 1.49972
1 h-m-p 0.0000 0.0002 342.7865 +++ 639.311502 m 0.0002 15 | 1/9
2 h-m-p 0.0037 0.0639 17.3319 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 322.2256 ++ 636.800561 m 0.0000 49 | 2/9
4 h-m-p 0.0006 0.1020 10.9475 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 287.7798 ++ 626.672098 m 0.0001 82 | 3/9
6 h-m-p 0.0038 0.1416 7.9666 ------------.. | 3/9
7 h-m-p 0.0000 0.0002 251.9791 +++ 613.278491 m 0.0002 117 | 4/9
8 h-m-p 0.0128 0.3843 3.3502 -------------.. | 4/9
9 h-m-p 0.0000 0.0000 210.4737 ++ 611.868935 m 0.0000 152 | 5/9
10 h-m-p 0.0053 2.6327 1.4802 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 148.5344 ++ 608.785459 m 0.0001 186 | 6/9
12 h-m-p 0.1461 8.0000 0.0000 +++ 608.785459 m 8.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0041 +++++ 608.785459 m 8.0000 217 | 6/9
14 h-m-p 0.0432 8.0000 0.7633 ++++ 608.785453 m 8.0000 234 | 6/9
15 h-m-p 1.6000 8.0000 0.2634 ++ 608.785452 m 8.0000 249 | 6/9
16 h-m-p 0.6240 8.0000 3.3771 ++ 608.785452 m 8.0000 264 | 6/9
17 h-m-p 1.6000 8.0000 1.6688 -------------C 608.785452 0 0.0000 289 | 6/9
18 h-m-p 0.7881 8.0000 0.0000 --Y 608.785452 0 0.0123 303
Out..
lnL = -608.785452
304 lfun, 3344 eigenQcodon, 18240 P(t)
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018006 0.086891 0.027135 0.075919 0.072840 0.091526 175.341091 0.900000 1.161501 1.913484 1.299908
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.154647
np = 11
lnL0 = -661.960908
Iterating by ming2
Initial: fx= 661.960908
x= 0.01801 0.08689 0.02713 0.07592 0.07284 0.09153 175.34109 0.90000 1.16150 1.91348 1.29991
1 h-m-p 0.0000 0.0001 335.3040 ++ 647.331692 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 113.7223 ++ 640.108063 m 0.0007 30 | 2/11
3 h-m-p 0.0002 0.0008 187.4164 ++ 613.274866 m 0.0008 44 | 3/11
4 h-m-p 0.0002 0.0012 29.4470 ++ 612.876406 m 0.0012 58 | 4/11
5 h-m-p 0.0000 0.0002 617.6369 ++ 610.085568 m 0.0002 72 | 5/11
6 h-m-p 0.0000 0.0001 5906.1800 ++ 608.785444 m 0.0001 86 | 6/11
7 h-m-p 1.6000 8.0000 0.0007 ++ 608.785444 m 8.0000 100 | 6/11
8 h-m-p 0.0067 1.2059 0.8066 ------------.. | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 608.785444 m 8.0000 151 | 6/11
10 h-m-p 0.0028 1.4192 0.4138 +++++ 608.785433 m 1.4192 173 | 7/11
11 h-m-p 0.4441 8.0000 0.3961 +++ 608.785425 m 8.0000 193 | 7/11
12 h-m-p 1.6000 8.0000 0.7713 ++ 608.785422 m 8.0000 211 | 7/11
13 h-m-p 0.6879 3.4393 1.8339 +
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
+ 608.785421 m 3.4393 229
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p 0.0000 0.0000 1.1835
h-m-p: 5.73605733e-18 2.86802866e-17 1.18349517e+00 608.785421
..
