--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:46:30 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2012/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -570.36 -572.68
2 -570.40 -574.21
--------------------------------------
TOTAL -570.38 -573.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897527 0.085006 0.365387 1.472430 0.872662 723.83 737.41 1.000
r(A<->C){all} 0.173044 0.020027 0.000029 0.448808 0.138304 36.06 58.08 1.010
r(A<->G){all} 0.159232 0.017567 0.000355 0.432440 0.125097 65.99 151.16 1.037
r(A<->T){all} 0.157080 0.018241 0.000126 0.434739 0.115238 80.11 86.56 1.003
r(C<->G){all} 0.186149 0.020859 0.000038 0.473758 0.158134 89.78 109.15 1.009
r(C<->T){all} 0.164531 0.020024 0.000042 0.438922 0.126295 66.27 73.29 0.999
r(G<->T){all} 0.159963 0.017044 0.000008 0.420360 0.127102 96.82 118.40 1.002
pi(A){all} 0.166453 0.000348 0.130794 0.205748 0.166158 424.08 505.02 1.002
pi(C){all} 0.253229 0.000440 0.214434 0.294664 0.252702 470.23 575.03 1.000
pi(G){all} 0.300141 0.000510 0.253950 0.342913 0.299573 559.93 655.47 0.999
pi(T){all} 0.280177 0.000495 0.238935 0.324266 0.279563 615.94 618.61 1.000
alpha{1,2} 0.392802 0.196383 0.000744 1.312228 0.222128 306.99 425.03 0.999
alpha{3} 0.451219 0.238381 0.000156 1.437551 0.288856 440.69 478.81 0.999
pinvar{all} 0.996114 0.000021 0.987654 0.999999 0.997621 629.43 635.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -537.985006
Model 2: PositiveSelection -537.985006
Model 0: one-ratio -537.985234
Model 3: discrete -537.985214
Model 7: beta -537.985057
Model 8: beta&w>1 -537.985211
Model 0 vs 1 4.5599999998557905E-4
Model 2 vs 1 0.0
Model 8 vs 7 3.0800000013186946E-4
>C1
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C2
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C3
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C4
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C5
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C6
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=139
C1 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C2 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C3 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C4 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C5 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C6 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
**************************************************
C1 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C2 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C3 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C4 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C5 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C6 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
**************************************************
C1 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C2 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C3 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C4 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C5 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C6 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
***************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 139 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 139 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4170]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4170]--->[4170]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.459 Mb, Max= 30.666 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C2 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C3 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C4 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C5 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
C6 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
**************************************************
C1 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C2 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C3 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C4 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C5 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
C6 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
**************************************************
C1 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C2 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C3 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C4 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C5 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
C6 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
***************************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
C2 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
C3 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
C4 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
C5 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
C6 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
**************************************************
C1 CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
C2 CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
C3 CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
C4 CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
C5 CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
C6 CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
**************************************************
C1 TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
C2 TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
C3 TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
C4 TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
C5 TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
C6 TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
**************************************************
C1 GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
C2 GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
C3 GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
C4 GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
C5 GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
C6 GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
**************************************************
C1 GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
C2 GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
C3 GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
C4 GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
C5 GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
C6 GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
**************************************************
C1 ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
C2 ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
C3 ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
C4 ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
C5 ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
C6 ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
**************************************************
C1 TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
C2 TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
C3 TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
C4 TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
C5 TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
C6 TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