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
C 608.785421 0 0.0000 259
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46132, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46093, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
C 608.785421 0 0.0001 280
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -608.785421
281 lfun, 3372 eigenQcodon, 18546 P(t)
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -608.782612 S = -608.781949 -0.000290
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:18
did 20 / 50 patterns 0:18
did 30 / 50 patterns 0:18
did 40 / 50 patterns 0:18
did 50 / 50 patterns 0:18
QuantileBeta(0.85, 5.46113, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
NC_011896_1_WP_010908671_1_2144_MLBR_RS10185 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
NC_002677_1_NP_302351_1_1223_ML2010 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA
**************************************************
NC_011896_1_WP_010908671_1_2144_MLBR_RS10185 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
NC_002677_1_NP_302351_1_1223_ML2010 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310 VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN
**************************************************
NC_011896_1_WP_010908671_1_2144_MLBR_RS10185 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
NC_002677_1_NP_302351_1_1223_ML2010 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310 KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV
**************************************************
NC_011896_1_WP_010908671_1_2144_MLBR_RS10185 PRS
NC_002677_1_NP_302351_1_1223_ML2010 PRS
NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065 PRS
NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460 PRS
NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010 PRS
NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310 PRS
***
>NC_011896_1_WP_010908671_1_2144_MLBR_RS10185 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG CCGCGGTCC >NC_002677_1_NP_302351_1_1223_ML2010 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG CCGCGGTCC >NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG CCGCGGTCC >NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG CCGCGGTCC >NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG CCGCGGTCC >NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310 ATGTGGTTGACAGCAGCACCTGCTGCGGCGAGATTTGTCGTTGCGAGTGT GATAGCTGCGAGTTGCGCTGCGTCGACGGGTGTTGCCGGCGCCGATCCGC AGTCGCCGTCTGCACCGAAGACAACCATCGACCACGATGGCACATATGCG GTGGGAACCGATATCGCGCCCGGCACGTACAGCTCCGCCGGACCTGTCGG CAACGGGACATGTTATTGGAAGCGGATCGACAACCCCGATGGCCCTATCG ATAACGCCATGAGCAAAAAGCCGAAGATTGTGCAGATTGAAGCGAGTAAC AAAGCATTCAAGACCACCGGCTGCCAGCCCTGGCAGCAAACGAGTAACAC CACCGTATCAACGGATCTCCCCGGGCCGATCGCAGGAATCCAACTGGAAA GCAATCTCGGGATCCTCAATGGGCTGCTCGCCTCAAACGGCCAGCAAGTG CCGCGGTCC
>NC_011896_1_WP_010908671_1_2144_MLBR_RS10185 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV PRS >NC_002677_1_NP_302351_1_1223_ML2010 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV PRS >NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV PRS >NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV PRS >NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV PRS >NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310 MWLTAAPAAARFVVASVIAASCAASTGVAGADPQSPSAPKTTIDHDGTYA VGTDIAPGTYSSAGPVGNGTCYWKRIDNPDGPIDNAMSKKPKIVQIEASN KAFKTTGCQPWQQTSNTTVSTDLPGPIAGIQLESNLGILNGLLASNGQQV PRS
#NEXUS
[ID: 5493547137]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908671_1_2144_MLBR_RS10185
NC_002677_1_NP_302351_1_1223_ML2010
NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065
NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460
NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010
NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908671_1_2144_MLBR_RS10185,
2 NC_002677_1_NP_302351_1_1223_ML2010,
3 NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065,
4 NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460,
5 NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010,