**************************************************
C1 CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
C2 CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
C3 CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
C4 CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
C5 CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
C6 CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
**************************************************
C1 GGCGCCGCACTTGCGAC
C2 GGCGCCGCACTTGCGAC
C3 GGCGCCGCACTTGCGAC
C4 GGCGCCGCACTTGCGAC
C5 GGCGCCGCACTTGCGAC
C6 GGCGCCGCACTTGCGAC
*****************
>C1
ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
GGCGCCGCACTTGCGAC
>C2
ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
GGCGCCGCACTTGCGAC
>C3
ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
GGCGCCGCACTTGCGAC
>C4
ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
GGCGCCGCACTTGCGAC
>C5
ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
GGCGCCGCACTTGCGAC
>C6
ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC
CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG
TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG
GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT
GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA
ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC
TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT
CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG
GGCGCCGCACTTGCGAC
>C1
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C2
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C3
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C4
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C5
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
>C6
MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 417 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855535
Setting output file names to "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 347351833
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5655843461
Seed = 532331260
Swapseed = 1579855535
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -933.265987 -- -24.965149
Chain 2 -- -933.265933 -- -24.965149
Chain 3 -- -933.265933 -- -24.965149
Chain 4 -- -933.265987 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -933.265987 -- -24.965149
Chain 2 -- -933.265987 -- -24.965149
Chain 3 -- -933.265987 -- -24.965149
Chain 4 -- -933.265933 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-933.266] (-933.266) (-933.266) (-933.266) * [-933.266] (-933.266) (-933.266) (-933.266)
500 -- (-580.888) [-588.016] (-582.404) (-582.596) * (-579.234) (-583.664) [-575.651] (-580.384) -- 0:16:39
1000 -- (-585.097) (-595.780) (-576.583) [-581.034] * [-577.302] (-584.179) (-578.096) (-580.896) -- 0:08:19
1500 -- (-578.850) (-582.654) [-577.542] (-576.865) * (-577.644) (-586.734) [-574.402] (-581.574) -- 0:05:32
2000 -- (-579.119) [-574.571] (-579.846) (-577.998) * (-580.763) (-579.616) (-581.053) [-579.780] -- 0:04:09
2500 -- (-581.799) (-578.928) (-583.500) [-581.370] * (-586.902) [-584.019] (-578.075) (-584.553) -- 0:03:19
3000 -- [-578.830] (-583.939) (-578.255) (-582.300) * (-582.053) [-581.345] (-580.074) (-581.262) -- 0:02:45
3500 -- [-581.739] (-575.687) (-581.512) (-587.707) * (-578.445) [-578.661] (-584.250) (-580.043) -- 0:02:21
4000 -- (-583.591) (-578.983) [-575.245] (-584.551) * (-583.027) (-584.961) [-573.690] (-577.576) -- 0:02:04
4500 -- (-580.522) (-584.746) [-578.928] (-576.197) * [-574.746] (-584.507) (-578.536) (-574.509) -- 0:01:50
5000 -- (-585.231) (-577.688) [-577.692] (-576.813) * (-580.958) [-577.321] (-586.038) (-585.654) -- 0:01:39
Average standard deviation of split frequencies: 0.057140
5500 -- (-579.505) [-581.165] (-575.809) (-576.372) * (-578.453) [-579.311] (-579.707) (-576.034) -- 0:01:29
6000 -- (-577.506) (-575.987) (-583.856) [-576.324] * (-587.679) (-574.561) (-580.023) [-579.550] -- 0:01:22
6500 -- (-584.143) [-585.419] (-583.213) (-586.529) * [-584.808] (-577.218) (-577.795) (-580.908) -- 0:01:15
7000 -- (-580.018) (-578.502) (-587.755) [-579.048] * (-584.830) (-586.765) [-580.077] (-580.904) -- 0:01:10
7500 -- (-580.067) [-574.194] (-584.766) (-573.825) * (-596.431) (-581.467) [-581.159] (-576.778) -- 0:01:05
8000 -- (-584.826) (-587.011) (-580.019) [-577.740] * [-582.334] (-582.080) (-584.198) (-578.765) -- 0:01:01
8500 -- (-582.299) (-584.042) (-579.150) [-583.291] * [-575.400] (-584.007) (-581.873) (-578.268) -- 0:00:57
9000 -- (-583.567) (-581.091) (-577.774) [-578.753] * (-578.558) (-578.081) (-583.703) [-577.840] -- 0:00:54
9500 -- (-577.964) (-592.242) (-581.873) [-578.544] * [-581.237] (-576.727) (-592.552) (-589.677) -- 0:00:51
10000 -- (-581.988) (-581.997) [-580.848] (-582.543) * (-577.100) [-579.230] (-572.323) (-575.107) -- 0:00:49
Average standard deviation of split frequencies: 0.054717
10500 -- (-582.589) (-583.789) (-575.025) [-577.076] * [-578.002] (-573.728) (-583.220) (-577.103) -- 0:00:46
11000 -- (-576.420) (-582.837) (-573.711) [-577.048] * (-579.477) [-577.163] (-583.887) (-582.889) -- 0:00:44
11500 -- (-589.692) (-576.277) (-579.513) [-575.423] * [-577.615] (-584.626) (-581.311) (-582.234) -- 0:00:42
12000 -- [-570.254] (-580.728) (-582.902) (-584.059) * (-587.374) (-585.454) [-580.751] (-578.959) -- 0:00:40
12500 -- (-570.609) [-576.677] (-581.877) (-579.669) * (-574.931) (-580.040) [-580.284] (-579.153) -- 0:00:39
13000 -- (-571.828) (-587.097) (-583.417) [-580.852] * [-578.155] (-592.521) (-586.224) (-580.281) -- 0:00:37
13500 -- (-570.441) (-579.404) [-577.822] (-581.515) * (-581.141) (-587.860) [-577.297] (-585.892) -- 0:00:36
14000 -- [-572.966] (-583.630) (-585.535) (-581.479) * (-585.126) (-576.600) [-580.061] (-578.995) -- 0:00:34
14500 -- (-570.799) (-576.043) (-573.859) [-578.459] * (-584.927) [-588.386] (-582.730) (-578.362) -- 0:00:33
15000 -- [-569.407] (-594.827) (-578.991) (-575.633) * (-580.965) [-576.775] (-592.988) (-576.949) -- 0:00:32
Average standard deviation of split frequencies: 0.033672
15500 -- (-569.474) (-583.448) (-580.367) [-580.706] * [-579.927] (-580.456) (-590.909) (-581.149) -- 0:01:02
16000 -- (-570.562) [-578.471] (-582.227) (-586.455) * (-591.308) [-581.906] (-579.431) (-581.221) -- 0:01:00
16500 -- [-570.310] (-582.880) (-583.240) (-575.540) * [-575.685] (-583.349) (-569.896) (-582.339) -- 0:00:58
17000 -- (-572.675) (-582.321) (-578.649) [-574.610] * [-579.164] (-580.424) (-569.518) (-591.282) -- 0:00:56
17500 -- (-574.038) (-582.975) (-579.569) [-575.035] * [-578.345] (-581.325) (-569.274) (-581.156) -- 0:00:55
18000 -- (-571.918) (-578.792) [-581.685] (-580.321) * (-576.097) (-576.041) (-570.397) [-574.966] -- 0:00:53
18500 -- (-572.128) [-579.829] (-582.558) (-580.449) * (-581.523) (-579.735) (-569.937) [-577.127] -- 0:00:52
19000 -- (-571.349) (-579.813) (-578.174) [-580.005] * (-587.957) (-580.640) [-572.094] (-577.654) -- 0:00:50
19500 -- (-571.393) (-577.863) [-579.691] (-582.521) * (-576.562) (-587.014) [-572.120] (-580.273) -- 0:00:49
20000 -- (-570.015) (-577.937) (-582.466) [-580.536] * (-578.935) (-577.295) [-574.342] (-578.071) -- 0:00:48
Average standard deviation of split frequencies: 0.040818
20500 -- (-574.388) (-579.467) (-582.061) [-584.234] * (-581.191) (-577.367) [-573.384] (-582.147) -- 0:00:46
21000 -- [-574.877] (-582.735) (-580.099) (-579.555) * (-581.531) [-578.806] (-569.962) (-586.338) -- 0:00:45