6 NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06623242,2:0.07434257,3:0.06974241,4:0.06852385,5:0.06604131,6:0.06483324);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06623242,2:0.07434257,3:0.06974241,4:0.06852385,5:0.06604131,6:0.06483324);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -627.18 -631.12
2 -627.22 -629.51
--------------------------------------
TOTAL -627.20 -630.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888361 0.090530 0.342836 1.479037 0.863685 751.00 751.00 1.000
r(A<->C){all} 0.193055 0.025282 0.000174 0.524495 0.152426 39.35 56.82 1.000
r(A<->G){all} 0.150560 0.016257 0.000028 0.409664 0.116375 43.43 90.02 1.000
r(A<->T){all} 0.159005 0.019734 0.000111 0.456692 0.120616 80.35 142.32 1.013
r(C<->G){all} 0.184289 0.024069 0.000097 0.500157 0.144644 57.67 100.13 1.008
r(C<->T){all} 0.161776 0.019158 0.000251 0.442994 0.122052 25.66 71.95 1.004
r(G<->T){all} 0.151315 0.016023 0.000095 0.397249 0.114873 93.36 189.67 1.020
pi(A){all} 0.240276 0.000388 0.203969 0.281146 0.239585 584.34 667.67 1.000
pi(C){all} 0.299558 0.000441 0.259934 0.341155 0.298652 751.00 751.00 1.000
pi(G){all} 0.291989 0.000438 0.253645 0.334228 0.291471 593.08 666.61 1.000
pi(T){all} 0.168177 0.000295 0.135104 0.201422 0.167685 591.79 632.99 0.999
alpha{1,2} 0.448899 0.234757 0.000182 1.487835 0.266943 266.31 407.80 1.004
alpha{3} 0.453577 0.276592 0.000291 1.478553 0.283038 362.78 447.61 1.000
pinvar{all} 0.996494 0.000016 0.989182 0.999993 0.997817 414.96 498.16 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2010/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 153
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 4 4 4 4 4 4 | CCC 4 4 4 4 4 4 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 6 6 6 6 6 6 | CAG 5 5 5 5 5 5 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 2 2 2 | Ser AGT 4 4 4 4 4 4
ATC 7 7 7 7 7 7 | ACC 6 6 6 6 6 6 | AAC 6 6 6 6 6 6 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 4 4 4 4 4 4 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 2 2 2 2 2 2 | ACG 4 4 4 4 4 4 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 6 6 6 6 6 6 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 5 5 5 5 5 5 | GAC 2 2 2 2 2 2 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 5 5 5 5 5 5 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 4 4 4 4 4 4 | GCG 8 8 8 8 8 8 | GAG 0 0 0 0 0 0 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908671_1_2144_MLBR_RS10185
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
#2: NC_002677_1_NP_302351_1_1223_ML2010
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
#3: NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
#4: NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
#5: NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
#6: NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 6 | TCC 12 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 0
CTC 24 | CCC 24 | CAC 6 | CGC 0
CTA 0 | CCA 0 | Gln Q CAA 18 | CGA 0
CTG 12 | CCG 36 | CAG 30 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 12 | Ser S AGT 24
ATC 42 | ACC 36 | AAC 36 | AGC 18
ATA 6 | ACA 24 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 12 | ACG 24 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 18 | Asp D GAT 36 | Gly G GGT 6
GTC 12 | GCC 30 | GAC 12 | GGC 42
GTA 6 | GCA 30 | Glu E GAA 12 | GGA 18
GTG 24 | GCG 48 | GAG 0 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12418 C:0.19608 A:0.32026 G:0.35948
position 2: T:0.19608 C:0.35948 A:0.24183 G:0.20261
position 3: T:0.18301 C:0.34641 A:0.15686 G:0.31373
Average T:0.16776 C:0.30065 A:0.23965 G:0.29194
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -608.785495 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300105 1.299908
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908671_1_2144_MLBR_RS10185: 0.000004, NC_002677_1_NP_302351_1_1223_ML2010: 0.000004, NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065: 0.000004, NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460: 0.000004, NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010: 0.000004, NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30010
omega (dN/dS) = 1.29991