21500 -- (-575.998) (-577.296) (-577.441) [-576.461] * (-580.548) (-579.516) [-569.407] (-577.082) -- 0:00:44
22000 -- (-573.463) (-581.495) [-577.267] (-574.681) * [-580.776] (-574.065) (-571.262) (-581.830) -- 0:00:43
22500 -- (-570.247) (-586.318) [-579.119] (-580.123) * [-585.626] (-582.106) (-574.132) (-582.569) -- 0:00:42
23000 -- (-570.862) (-583.380) (-582.711) [-583.920] * (-581.654) (-581.620) [-572.022] (-581.094) -- 0:00:41
23500 -- (-576.845) (-583.325) [-590.424] (-580.589) * (-585.697) [-584.527] (-571.375) (-571.147) -- 0:00:40
24000 -- (-574.447) (-582.798) [-575.620] (-583.299) * [-572.060] (-575.369) (-571.516) (-571.713) -- 0:00:39
24500 -- (-573.392) (-581.769) [-582.345] (-582.922) * [-573.520] (-584.236) (-573.031) (-569.490) -- 0:00:38
25000 -- (-571.090) [-578.627] (-575.325) (-579.259) * (-574.389) [-578.221] (-569.414) (-569.730) -- 0:00:38
Average standard deviation of split frequencies: 0.040992
25500 -- (-571.328) (-580.827) [-574.443] (-587.715) * [-575.243] (-574.522) (-569.571) (-571.413) -- 0:00:37
26000 -- (-569.523) (-579.813) [-575.756] (-577.407) * [-571.076] (-580.800) (-571.125) (-573.903) -- 0:00:36
26500 -- (-572.956) (-583.324) [-583.207] (-578.677) * (-575.793) (-578.695) (-570.645) [-570.205] -- 0:00:35
27000 -- (-571.879) (-578.456) [-577.199] (-579.992) * (-572.394) (-582.924) (-571.292) [-571.100] -- 0:00:35
27500 -- (-574.025) (-581.199) (-579.282) [-583.598] * (-571.762) (-580.021) [-571.232] (-575.846) -- 0:00:34
28000 -- (-573.301) (-585.411) [-574.702] (-591.487) * [-569.417] (-578.232) (-575.270) (-572.060) -- 0:00:33
28500 -- (-572.564) (-572.569) [-578.382] (-571.568) * (-574.029) [-578.517] (-571.870) (-571.645) -- 0:00:33
29000 -- (-573.691) (-579.142) (-581.632) [-570.864] * (-579.216) (-582.024) [-569.882] (-570.525) -- 0:00:32
29500 -- (-574.609) [-574.287] (-577.846) (-569.734) * (-570.856) (-580.867) (-573.152) [-569.912] -- 0:00:31
30000 -- [-569.927] (-585.622) (-578.774) (-574.143) * [-570.240] (-580.874) (-569.163) (-572.481) -- 0:00:31
Average standard deviation of split frequencies: 0.037216
30500 -- (-569.620) (-584.889) (-574.881) [-570.816] * (-569.287) [-576.556] (-569.875) (-570.808) -- 0:00:30
31000 -- (-571.171) (-578.589) (-577.749) [-572.084] * (-569.123) [-574.539] (-576.799) (-570.902) -- 0:00:45
31500 -- (-570.203) [-585.430] (-588.532) (-571.337) * (-571.613) (-584.187) (-569.044) [-574.022] -- 0:00:44
32000 -- (-569.414) (-583.517) [-578.226] (-570.873) * (-569.849) [-574.323] (-571.383) (-571.589) -- 0:00:43
32500 -- (-569.528) [-578.985] (-581.094) (-569.465) * (-571.309) [-577.991] (-571.264) (-570.215) -- 0:00:43
33000 -- (-569.315) (-572.631) [-576.485] (-576.933) * (-569.603) (-582.587) [-570.751] (-572.443) -- 0:00:42
33500 -- (-569.772) (-576.717) [-577.878] (-569.611) * (-576.450) [-581.034] (-571.961) (-569.418) -- 0:00:41
34000 -- (-571.387) [-575.448] (-585.126) (-570.316) * (-572.469) (-584.973) (-570.263) [-570.061] -- 0:00:41
34500 -- [-571.541] (-579.785) (-577.574) (-570.030) * (-571.743) (-590.490) (-571.386) [-573.148] -- 0:00:40
35000 -- [-573.609] (-582.126) (-576.764) (-569.885) * (-570.743) [-581.609] (-570.096) (-568.984) -- 0:00:39
Average standard deviation of split frequencies: 0.034295
35500 -- (-572.140) (-580.523) [-573.579] (-570.047) * (-572.901) (-598.309) (-574.235) [-569.374] -- 0:00:39
36000 -- (-573.578) (-575.242) (-580.588) [-570.413] * (-570.364) [-581.830] (-571.957) (-570.178) -- 0:00:38
36500 -- [-569.269] (-576.260) (-584.755) (-569.445) * [-570.023] (-577.010) (-574.685) (-576.386) -- 0:00:38
37000 -- (-569.100) (-582.130) [-585.828] (-571.318) * (-572.165) [-583.893] (-570.875) (-570.613) -- 0:00:37
37500 -- (-571.947) (-576.697) [-579.762] (-571.374) * [-570.785] (-580.640) (-574.851) (-573.084) -- 0:00:37
38000 -- (-569.973) (-581.604) (-577.139) [-572.129] * (-569.641) (-585.879) [-572.064] (-574.461) -- 0:00:36
38500 -- (-572.112) (-584.077) (-575.866) [-569.595] * (-573.660) (-575.982) (-570.484) [-570.111] -- 0:00:35
39000 -- (-570.778) (-582.572) [-575.570] (-569.818) * (-570.668) (-572.320) (-569.029) [-570.492] -- 0:00:35
39500 -- (-571.513) [-577.397] (-581.732) (-570.654) * [-572.010] (-571.062) (-570.621) (-578.001) -- 0:00:34
40000 -- (-574.288) [-579.405] (-578.800) (-569.972) * [-573.642] (-571.739) (-570.112) (-573.322) -- 0:00:34
Average standard deviation of split frequencies: 0.033617
40500 -- (-575.061) (-582.748) (-575.956) [-570.093] * (-573.929) (-579.965) [-570.144] (-571.941) -- 0:00:34
41000 -- [-570.806] (-575.054) (-577.241) (-572.388) * (-569.759) [-572.186] (-569.375) (-571.127) -- 0:00:33
41500 -- [-571.964] (-581.899) (-577.113) (-572.659) * (-571.724) (-569.693) [-569.733] (-570.228) -- 0:00:33
42000 -- [-569.405] (-582.636) (-577.487) (-572.468) * (-571.148) (-569.439) (-570.415) [-570.566] -- 0:00:32
42500 -- [-570.348] (-585.407) (-587.042) (-571.474) * (-575.907) (-576.005) [-573.827] (-571.054) -- 0:00:32
43000 -- [-569.625] (-576.286) (-573.838) (-569.844) * [-570.374] (-570.339) (-571.348) (-570.131) -- 0:00:31
43500 -- (-570.209) (-572.799) (-581.401) [-572.677] * (-571.893) (-569.086) [-569.862] (-573.054) -- 0:00:31
44000 -- (-571.804) (-569.926) [-580.026] (-570.388) * (-572.951) [-574.437] (-572.740) (-571.409) -- 0:00:31
44500 -- (-569.709) [-570.710] (-581.750) (-570.976) * (-572.142) [-571.695] (-577.102) (-569.986) -- 0:00:30
45000 -- [-570.230] (-572.112) (-580.788) (-570.897) * [-573.493] (-569.636) (-570.898) (-571.008) -- 0:00:30
Average standard deviation of split frequencies: 0.038197
45500 -- (-576.343) [-569.138] (-580.186) (-573.979) * (-577.881) (-570.393) [-573.006] (-569.626) -- 0:00:29
46000 -- (-572.463) (-573.457) (-579.895) [-569.307] * [-572.684] (-571.620) (-574.364) (-571.677) -- 0:00:39
46500 -- (-568.651) [-571.126] (-589.584) (-570.792) * [-570.784] (-572.250) (-571.332) (-569.525) -- 0:00:39
47000 -- [-569.210] (-575.457) (-577.221) (-569.455) * (-576.366) [-575.518] (-569.048) (-570.946) -- 0:00:38
47500 -- (-570.997) (-572.775) [-577.103] (-571.922) * (-571.275) [-572.570] (-569.717) (-570.489) -- 0:00:38
48000 -- (-571.483) (-571.318) (-576.220) [-570.097] * (-571.233) (-575.878) (-573.354) [-570.793] -- 0:00:37
48500 -- (-574.932) (-570.207) [-577.798] (-569.369) * (-572.415) (-571.995) [-574.812] (-570.996) -- 0:00:37
49000 -- (-571.419) (-573.151) [-578.550] (-570.572) * (-571.117) (-574.683) [-572.794] (-571.413) -- 0:00:36
49500 -- [-570.479] (-571.427) (-583.795) (-573.095) * [-571.459] (-570.581) (-573.112) (-576.460) -- 0:00:36
50000 -- (-570.144) (-569.784) [-579.138] (-569.441) * (-573.914) [-570.786] (-576.400) (-570.291) -- 0:00:36
Average standard deviation of split frequencies: 0.036286
50500 -- (-570.407) [-570.684] (-580.615) (-571.229) * [-570.019] (-571.143) (-573.813) (-570.162) -- 0:00:35
51000 -- (-573.460) (-570.295) (-588.577) [-570.195] * (-574.508) (-571.457) [-570.359] (-569.558) -- 0:00:35
51500 -- (-572.730) (-575.712) (-574.724) [-569.568] * (-571.026) (-570.676) [-570.503] (-570.401) -- 0:00:34
52000 -- (-569.890) (-571.265) (-573.302) [-569.487] * [-572.183] (-569.228) (-576.389) (-569.779) -- 0:00:34
52500 -- (-568.847) (-571.727) (-571.629) [-569.944] * [-569.929] (-571.538) (-571.588) (-571.504) -- 0:00:34
53000 -- (-569.024) [-571.860] (-570.625) (-569.722) * (-570.365) [-570.700] (-569.428) (-569.838) -- 0:00:33
53500 -- (-572.901) (-570.986) (-573.659) [-569.418] * [-570.347] (-573.189) (-571.385) (-570.150) -- 0:00:33
54000 -- (-571.191) (-572.703) [-572.688] (-570.778) * [-574.377] (-571.889) (-570.655) (-570.758) -- 0:00:33
54500 -- (-574.398) (-571.287) [-571.463] (-571.387) * (-573.811) (-570.228) (-570.765) [-570.885] -- 0:00:32
55000 -- (-569.743) (-569.997) (-576.849) [-571.630] * (-569.595) [-569.456] (-570.044) (-569.206) -- 0:00:32
Average standard deviation of split frequencies: 0.028798
55500 -- (-571.231) (-573.032) (-573.158) [-571.483] * (-572.241) (-572.350) (-571.754) [-570.881] -- 0:00:32
56000 -- (-572.382) (-571.664) [-572.483] (-574.228) * [-571.014] (-572.510) (-568.949) (-572.726) -- 0:00:31
56500 -- (-572.447) [-569.881] (-570.582) (-570.841) * (-569.749) (-572.356) (-573.452) [-571.512] -- 0:00:31
57000 -- [-569.226] (-571.007) (-571.670) (-570.811) * (-570.262) (-573.502) [-569.788] (-572.927) -- 0:00:31
57500 -- [-571.595] (-568.956) (-573.444) (-572.929) * (-570.569) [-572.374] (-572.618) (-569.474) -- 0:00:30
58000 -- (-573.067) (-570.912) (-568.697) [-571.236] * (-571.583) (-571.722) [-570.136] (-570.413) -- 0:00:30
58500 -- (-570.963) (-569.858) [-570.712] (-576.337) * (-569.088) [-571.718] (-569.901) (-570.767) -- 0:00:30
59000 -- (-569.927) [-569.102] (-570.229) (-575.418) * (-573.033) (-571.309) (-569.762) [-570.031] -- 0:00:29
59500 -- [-569.288] (-571.879) (-572.034) (-571.392) * (-571.438) (-575.600) (-569.988) [-577.783] -- 0:00:29
60000 -- [-569.305] (-574.315) (-569.997) (-573.397) * (-573.043) (-578.993) [-573.083] (-571.368) -- 0:00:29
Average standard deviation of split frequencies: 0.028362
60500 -- (-573.482) (-573.567) (-572.489) [-569.670] * (-572.658) (-573.938) (-570.597) [-570.464] -- 0:00:29
61000 -- [-573.249] (-573.596) (-570.696) (-572.222) * (-570.315) [-571.536] (-570.759) (-571.995) -- 0:00:28
61500 -- (-572.045) [-572.122] (-578.299) (-569.121) * (-573.383) (-570.750) [-569.714] (-570.941) -- 0:00:28
62000 -- [-569.085] (-570.680) (-571.220) (-569.055) * (-573.016) (-569.905) [-569.550] (-572.741) -- 0:00:28
62500 -- (-570.962) (-574.578) (-569.948) [-570.756] * (-572.532) (-569.986) (-569.679) [-571.783] -- 0:00:35
63000 -- [-571.207] (-572.627) (-572.791) (-571.566) * (-569.629) [-570.253] (-568.874) (-575.425) -- 0:00:34
63500 -- [-571.807] (-572.205) (-570.453) (-571.056) * (-571.312) [-569.973] (-571.520) (-572.023) -- 0:00:34
64000 -- [-570.359] (-571.187) (-571.228) (-569.508) * [-568.959] (-569.841) (-571.287) (-572.181) -- 0:00:34
64500 -- (-576.103) [-569.914] (-569.635) (-571.659) * [-573.512] (-572.847) (-571.485) (-572.771) -- 0:00:33
65000 -- (-578.181) (-570.506) (-569.510) [-570.438] * (-577.755) (-573.274) [-569.689] (-571.832) -- 0:00:33
Average standard deviation of split frequencies: 0.024349
65500 -- (-571.369) [-571.627] (-569.970) (-571.012) * (-574.421) [-570.913] (-569.863) (-570.351) -- 0:00:33
66000 -- (-574.601) [-571.637] (-570.492) (-570.447) * (-570.904) [-570.056] (-574.129) (-571.304) -- 0:00:32
66500 -- (-572.285) (-570.224) (-569.242) [-571.765] * (-572.794) (-570.646) (-571.487) [-570.414] -- 0:00:32
67000 -- (-572.130) [-569.700] (-570.527) (-570.783) * (-574.662) (-569.247) (-571.468) [-573.642] -- 0:00:32
67500 -- (-573.411) (-571.144) [-573.176] (-574.231) * (-573.019) (-570.053) [-570.991] (-571.972) -- 0:00:32
68000 -- (-571.749) [-570.697] (-571.449) (-571.068) * (-573.246) (-571.343) [-571.722] (-572.983) -- 0:00:31
68500 -- (-569.531) [-569.668] (-570.377) (-572.365) * [-571.373] (-569.656) (-574.108) (-571.255) -- 0:00:31
69000 -- (-570.178) (-569.598) [-570.691] (-572.148) * (-570.476) [-572.521] (-570.649) (-571.107) -- 0:00:31
69500 -- (-570.904) (-573.406) (-571.730) [-572.001] * (-570.629) [-570.754] (-573.058) (-570.865) -- 0:00:30
70000 -- (-574.207) (-571.602) (-571.937) [-570.672] * [-572.516] (-572.250) (-577.398) (-569.288) -- 0:00:30
Average standard deviation of split frequencies: 0.024258
70500 -- (-574.989) (-569.729) [-574.355] (-570.980) * [-570.469] (-572.667) (-572.416) (-569.818) -- 0:00:30
71000 -- (-576.770) [-572.449] (-571.222) (-570.730) * [-573.168] (-569.342) (-569.049) (-570.850) -- 0:00:30
71500 -- [-570.799] (-575.583) (-570.431) (-575.345) * (-569.345) (-569.115) [-569.910] (-570.652) -- 0:00:29
72000 -- (-569.609) [-569.351] (-569.372) (-569.126) * (-569.691) [-571.198] (-570.926) (-571.547) -- 0:00:29
72500 -- (-568.966) (-570.567) (-573.900) [-570.560] * [-570.122] (-572.653) (-572.447) (-571.237) -- 0:00:29
73000 -- (-569.023) [-569.522] (-572.563) (-570.561) * (-570.651) (-569.241) (-572.515) [-571.069] -- 0:00:29
73500 -- (-571.254) [-570.274] (-571.740) (-569.491) * (-572.668) (-571.697) [-571.498] (-570.186) -- 0:00:29
74000 -- (-570.742) [-570.316] (-570.614) (-570.212) * (-574.451) (-570.595) [-571.272] (-569.439) -- 0:00:28
74500 -- (-570.089) [-569.324] (-569.416) (-570.758) * (-573.191) (-571.702) (-571.514) [-570.269] -- 0:00:28
75000 -- (-576.131) (-571.225) (-569.460) [-573.379] * [-569.495] (-575.611) (-572.635) (-570.567) -- 0:00:28
Average standard deviation of split frequencies: 0.026982
75500 -- (-570.045) (-571.593) [-569.564] (-570.437) * [-569.976] (-574.728) (-573.171) (-569.672) -- 0:00:28
76000 -- [-570.016] (-568.988) (-572.018) (-569.922) * (-571.580) [-570.904] (-571.972) (-569.899) -- 0:00:27
76500 -- (-569.996) [-573.063] (-569.265) (-571.910) * (-571.043) (-573.298) [-570.807] (-572.524) -- 0:00:27
77000 -- (-569.316) (-574.183) (-570.816) [-569.539] * [-570.520] (-570.755) (-571.049) (-570.496) -- 0:00:27
77500 -- [-569.319] (-570.308) (-575.330) (-569.269) * (-573.358) [-569.568] (-571.214) (-571.753) -- 0:00:27
78000 -- (-570.565) (-572.040) (-574.286) [-569.615] * [-571.546] (-572.567) (-571.594) (-572.366) -- 0:00:32
78500 -- (-573.368) (-570.003) (-572.400) [-569.174] * (-572.216) [-572.134] (-572.311) (-573.373) -- 0:00:32
79000 -- (-571.343) [-572.234] (-573.483) (-568.808) * [-568.975] (-569.967) (-570.354) (-572.686) -- 0:00:31
79500 -- [-570.480] (-569.194) (-570.303) (-568.722) * (-570.422) (-571.899) (-569.537) [-571.367] -- 0:00:31
80000 -- [-570.055] (-572.798) (-573.220) (-571.270) * (-569.851) (-570.546) [-573.687] (-571.649) -- 0:00:31
Average standard deviation of split frequencies: 0.028927
80500 -- [-572.111] (-571.487) (-570.979) (-570.221) * (-572.438) (-574.026) [-573.414] (-569.811) -- 0:00:31
81000 -- (-570.370) (-569.706) [-571.153] (-570.188) * (-573.431) [-573.063] (-572.680) (-569.679) -- 0:00:31
81500 -- [-570.568] (-574.739) (-570.644) (-571.013) * [-572.420] (-569.166) (-571.144) (-572.127) -- 0:00:30
82000 -- (-572.252) [-574.733] (-573.626) (-572.154) * [-573.986] (-569.539) (-569.485) (-570.327) -- 0:00:30
82500 -- (-569.007) (-571.871) [-572.969] (-578.206) * (-571.100) [-570.521] (-569.657) (-569.596) -- 0:00:30
83000 -- [-569.384] (-572.488) (-571.798) (-572.973) * (-571.100) (-569.633) [-569.912] (-571.752) -- 0:00:30
83500 -- (-569.521) [-573.838] (-574.614) (-572.414) * (-574.551) (-571.272) (-571.284) [-569.407] -- 0:00:29
84000 -- (-569.854) [-570.074] (-571.926) (-569.164) * [-574.827] (-571.263) (-574.508) (-570.134) -- 0:00:29
84500 -- (-570.870) (-569.606) (-572.782) [-570.951] * (-575.754) [-572.267] (-570.509) (-571.011) -- 0:00:29
85000 -- (-571.785) [-570.643] (-569.758) (-569.763) * (-574.332) (-571.153) (-570.037) [-571.432] -- 0:00:29