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 342.3 116.7 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 342.3 116.7 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 342.3 116.7 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 342.3 116.7 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 342.3 116.7 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 342.3 116.7 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -608.785420 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.025300 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908671_1_2144_MLBR_RS10185: 0.000004, NC_002677_1_NP_302351_1_1223_ML2010: 0.000004, NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065: 0.000004, NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460: 0.000004, NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010: 0.000004, NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.02530
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 345.4 113.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 345.4 113.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 345.4 113.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 345.4 113.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 345.4 113.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 345.4 113.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -608.785448 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.891602 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908671_1_2144_MLBR_RS10185: 0.000004, NC_002677_1_NP_302351_1_1223_ML2010: 0.000004, NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065: 0.000004, NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460: 0.000004, NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010: 0.000004, NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.89160
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 337.7 121.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 337.7 121.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 337.7 121.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 337.7 121.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 337.7 121.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 337.7 121.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908671_1_2144_MLBR_RS10185)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.100 0.100 0.100 0.099 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -608.785421 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 175.411201 0.000000 0.000000 0.000001 0.000001 21.962771
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908671_1_2144_MLBR_RS10185: 0.000004, NC_002677_1_NP_302351_1_1223_ML2010: 0.000004, NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065: 0.000004, NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460: 0.000004, NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010: 0.000004, NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 175.41120
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 0.00000 21.96277
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.8 138.2 21.9628 0.0000 0.0000 0.0 0.0
7..2 0.000 320.8 138.2 21.9628 0.0000 0.0000 0.0 0.0
7..3 0.000 320.8 138.2 21.9628 0.0000 0.0000 0.0 0.0
7..4 0.000 320.8 138.2 21.9628 0.0000 0.0000 0.0 0.0
7..5 0.000 320.8 138.2 21.9628 0.0000 0.0000 0.0 0.0
7..6 0.000 320.8 138.2 21.9628 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908671_1_2144_MLBR_RS10185)
Pr(w>1) post mean +- SE for w
1 M 1.000** 21.963
2 W 1.000** 21.963
3 L 1.000** 21.963
4 T 1.000** 21.963
5 A 1.000** 21.963
6 A 1.000** 21.963
7 P 1.000** 21.963
8 A 1.000** 21.963
9 A 1.000** 21.963
10 A 1.000** 21.963
11 R 1.000** 21.963
12 F 1.000** 21.963
13 V 1.000** 21.963
14 V 1.000** 21.963
15 A 1.000** 21.963
16 S 1.000** 21.963
17 V 1.000** 21.963
18 I 1.000** 21.963
19 A 1.000** 21.963
20 A 1.000** 21.963
21 S 1.000** 21.963
22 C 1.000** 21.963
23 A 1.000** 21.963
24 A 1.000** 21.963
25 S 1.000** 21.963
26 T 1.000** 21.963
27 G 1.000** 21.963
28 V 1.000** 21.963
29 A 1.000** 21.963
30 G 1.000** 21.963
31 A 1.000** 21.963
32 D 1.000** 21.963
33 P 1.000** 21.963
34 Q 1.000** 21.963
35 S 1.000** 21.963