Average standard deviation of split frequencies: 0.025489
85500 -- (-570.319) (-570.748) (-569.790) [-570.026] * [-570.776] (-570.757) (-569.382) (-569.744) -- 0:00:29
86000 -- (-568.944) [-570.989] (-569.431) (-571.295) * [-571.916] (-571.212) (-572.533) (-570.989) -- 0:00:28
86500 -- (-569.592) (-576.485) (-570.004) [-571.200] * [-571.822] (-568.740) (-569.623) (-570.779) -- 0:00:28
87000 -- (-570.908) (-576.222) [-577.633] (-579.613) * [-573.247] (-570.896) (-569.940) (-571.283) -- 0:00:28
87500 -- [-572.134] (-573.739) (-571.292) (-574.102) * (-572.810) (-570.986) (-570.561) [-570.673] -- 0:00:28
88000 -- (-573.863) [-571.786] (-573.944) (-569.813) * [-572.691] (-571.690) (-570.217) (-570.005) -- 0:00:28
88500 -- (-570.797) (-571.315) (-570.038) [-569.592] * [-570.870] (-574.897) (-569.551) (-574.857) -- 0:00:27
89000 -- [-570.105] (-571.580) (-569.602) (-569.627) * [-573.346] (-569.486) (-570.510) (-570.809) -- 0:00:27
89500 -- [-573.469] (-570.847) (-570.638) (-570.885) * (-570.569) (-570.090) (-570.475) [-573.677] -- 0:00:27
90000 -- (-572.784) (-570.411) (-571.217) [-572.221] * (-575.149) (-571.391) (-572.046) [-569.864] -- 0:00:27
Average standard deviation of split frequencies: 0.027365
90500 -- [-571.127] (-570.129) (-570.123) (-572.715) * (-569.439) (-573.769) (-569.241) [-572.136] -- 0:00:27
91000 -- (-570.116) (-571.503) (-571.040) [-571.197] * (-569.743) (-572.297) (-570.582) [-572.349] -- 0:00:26
91500 -- (-570.118) [-574.137] (-570.791) (-571.611) * (-574.139) (-577.587) (-572.358) [-572.488] -- 0:00:26
92000 -- [-570.110] (-571.446) (-571.177) (-573.606) * (-571.629) [-573.600] (-569.939) (-570.644) -- 0:00:26
92500 -- (-571.365) (-569.697) [-571.019] (-569.893) * (-569.571) (-570.750) (-571.549) [-570.366] -- 0:00:26
93000 -- (-573.467) (-570.624) [-569.529] (-569.676) * (-570.121) [-570.907] (-571.054) (-577.224) -- 0:00:26
93500 -- (-576.087) (-573.187) [-569.978] (-570.994) * [-578.569] (-569.489) (-571.965) (-571.074) -- 0:00:26
94000 -- (-573.098) (-571.214) [-571.914] (-572.127) * (-571.515) (-571.453) (-570.945) [-570.344] -- 0:00:30
94500 -- (-570.706) (-570.154) (-571.350) [-575.264] * (-573.911) (-572.365) (-571.766) [-572.286] -- 0:00:30
95000 -- (-571.907) (-569.986) (-571.261) [-574.378] * (-570.022) [-570.429] (-569.606) (-569.419) -- 0:00:29
Average standard deviation of split frequencies: 0.026189
95500 -- (-571.481) (-571.112) [-572.081] (-572.821) * (-570.152) (-572.167) [-569.675] (-569.097) -- 0:00:29
96000 -- (-571.013) (-570.544) [-572.870] (-572.040) * (-570.567) (-571.797) [-569.756] (-569.479) -- 0:00:29
96500 -- (-569.767) [-570.101] (-571.083) (-573.275) * (-570.004) (-570.466) [-569.854] (-570.252) -- 0:00:29
97000 -- (-570.276) [-572.737] (-573.593) (-571.768) * [-572.868] (-570.946) (-570.901) (-571.381) -- 0:00:29
97500 -- [-570.731] (-569.877) (-571.211) (-575.019) * (-572.627) [-571.173] (-571.427) (-571.449) -- 0:00:28
98000 -- (-570.790) [-569.351] (-570.683) (-569.699) * [-570.386] (-570.698) (-571.276) (-570.169) -- 0:00:28
98500 -- [-577.921] (-568.798) (-569.858) (-569.413) * (-570.044) (-570.841) [-569.986] (-572.356) -- 0:00:28
99000 -- (-572.483) (-570.367) (-570.044) [-570.470] * (-571.360) (-571.361) [-569.345] (-570.930) -- 0:00:28
99500 -- (-573.738) (-571.406) [-569.473] (-573.208) * (-569.760) (-575.350) (-569.393) [-570.730] -- 0:00:28
100000 -- (-575.943) [-572.207] (-570.194) (-570.919) * (-569.899) (-570.003) (-571.841) [-571.439] -- 0:00:27
Average standard deviation of split frequencies: 0.024893
100500 -- [-571.004] (-571.589) (-570.460) (-570.587) * (-572.626) (-572.275) [-570.368] (-569.337) -- 0:00:27
101000 -- (-570.264) (-571.654) (-570.252) [-573.361] * (-572.445) (-572.537) (-573.262) [-569.761] -- 0:00:27
101500 -- (-570.071) (-576.643) (-571.636) [-570.797] * (-571.830) [-569.828] (-570.603) (-569.674) -- 0:00:27
102000 -- (-570.624) (-569.823) (-572.158) [-569.159] * (-569.599) (-570.960) [-570.832] (-568.764) -- 0:00:27
102500 -- (-573.288) (-573.667) (-569.724) [-569.959] * (-570.183) (-570.351) [-572.544] (-572.319) -- 0:00:27
103000 -- (-571.501) (-570.010) [-569.242] (-570.877) * (-576.986) (-570.362) [-573.987] (-572.182) -- 0:00:26
103500 -- [-571.586] (-572.217) (-571.494) (-568.704) * (-571.768) (-572.458) (-573.912) [-571.207] -- 0:00:26
104000 -- [-571.404] (-575.760) (-572.257) (-571.097) * (-569.764) [-571.958] (-571.564) (-570.912) -- 0:00:26
104500 -- [-571.201] (-572.446) (-570.381) (-570.233) * (-568.680) (-570.274) [-573.838] (-571.472) -- 0:00:26
105000 -- (-570.357) (-570.708) [-569.062] (-571.062) * (-569.374) (-569.472) [-572.866] (-570.581) -- 0:00:26
Average standard deviation of split frequencies: 0.024811
105500 -- [-570.484] (-572.407) (-571.208) (-571.676) * (-571.779) [-569.291] (-570.492) (-571.742) -- 0:00:26
106000 -- (-570.617) (-571.739) [-570.924] (-570.698) * (-577.092) (-569.305) [-571.511] (-570.087) -- 0:00:26
106500 -- (-570.717) (-572.803) [-572.087] (-572.391) * (-573.837) [-569.507] (-571.701) (-571.390) -- 0:00:25
107000 -- (-573.075) (-570.202) [-573.790] (-572.110) * (-570.708) (-570.580) [-573.836] (-572.335) -- 0:00:25
107500 -- [-577.688] (-570.643) (-574.814) (-569.622) * (-571.449) (-569.106) (-570.344) [-570.586] -- 0:00:25
108000 -- (-571.749) [-574.297] (-572.929) (-571.318) * (-570.054) (-570.354) (-571.516) [-573.188] -- 0:00:25
108500 -- [-571.529] (-571.639) (-572.036) (-573.879) * (-569.540) [-572.644] (-576.106) (-571.777) -- 0:00:25
109000 -- (-569.206) [-569.646] (-570.410) (-569.162) * (-570.386) (-573.682) [-571.567] (-572.533) -- 0:00:25
109500 -- [-571.705] (-569.276) (-571.184) (-570.464) * [-570.897] (-572.224) (-574.089) (-571.201) -- 0:00:24
110000 -- (-572.878) [-569.756] (-571.260) (-570.684) * [-571.038] (-576.430) (-571.689) (-575.170) -- 0:00:28
Average standard deviation of split frequencies: 0.024493
110500 -- [-570.404] (-570.640) (-570.983) (-574.700) * [-573.222] (-573.064) (-570.936) (-575.338) -- 0:00:28
111000 -- (-570.414) (-573.545) (-575.174) [-570.454] * (-575.515) (-571.159) [-569.440] (-570.700) -- 0:00:28
111500 -- [-568.706] (-569.887) (-570.087) (-569.469) * [-571.533] (-570.600) (-569.770) (-570.173) -- 0:00:27
112000 -- [-570.947] (-570.795) (-570.945) (-569.581) * [-570.409] (-569.078) (-570.246) (-576.799) -- 0:00:27
112500 -- (-571.418) (-569.804) (-569.264) [-571.343] * [-573.300] (-569.114) (-577.982) (-571.993) -- 0:00:27
113000 -- (-572.529) [-570.358] (-569.267) (-570.338) * [-570.200] (-570.703) (-573.935) (-574.064) -- 0:00:27
113500 -- (-571.324) [-571.106] (-569.550) (-569.199) * (-570.529) [-569.445] (-571.257) (-572.978) -- 0:00:27
114000 -- [-570.683] (-570.442) (-570.092) (-569.106) * (-570.999) (-569.290) [-569.586] (-574.380) -- 0:00:27
114500 -- [-572.131] (-573.325) (-570.436) (-569.005) * (-575.552) (-569.936) (-569.340) [-571.479] -- 0:00:26
115000 -- (-573.612) [-572.507] (-569.133) (-569.164) * [-572.312] (-569.993) (-570.322) (-571.284) -- 0:00:26
Average standard deviation of split frequencies: 0.021538
115500 -- (-570.147) (-571.514) [-569.412] (-572.164) * (-571.740) [-569.998] (-572.350) (-570.611) -- 0:00:26
116000 -- (-572.493) [-574.174] (-570.247) (-571.535) * [-570.325] (-569.696) (-578.434) (-574.346) -- 0:00:26
116500 -- (-570.250) (-571.706) (-569.735) [-573.067] * [-569.057] (-570.700) (-573.703) (-570.508) -- 0:00:26
117000 -- (-569.817) (-574.000) [-569.593] (-570.557) * (-570.162) (-569.657) [-570.688] (-571.573) -- 0:00:26
117500 -- (-570.179) (-571.181) (-570.658) [-569.516] * (-569.712) [-571.288] (-571.548) (-570.483) -- 0:00:26
118000 -- (-569.240) [-573.302] (-573.683) (-569.490) * [-571.495] (-572.357) (-571.459) (-571.585) -- 0:00:25
118500 -- [-569.631] (-572.568) (-574.314) (-570.098) * [-572.757] (-570.515) (-568.906) (-568.754) -- 0:00:25
119000 -- [-570.081] (-571.223) (-570.370) (-572.817) * (-574.508) (-571.697) (-570.020) [-571.663] -- 0:00:25
119500 -- (-570.632) (-569.157) (-572.299) [-570.747] * (-571.220) (-570.279) (-570.707) [-572.602] -- 0:00:25
120000 -- (-570.392) (-570.650) [-572.000] (-578.036) * (-570.110) [-570.375] (-571.352) (-571.413) -- 0:00:25
Average standard deviation of split frequencies: 0.021096
120500 -- (-571.772) (-570.912) [-573.645] (-572.482) * (-571.016) (-573.111) (-570.595) [-572.489] -- 0:00:25
121000 -- (-573.036) (-570.521) [-575.848] (-569.640) * (-571.498) [-571.834] (-570.730) (-571.315) -- 0:00:25
121500 -- (-572.890) (-569.283) (-568.960) [-569.759] * (-571.088) (-570.572) [-570.700] (-572.517) -- 0:00:24
122000 -- (-571.702) (-570.186) (-574.491) [-570.028] * [-570.468] (-570.195) (-571.239) (-571.120) -- 0:00:24
122500 -- (-577.546) (-570.505) [-569.658] (-569.756) * [-569.862] (-573.478) (-570.173) (-569.014) -- 0:00:24
123000 -- (-570.039) (-572.068) [-569.707] (-571.295) * (-572.971) (-569.086) [-571.597] (-570.836) -- 0:00:24
123500 -- (-572.447) (-569.303) (-569.808) [-569.919] * (-571.552) (-570.368) [-574.133] (-568.653) -- 0:00:24
124000 -- [-573.262] (-569.440) (-571.271) (-572.715) * (-576.280) (-571.156) (-573.856) [-570.918] -- 0:00:24
124500 -- (-571.755) (-570.716) [-570.161] (-571.869) * (-569.389) [-572.772] (-571.544) (-570.674) -- 0:00:24
125000 -- (-571.310) [-570.413] (-570.382) (-571.431) * (-571.547) [-569.799] (-577.796) (-570.278) -- 0:00:24
Average standard deviation of split frequencies: 0.019081
125500 -- (-575.878) (-571.619) (-575.543) [-570.441] * (-570.849) (-570.679) (-571.284) [-570.227] -- 0:00:23
126000 -- (-569.512) (-570.206) (-571.666) [-569.313] * [-569.787] (-569.110) (-573.498) (-574.903) -- 0:00:26
126500 -- (-576.939) (-573.233) [-569.819] (-570.341) * (-574.143) (-569.794) (-573.407) [-570.251] -- 0:00:26
127000 -- (-578.337) (-573.089) [-571.340] (-569.347) * (-570.428) [-569.130] (-569.516) (-577.511) -- 0:00:26
127500 -- (-577.688) [-569.383] (-573.149) (-569.234) * (-569.862) (-570.580) [-569.186] (-576.727) -- 0:00:26
128000 -- (-570.667) (-570.195) [-571.698] (-570.142) * (-570.456) [-570.081] (-570.656) (-569.920) -- 0:00:26
128500 -- [-570.735] (-573.732) (-569.933) (-570.417) * (-570.576) (-569.843) [-569.450] (-570.125) -- 0:00:26
129000 -- (-572.242) (-571.592) (-573.251) [-573.074] * (-569.602) [-572.433] (-570.183) (-570.644) -- 0:00:25
129500 -- (-571.166) (-571.601) (-570.505) [-574.859] * (-570.526) (-572.035) (-573.932) [-575.202] -- 0:00:25
130000 -- [-572.707] (-572.001) (-573.737) (-570.530) * (-569.547) [-572.397] (-572.681) (-573.786) -- 0:00:25
Average standard deviation of split frequencies: 0.015874
130500 -- (-572.229) [-572.700] (-572.131) (-569.599) * [-569.658] (-571.808) (-572.723) (-572.520) -- 0:00:25
131000 -- [-571.400] (-571.595) (-569.038) (-573.086) * (-571.676) [-570.864] (-572.109) (-571.080) -- 0:00:25
131500 -- (-572.022) [-571.927] (-570.116) (-571.186) * (-571.036) (-570.541) [-572.830] (-569.420) -- 0:00:25
132000 -- [-572.934] (-571.781) (-570.649) (-569.451) * (-573.903) (-570.125) [-569.111] (-572.473) -- 0:00:25
132500 -- (-568.722) [-571.194] (-569.926) (-571.059) * (-569.699) [-571.531] (-569.471) (-570.956) -- 0:00:24
133000 -- (-570.744) (-574.141) [-571.266] (-568.950) * (-570.802) [-570.859] (-571.333) (-572.593) -- 0:00:24
133500 -- (-570.984) (-571.117) (-572.099) [-569.326] * [-571.538] (-573.036) (-570.905) (-569.061) -- 0:00:24
134000 -- (-569.866) (-573.063) [-569.654] (-569.716) * [-573.022] (-571.162) (-570.229) (-573.796) -- 0:00:24
134500 -- [-569.586] (-571.498) (-569.488) (-570.831) * (-569.647) [-572.622] (-574.463) (-570.327) -- 0:00:24
135000 -- [-573.468] (-572.003) (-572.854) (-570.543) * [-570.274] (-572.346) (-570.204) (-570.943) -- 0:00:24
Average standard deviation of split frequencies: 0.016236
135500 -- (-569.726) (-570.660) (-570.584) [-570.360] * [-570.188] (-569.937) (-569.779) (-574.066) -- 0:00:24
136000 -- (-570.467) (-570.336) (-569.710) [-569.765] * (-570.949) [-573.457] (-579.548) (-570.676) -- 0:00:24
136500 -- (-575.195) (-569.980) (-572.289) [-568.945] * [-571.692] (-572.303) (-575.110) (-572.024) -- 0:00:23
137000 -- (-572.978) (-570.600) (-572.235) [-571.262] * [-572.669] (-570.242) (-572.205) (-569.919) -- 0:00:23
137500 -- (-571.082) (-570.391) (-569.625) [-570.730] * [-569.619] (-570.388) (-572.385) (-570.639) -- 0:00:23
138000 -- (-569.380) [-571.321] (-574.984) (-573.118) * [-570.459] (-572.215) (-571.171) (-569.024) -- 0:00:23
138500 -- [-568.706] (-570.224) (-571.285) (-572.176) * (-570.843) (-569.871) [-571.282] (-572.768) -- 0:00:23
139000 -- (-569.955) (-572.424) [-569.634] (-569.732) * (-569.603) [-570.424] (-575.148) (-571.090) -- 0:00:23
139500 -- (-571.192) (-569.245) (-571.414) [-571.239] * (-569.552) [-569.616] (-574.540) (-571.153) -- 0:00:23
140000 -- (-570.412) [-573.124] (-571.000) (-569.731) * (-572.963) (-575.628) (-577.110) [-570.890] -- 0:00:23
Average standard deviation of split frequencies: 0.014463
140500 -- (-574.349) (-572.686) (-571.045) [-569.746] * (-578.806) (-572.703) [-569.508] (-570.844) -- 0:00:23
141000 -- (-570.476) (-571.203) (-572.583) [-572.039] * (-570.969) [-571.773] (-570.410) (-570.634) -- 0:00:22
141500 -- [-570.559] (-571.312) (-571.588) (-571.306) * (-569.460) (-571.748) [-571.766] (-570.254) -- 0:00:22
142000 -- [-571.431] (-571.190) (-574.160) (-569.784) * (-570.376) (-573.725) (-572.281) [-569.168] -- 0:00:22
142500 -- (-569.891) (-571.538) (-576.016) [-570.551] * (-570.456) (-570.417) (-569.855) [-571.651] -- 0:00:25
143000 -- (-572.718) [-570.728] (-573.880) (-571.997) * [-575.204] (-569.140) (-574.176) (-570.411) -- 0:00:24
143500 -- [-576.375] (-571.034) (-571.053) (-571.023) * (-573.850) (-569.034) [-573.714] (-571.120) -- 0:00:24
144000 -- (-573.245) [-569.694] (-570.470) (-574.359) * (-571.971) [-571.702] (-572.856) (-570.343) -- 0:00:24
144500 -- (-573.701) [-569.070] (-575.099) (-575.050) * (-572.381) (-570.829) (-572.443) [-572.057] -- 0:00:24
145000 -- (-574.506) (-571.126) (-571.431) [-573.623] * (-572.392) (-574.526) [-571.966] (-570.825) -- 0:00:24
Average standard deviation of split frequencies: 0.015498
145500 -- (-573.697) (-570.462) [-570.936] (-570.009) * (-570.855) [-572.377] (-571.850) (-572.020) -- 0:00:24
146000 -- (-570.369) (-574.401) (-573.918) [-570.046] * [-570.959] (-570.467) (-572.977) (-572.198) -- 0:00:24
146500 -- [-572.896] (-569.848) (-573.093) (-571.557) * [-569.313] (-572.535) (-573.259) (-569.849) -- 0:00:24
147000 -- (-570.069) [-569.795] (-573.045) (-572.156) * (-570.417) [-570.648] (-573.182) (-570.058) -- 0:00:24
147500 -- [-571.466] (-570.338) (-570.233) (-575.667) * [-570.593] (-571.893) (-572.225) (-572.750) -- 0:00:23
148000 -- (-571.427) (-569.453) [-573.878] (-570.088) * (-572.173) (-571.017) (-573.618) [-572.400] -- 0:00:23