36 P 1.000** 21.963
37 S 1.000** 21.963
38 A 1.000** 21.963
39 P 1.000** 21.963
40 K 1.000** 21.963
41 T 1.000** 21.963
42 T 1.000** 21.963
43 I 1.000** 21.963
44 D 1.000** 21.963
45 H 1.000** 21.963
46 D 1.000** 21.963
47 G 1.000** 21.963
48 T 1.000** 21.963
49 Y 1.000** 21.963
50 A 1.000** 21.963
51 V 1.000** 21.963
52 G 1.000** 21.963
53 T 1.000** 21.963
54 D 1.000** 21.963
55 I 1.000** 21.963
56 A 1.000** 21.963
57 P 1.000** 21.963
58 G 1.000** 21.963
59 T 1.000** 21.963
60 Y 1.000** 21.963
61 S 1.000** 21.963
62 S 1.000** 21.963
63 A 1.000** 21.963
64 G 1.000** 21.963
65 P 1.000** 21.963
66 V 1.000** 21.963
67 G 1.000** 21.963
68 N 1.000** 21.963
69 G 1.000** 21.963
70 T 1.000** 21.963
71 C 1.000** 21.963
72 Y 1.000** 21.963
73 W 1.000** 21.963
74 K 1.000** 21.963
75 R 1.000** 21.963
76 I 1.000** 21.963
77 D 1.000** 21.963
78 N 1.000** 21.963
79 P 1.000** 21.963
80 D 1.000** 21.963
81 G 1.000** 21.963
82 P 1.000** 21.963
83 I 1.000** 21.963
84 D 1.000** 21.963
85 N 1.000** 21.963
86 A 1.000** 21.963
87 M 1.000** 21.963
88 S 1.000** 21.963
89 K 1.000** 21.963
90 K 1.000** 21.963
91 P 1.000** 21.963
92 K 1.000** 21.963
93 I 1.000** 21.963
94 V 1.000** 21.963
95 Q 1.000** 21.963
96 I 1.000** 21.963
97 E 1.000** 21.963
98 A 1.000** 21.963
99 S 1.000** 21.963
100 N 1.000** 21.963
101 K 1.000** 21.963
102 A 1.000** 21.963
103 F 1.000** 21.963
104 K 1.000** 21.963
105 T 1.000** 21.963
106 T 1.000** 21.963
107 G 1.000** 21.963
108 C 1.000** 21.963
109 Q 1.000** 21.963
110 P 1.000** 21.963
111 W 1.000** 21.963
112 Q 1.000** 21.963
113 Q 1.000** 21.963
114 T 1.000** 21.963
115 S 1.000** 21.963
116 N 1.000** 21.963
117 T 1.000** 21.963
118 T 1.000** 21.963
119 V 1.000** 21.963
120 S 1.000** 21.963
121 T 1.000** 21.963
122 D 1.000** 21.963
123 L 1.000** 21.963
124 P 1.000** 21.963
125 G 1.000** 21.963
126 P 1.000** 21.963
127 I 1.000** 21.963
128 A 1.000** 21.963
129 G 1.000** 21.963
130 I 1.000** 21.963
131 Q 1.000** 21.963
132 L 1.000** 21.963
133 E 1.000** 21.963
134 S 1.000** 21.963
135 N 1.000** 21.963
136 L 1.000** 21.963
137 G 1.000** 21.963
138 I 1.000** 21.963
139 L 1.000** 21.963
140 N 1.000** 21.963
141 G 1.000** 21.963
142 L 1.000** 21.963
143 L 1.000** 21.963
144 A 1.000** 21.963
145 S 1.000** 21.963
146 N 1.000** 21.963
147 G 1.000** 21.963
148 Q 1.000** 21.963
149 Q 1.000** 21.963
150 V 1.000** 21.963
151 P 1.000** 21.963
152 R 1.000** 21.963
153 S 1.000** 21.963
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -608.785452 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 175.341091 31.499278 19.384863
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908671_1_2144_MLBR_RS10185: 0.000004, NC_002677_1_NP_302351_1_1223_ML2010: 0.000004, NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065: 0.000004, NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460: 0.000004, NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010: 0.000004, NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 175.34109
Parameters in M7 (beta):
p = 31.49928 q = 19.38486
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.50538 0.54843 0.57388 0.59406 0.61200 0.62917 0.64669 0.66588 0.68938 0.72732
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.8 138.2 0.6192 0.0000 0.0000 0.0 0.0
7..2 0.000 320.8 138.2 0.6192 0.0000 0.0000 0.0 0.0
7..3 0.000 320.8 138.2 0.6192 0.0000 0.0000 0.0 0.0
7..4 0.000 320.8 138.2 0.6192 0.0000 0.0000 0.0 0.0
7..5 0.000 320.8 138.2 0.6192 0.0000 0.0000 0.0 0.0
7..6 0.000 320.8 138.2 0.6192 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -608.785421 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 175.347474 0.000010 5.461126 0.005000 16.797926
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908671_1_2144_MLBR_RS10185: 0.000004, NC_002677_1_NP_302351_1_1223_ML2010: 0.000004, NZ_LVXE01000003_1_WP_010908671_1_1270_A3216_RS02065: 0.000004, NZ_LYPH01000033_1_WP_010908671_1_1350_A8144_RS06460: 0.000004, NZ_CP029543_1_WP_010908671_1_2163_DIJ64_RS11010: 0.000004, NZ_AP014567_1_WP_010908671_1_2223_JK2ML_RS11310: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 175.34747
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 5.46113 q = 0.00500