148500 -- (-573.896) (-570.289) [-572.152] (-572.867) * [-570.739] (-570.234) (-570.904) (-569.607) -- 0:00:23
149000 -- (-570.081) (-571.519) (-569.852) [-572.298] * (-571.627) [-569.979] (-571.308) (-570.614) -- 0:00:23
149500 -- (-573.573) (-570.886) [-570.508] (-571.545) * (-570.039) (-575.241) (-571.589) [-569.320] -- 0:00:23
150000 -- (-571.424) (-571.181) [-569.590] (-569.134) * (-570.962) (-569.290) [-570.252] (-571.270) -- 0:00:23
Average standard deviation of split frequencies: 0.014392
150500 -- (-573.924) (-571.422) (-571.495) [-570.389] * (-571.954) [-568.981] (-569.196) (-570.863) -- 0:00:23
151000 -- (-572.974) (-574.241) [-571.302] (-573.659) * [-571.363] (-572.271) (-574.083) (-571.341) -- 0:00:23
151500 -- (-569.985) (-570.189) (-570.862) [-569.669] * [-570.016] (-570.866) (-572.553) (-574.111) -- 0:00:23
152000 -- (-569.914) [-569.960] (-569.246) (-569.334) * (-572.449) [-570.758] (-571.302) (-574.025) -- 0:00:22
152500 -- (-571.450) [-570.388] (-570.375) (-571.724) * (-570.277) [-569.963] (-571.144) (-573.607) -- 0:00:22
153000 -- (-574.761) (-569.890) (-569.663) [-571.969] * [-569.347] (-571.598) (-569.465) (-573.321) -- 0:00:22
153500 -- [-571.201] (-571.676) (-570.049) (-573.930) * [-568.839] (-573.884) (-570.774) (-573.382) -- 0:00:22
154000 -- (-569.840) (-570.269) [-571.345] (-573.122) * (-570.203) [-569.436] (-569.034) (-572.397) -- 0:00:22
154500 -- (-572.206) [-571.063] (-571.139) (-571.823) * (-574.276) (-569.940) (-569.520) [-575.401] -- 0:00:22
155000 -- (-572.195) (-571.041) (-569.374) [-572.080] * (-570.566) (-570.931) [-569.448] (-576.182) -- 0:00:22
Average standard deviation of split frequencies: 0.013447
155500 -- [-570.096] (-570.792) (-571.739) (-570.697) * (-569.325) [-569.998] (-571.776) (-569.784) -- 0:00:22
156000 -- (-572.718) (-571.259) (-572.652) [-571.565] * (-570.512) (-570.369) (-571.093) [-569.861] -- 0:00:22
156500 -- (-569.997) [-572.360] (-571.065) (-573.080) * (-571.653) (-568.981) (-569.878) [-569.352] -- 0:00:21
157000 -- (-569.746) (-569.683) [-571.276] (-569.829) * (-570.246) (-569.104) (-570.641) [-570.347] -- 0:00:21
157500 -- (-571.911) [-570.212] (-574.355) (-569.129) * (-569.895) [-569.127] (-571.255) (-572.210) -- 0:00:21
158000 -- (-570.757) (-570.965) (-572.207) [-571.107] * (-578.556) (-570.690) [-572.247] (-570.917) -- 0:00:23
158500 -- (-571.442) (-569.456) [-569.650] (-574.261) * [-572.466] (-572.596) (-570.865) (-573.546) -- 0:00:23
159000 -- (-574.339) (-570.373) [-570.483] (-572.268) * (-572.583) (-573.014) (-571.522) [-571.650] -- 0:00:23
159500 -- [-570.817] (-568.951) (-570.968) (-571.542) * (-571.091) (-570.353) [-570.994] (-573.982) -- 0:00:23
160000 -- (-571.600) [-570.582] (-579.742) (-575.890) * (-574.133) [-569.378] (-570.287) (-571.300) -- 0:00:23
Average standard deviation of split frequencies: 0.014670
160500 -- [-573.041] (-570.283) (-576.314) (-569.822) * (-569.649) (-569.946) (-569.257) [-570.303] -- 0:00:23
161000 -- (-570.619) [-568.950] (-570.670) (-569.954) * (-569.299) (-569.955) [-571.625] (-570.134) -- 0:00:23
161500 -- (-571.539) (-571.112) (-569.920) [-569.555] * (-571.234) (-569.295) (-570.625) [-569.668] -- 0:00:23
162000 -- (-571.739) (-574.176) (-570.260) [-570.042] * (-572.077) (-571.787) (-573.508) [-570.517] -- 0:00:22
162500 -- (-573.552) (-571.427) [-572.427] (-574.326) * (-570.100) (-573.309) [-571.453] (-572.265) -- 0:00:22
163000 -- (-573.180) (-571.350) [-570.708] (-572.605) * [-570.089] (-574.811) (-576.448) (-576.191) -- 0:00:22
163500 -- [-572.185] (-572.340) (-570.740) (-571.006) * (-571.909) (-570.357) [-574.149] (-571.599) -- 0:00:22
164000 -- (-572.477) [-571.915] (-570.120) (-573.417) * (-573.058) [-569.099] (-571.574) (-572.054) -- 0:00:22
164500 -- [-570.454] (-570.912) (-569.275) (-570.686) * (-570.406) (-570.162) [-571.295] (-574.370) -- 0:00:22
165000 -- (-571.857) (-572.271) [-572.637] (-574.720) * [-573.212] (-572.936) (-570.622) (-570.500) -- 0:00:22
Average standard deviation of split frequencies: 0.015146
165500 -- (-570.218) (-572.043) [-574.890] (-572.410) * (-573.218) (-569.957) [-570.462] (-571.603) -- 0:00:22
166000 -- (-569.393) [-570.616] (-569.725) (-573.206) * [-572.233] (-571.648) (-577.188) (-571.824) -- 0:00:22
166500 -- (-575.074) (-571.647) [-569.539] (-576.067) * (-571.286) (-573.102) [-574.028] (-576.866) -- 0:00:22
167000 -- (-572.149) [-571.665] (-569.641) (-570.773) * (-570.558) (-572.569) (-569.756) [-572.876] -- 0:00:21
167500 -- [-569.384] (-571.905) (-572.035) (-570.583) * (-570.394) (-570.275) (-574.456) [-571.016] -- 0:00:21
168000 -- (-570.886) (-571.644) [-570.923] (-570.571) * (-569.247) (-569.423) (-569.730) [-574.600] -- 0:00:21
168500 -- (-570.201) (-575.667) [-570.670] (-572.354) * (-570.161) (-572.734) (-569.640) [-569.262] -- 0:00:21
169000 -- (-576.718) (-571.245) (-570.789) [-572.120] * (-571.835) (-574.354) [-571.976] (-569.676) -- 0:00:21
169500 -- (-573.707) [-572.804] (-572.110) (-570.093) * (-569.953) [-571.960] (-570.121) (-572.810) -- 0:00:21
170000 -- (-572.423) (-570.046) (-570.088) [-569.612] * (-569.498) [-571.120] (-570.271) (-572.992) -- 0:00:21
Average standard deviation of split frequencies: 0.015192
170500 -- (-573.250) (-569.867) (-570.508) [-569.257] * [-569.207] (-572.060) (-570.884) (-571.144) -- 0:00:21
171000 -- (-571.799) (-570.139) [-569.402] (-571.027) * [-571.852] (-571.706) (-572.774) (-571.047) -- 0:00:21
171500 -- (-570.979) (-571.400) [-570.594] (-574.611) * [-568.976] (-570.344) (-569.126) (-571.937) -- 0:00:21
172000 -- (-570.967) (-569.957) [-569.715] (-570.776) * (-569.056) (-572.705) [-570.716] (-571.354) -- 0:00:20
172500 -- (-574.777) [-571.164] (-573.784) (-572.010) * (-571.657) (-575.743) [-569.337] (-572.236) -- 0:00:20
173000 -- (-573.110) [-571.604] (-574.795) (-569.668) * (-573.607) (-572.498) [-572.204] (-569.857) -- 0:00:20
173500 -- (-571.813) (-571.464) (-571.530) [-572.269] * [-574.783] (-569.416) (-572.990) (-570.651) -- 0:00:22
174000 -- (-572.734) (-571.899) (-570.905) [-575.867] * (-569.930) [-569.154] (-571.808) (-571.699) -- 0:00:22
174500 -- (-570.672) (-571.060) (-569.632) [-572.726] * (-569.415) (-570.091) [-570.053] (-569.528) -- 0:00:22
175000 -- (-569.776) [-570.994] (-569.752) (-569.240) * (-569.623) (-570.653) [-572.846] (-569.903) -- 0:00:22
Average standard deviation of split frequencies: 0.014464
175500 -- (-569.940) [-572.113] (-571.095) (-570.043) * (-570.668) [-569.918] (-570.982) (-570.275) -- 0:00:22
176000 -- [-571.858] (-574.467) (-570.185) (-571.420) * (-570.956) (-569.780) [-569.883] (-569.637) -- 0:00:22
176500 -- [-573.515] (-577.383) (-569.019) (-574.378) * [-575.557] (-571.413) (-570.629) (-575.943) -- 0:00:21
177000 -- (-573.588) (-575.966) [-570.910] (-577.285) * [-569.523] (-572.084) (-570.006) (-573.396) -- 0:00:21
177500 -- (-571.745) [-572.988] (-569.934) (-570.633) * (-573.675) (-570.654) [-569.816] (-569.666) -- 0:00:21
178000 -- (-570.688) (-571.476) (-570.688) [-572.366] * (-572.088) (-570.756) (-569.185) [-571.103] -- 0:00:21
178500 -- (-569.972) (-569.323) (-570.843) [-570.453] * (-573.764) (-570.749) (-570.106) [-571.839] -- 0:00:21
179000 -- (-574.147) (-571.460) (-570.849) [-571.462] * (-573.684) [-570.765] (-569.535) (-570.398) -- 0:00:21
179500 -- (-569.169) (-569.859) (-569.197) [-570.532] * (-575.201) (-571.589) [-569.652] (-570.396) -- 0:00:21