(p1 = 0.99999) w = 16.79793
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 16.79793
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 320.8 138.2 16.7978 0.0000 0.0000 0.0 0.0
7..2 0.000 320.8 138.2 16.7978 0.0000 0.0000 0.0 0.0
7..3 0.000 320.8 138.2 16.7978 0.0000 0.0000 0.0 0.0
7..4 0.000 320.8 138.2 16.7978 0.0000 0.0000 0.0 0.0
7..5 0.000 320.8 138.2 16.7978 0.0000 0.0000 0.0 0.0
7..6 0.000 320.8 138.2 16.7978 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908671_1_2144_MLBR_RS10185)
Pr(w>1) post mean +- SE for w
1 M 1.000** 16.798
2 W 1.000** 16.798
3 L 1.000** 16.798
4 T 1.000** 16.798
5 A 1.000** 16.798
6 A 1.000** 16.798
7 P 1.000** 16.798
8 A 1.000** 16.798
9 A 1.000** 16.798
10 A 1.000** 16.798
11 R 1.000** 16.798
12 F 1.000** 16.798
13 V 1.000** 16.798
14 V 1.000** 16.798
15 A 1.000** 16.798
16 S 1.000** 16.798
17 V 1.000** 16.798
18 I 1.000** 16.798
19 A 1.000** 16.798
20 A 1.000** 16.798
21 S 1.000** 16.798
22 C 1.000** 16.798
23 A 1.000** 16.798
24 A 1.000** 16.798
25 S 1.000** 16.798
26 T 1.000** 16.798
27 G 1.000** 16.798
28 V 1.000** 16.798
29 A 1.000** 16.798
30 G 1.000** 16.798
31 A 1.000** 16.798
32 D 1.000** 16.798
33 P 1.000** 16.798
34 Q 1.000** 16.798
35 S 1.000** 16.798
36 P 1.000** 16.798
37 S 1.000** 16.798
38 A 1.000** 16.798
39 P 1.000** 16.798
40 K 1.000** 16.798
41 T 1.000** 16.798
42 T 1.000** 16.798
43 I 1.000** 16.798
44 D 1.000** 16.798
45 H 1.000** 16.798
46 D 1.000** 16.798
47 G 1.000** 16.798
48 T 1.000** 16.798
49 Y 1.000** 16.798
50 A 1.000** 16.798
51 V 1.000** 16.798
52 G 1.000** 16.798
53 T 1.000** 16.798
54 D 1.000** 16.798
55 I 1.000** 16.798
56 A 1.000** 16.798
57 P 1.000** 16.798
58 G 1.000** 16.798
59 T 1.000** 16.798
60 Y 1.000** 16.798
61 S 1.000** 16.798
62 S 1.000** 16.798
63 A 1.000** 16.798
64 G 1.000** 16.798
65 P 1.000** 16.798
66 V 1.000** 16.798
67 G 1.000** 16.798
68 N 1.000** 16.798
69 G 1.000** 16.798
70 T 1.000** 16.798
71 C 1.000** 16.798
72 Y 1.000** 16.798
73 W 1.000** 16.798
74 K 1.000** 16.798
75 R 1.000** 16.798
76 I 1.000** 16.798
77 D 1.000** 16.798
78 N 1.000** 16.798
79 P 1.000** 16.798
80 D 1.000** 16.798
81 G 1.000** 16.798
82 P 1.000** 16.798
83 I 1.000** 16.798
84 D 1.000** 16.798
85 N 1.000** 16.798
86 A 1.000** 16.798
87 M 1.000** 16.798
88 S 1.000** 16.798
89 K 1.000** 16.798
90 K 1.000** 16.798
91 P 1.000** 16.798
92 K 1.000** 16.798
93 I 1.000** 16.798
94 V 1.000** 16.798
95 Q 1.000** 16.798
96 I 1.000** 16.798
97 E 1.000** 16.798
98 A 1.000** 16.798
99 S 1.000** 16.798
100 N 1.000** 16.798
101 K 1.000** 16.798
102 A 1.000** 16.798
103 F 1.000** 16.798
104 K 1.000** 16.798
105 T 1.000** 16.798
106 T 1.000** 16.798
107 G 1.000** 16.798
108 C 1.000** 16.798
109 Q 1.000** 16.798
110 P 1.000** 16.798
111 W 1.000** 16.798
112 Q 1.000** 16.798
113 Q 1.000** 16.798
114 T 1.000** 16.798
115 S 1.000** 16.798
116 N 1.000** 16.798
117 T 1.000** 16.798
118 T 1.000** 16.798
119 V 1.000** 16.798
120 S 1.000** 16.798
121 T 1.000** 16.798
122 D 1.000** 16.798
123 L 1.000** 16.798
124 P 1.000** 16.798
125 G 1.000** 16.798
126 P 1.000** 16.798
127 I 1.000** 16.798
128 A 1.000** 16.798
129 G 1.000** 16.798
130 I 1.000** 16.798
131 Q 1.000** 16.798
132 L 1.000** 16.798
133 E 1.000** 16.798
134 S 1.000** 16.798
135 N 1.000** 16.798
136 L 1.000** 16.798
137 G 1.000** 16.798
138 I 1.000** 16.798
139 L 1.000** 16.798
140 N 1.000** 16.798
141 G 1.000** 16.798
142 L 1.000** 16.798
143 L 1.000** 16.798
144 A 1.000** 16.798
145 S 1.000** 16.798
146 N 1.000** 16.798
147 G 1.000** 16.798
148 Q 1.000** 16.798
149 Q 1.000** 16.798
150 V 1.000** 16.798
151 P 1.000** 16.798
152 R 1.000** 16.798
153 S 1.000** 16.798
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908671_1_2144_MLBR_RS10185)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:18
Model 1: NearlyNeutral -608.78542 Model 2: PositiveSelection -608.785448 Model 0: one-ratio -608.785495 Model 3: discrete -608.785421 Model 7: beta -608.785452 Model 8: beta&w>1 -608.785421 Model 0 vs 1 1.4999999984866008E-4 Model 2 vs 1 5.599999985861359E-5 Model 8 vs 7 6.199999984346505E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