180000 -- (-569.599) (-569.887) [-569.006] (-569.113) * (-576.087) (-570.643) (-570.393) [-570.674] -- 0:00:21
Average standard deviation of split frequencies: 0.015916
180500 -- (-573.819) [-569.649] (-569.218) (-569.861) * (-570.850) (-570.066) [-570.626] (-571.383) -- 0:00:21
181000 -- (-577.935) (-570.354) [-572.007] (-569.471) * (-570.751) (-571.093) [-572.263] (-570.829) -- 0:00:21
181500 -- (-571.467) (-568.970) (-571.209) [-571.897] * (-570.546) (-572.361) [-572.763] (-570.565) -- 0:00:21
182000 -- (-570.557) (-571.640) (-572.232) [-573.193] * (-570.667) (-571.893) [-571.769] (-570.258) -- 0:00:20
182500 -- [-570.938] (-570.843) (-572.119) (-574.124) * [-573.152] (-576.370) (-569.914) (-569.561) -- 0:00:20
183000 -- [-570.269] (-569.910) (-571.175) (-573.572) * [-570.874] (-574.149) (-576.049) (-570.976) -- 0:00:20
183500 -- (-570.356) (-570.210) [-570.113] (-571.288) * [-569.452] (-571.953) (-576.387) (-570.161) -- 0:00:20
184000 -- (-571.418) (-576.969) (-572.115) [-569.183] * (-570.113) (-572.073) [-571.478] (-570.555) -- 0:00:20
184500 -- [-573.724] (-574.857) (-570.665) (-572.059) * (-570.664) (-572.438) (-570.124) [-569.984] -- 0:00:20
185000 -- (-571.972) (-575.104) [-569.067] (-573.786) * [-570.323] (-573.617) (-570.564) (-573.869) -- 0:00:20
Average standard deviation of split frequencies: 0.015080
185500 -- [-570.854] (-571.764) (-569.646) (-570.079) * (-571.417) (-571.094) [-569.181] (-572.389) -- 0:00:20
186000 -- (-570.123) [-569.317] (-570.896) (-570.347) * (-572.251) (-569.924) [-570.804] (-569.293) -- 0:00:20
186500 -- [-570.294] (-568.886) (-569.495) (-569.218) * [-569.507] (-571.086) (-570.344) (-570.530) -- 0:00:20
187000 -- (-569.273) (-571.897) (-569.795) [-570.298] * (-569.931) (-572.043) [-571.883] (-573.287) -- 0:00:20
187500 -- (-571.986) (-576.189) (-569.689) [-569.449] * (-570.863) [-569.772] (-570.388) (-573.815) -- 0:00:20
188000 -- (-572.832) (-571.876) [-569.401] (-572.108) * [-569.233] (-572.551) (-573.355) (-578.843) -- 0:00:19
188500 -- (-569.376) (-572.545) [-569.047] (-572.620) * [-569.290] (-571.113) (-573.881) (-575.111) -- 0:00:19
189000 -- (-572.449) (-569.267) [-568.877] (-574.458) * (-570.224) (-573.936) (-571.649) [-570.571] -- 0:00:19
189500 -- [-572.063] (-570.208) (-577.080) (-577.707) * (-571.025) (-572.854) (-572.657) [-570.156] -- 0:00:21
190000 -- (-570.787) (-573.472) [-573.360] (-572.772) * (-571.809) (-570.501) [-570.890] (-573.226) -- 0:00:21
Average standard deviation of split frequencies: 0.014093
190500 -- (-570.345) (-571.377) (-575.556) [-570.602] * [-571.558] (-572.869) (-570.905) (-572.070) -- 0:00:21
191000 -- (-571.108) (-570.861) [-573.256] (-570.807) * (-570.153) (-572.816) [-571.955] (-575.105) -- 0:00:21
191500 -- (-569.209) (-576.319) [-572.273] (-570.026) * (-569.522) (-570.404) [-569.210] (-570.083) -- 0:00:20
192000 -- [-569.045] (-570.101) (-574.546) (-570.707) * [-570.088] (-573.078) (-573.927) (-571.464) -- 0:00:20
192500 -- (-572.724) [-569.179] (-569.619) (-569.734) * (-571.123) [-571.757] (-571.351) (-571.776) -- 0:00:20
193000 -- (-570.783) (-574.057) [-570.929] (-572.395) * (-576.527) [-572.250] (-569.654) (-572.332) -- 0:00:20
193500 -- (-570.056) (-575.596) [-569.994] (-571.910) * [-569.592] (-570.884) (-570.371) (-571.198) -- 0:00:20
194000 -- (-569.462) (-571.108) [-571.683] (-571.705) * (-569.604) (-572.274) [-569.149] (-572.160) -- 0:00:20
194500 -- (-571.016) (-569.383) [-572.685] (-576.101) * (-570.474) (-570.473) [-575.137] (-571.851) -- 0:00:20
195000 -- (-569.606) [-570.205] (-570.662) (-573.013) * (-573.011) (-571.471) [-570.832] (-572.423) -- 0:00:20
Average standard deviation of split frequencies: 0.014431
195500 -- (-568.724) [-571.034] (-570.193) (-569.576) * [-578.286] (-569.816) (-570.719) (-572.489) -- 0:00:20
196000 -- (-568.732) (-571.600) [-570.523] (-571.406) * (-571.251) (-573.178) (-569.747) [-570.659] -- 0:00:20
196500 -- (-572.566) (-573.847) (-571.494) [-572.197] * [-572.859] (-570.149) (-570.432) (-574.060) -- 0:00:20
197000 -- (-572.919) [-573.083] (-571.086) (-570.716) * (-571.346) [-570.680] (-570.651) (-573.751) -- 0:00:19
197500 -- (-570.283) [-569.268] (-569.346) (-568.998) * [-569.448] (-571.405) (-573.856) (-569.741) -- 0:00:19
198000 -- [-569.569] (-569.321) (-572.893) (-570.777) * (-569.217) [-570.126] (-570.138) (-571.270) -- 0:00:19
198500 -- (-570.366) (-570.555) (-571.610) [-569.910] * (-570.235) [-569.657] (-571.262) (-570.850) -- 0:00:19
199000 -- (-570.327) (-570.113) [-570.994] (-571.072) * (-570.456) [-570.511] (-570.304) (-570.931) -- 0:00:19
199500 -- (-572.980) (-574.113) (-571.340) [-570.425] * (-570.712) [-574.629] (-576.548) (-570.387) -- 0:00:19
200000 -- (-572.422) [-572.091] (-570.766) (-575.678) * [-570.623] (-573.120) (-570.382) (-572.894) -- 0:00:19
Average standard deviation of split frequencies: 0.013978
200500 -- (-575.201) [-572.224] (-571.590) (-570.046) * (-570.203) [-571.231] (-571.132) (-571.341) -- 0:00:19
201000 -- (-573.013) (-572.021) [-569.228] (-570.239) * (-572.433) [-570.657] (-569.769) (-571.383) -- 0:00:19
201500 -- (-572.754) (-569.287) [-570.978] (-569.509) * (-575.272) [-570.589] (-573.931) (-577.920) -- 0:00:19
202000 -- (-570.603) [-575.184] (-571.950) (-569.340) * (-573.528) (-570.560) [-574.981] (-572.358) -- 0:00:19
202500 -- (-570.687) (-570.721) [-572.782] (-572.644) * [-576.222] (-571.680) (-570.155) (-570.096) -- 0:00:19
203000 -- (-570.554) (-569.456) (-575.069) [-570.650] * [-571.345] (-571.177) (-571.051) (-569.207) -- 0:00:19
203500 -- (-570.370) (-572.352) (-571.174) [-568.957] * [-572.821] (-571.106) (-574.187) (-573.772) -- 0:00:18
204000 -- (-570.472) (-577.895) (-576.706) [-570.604] * (-573.543) (-572.078) [-573.333] (-572.527) -- 0:00:18
204500 -- (-572.111) (-573.909) [-569.292] (-575.147) * (-571.002) (-570.293) (-576.158) [-571.583] -- 0:00:20
205000 -- (-572.695) (-573.186) [-571.050] (-575.293) * [-570.600] (-574.248) (-573.283) (-572.854) -- 0:00:20
Average standard deviation of split frequencies: 0.015447
205500 -- (-570.633) (-571.408) [-569.155] (-570.950) * (-573.393) [-571.456] (-577.819) (-570.507) -- 0:00:20
206000 -- (-571.956) [-571.761] (-570.517) (-572.431) * (-571.647) (-571.170) (-572.467) [-570.405] -- 0:00:19
206500 -- (-572.225) [-570.107] (-570.517) (-571.039) * (-574.550) (-569.939) (-572.447) [-570.055] -- 0:00:19
207000 -- (-570.293) (-575.367) (-570.588) [-575.787] * [-576.348] (-572.402) (-571.405) (-578.236) -- 0:00:19
207500 -- (-571.853) [-573.870] (-569.687) (-572.088) * (-569.787) (-571.109) [-571.399] (-569.251) -- 0:00:19
208000 -- (-576.026) (-571.324) [-569.924] (-570.064) * (-573.803) (-572.251) (-572.675) [-570.574] -- 0:00:19
208500 -- (-570.973) (-572.766) [-570.309] (-572.619) * [-574.044] (-569.849) (-573.326) (-569.954) -- 0:00:19
209000 -- (-569.706) (-571.858) [-569.414] (-574.463) * (-570.722) [-571.825] (-574.311) (-576.534) -- 0:00:19
209500 -- (-577.549) (-571.309) (-571.851) [-572.709] * (-571.250) (-574.158) [-569.732] (-571.984) -- 0:00:19
210000 -- (-573.715) (-569.453) (-569.354) [-574.611] * (-572.430) [-570.648] (-572.363) (-569.850) -- 0:00:19
Average standard deviation of split frequencies: 0.015216
210500 -- (-570.553) [-571.824] (-569.252) (-570.297) * (-579.081) [-572.745] (-569.334) (-573.167) -- 0:00:19
211000 -- (-569.212) [-570.532] (-569.951) (-573.944) * (-571.455) (-570.029) (-570.628) [-570.254] -- 0:00:19
211500 -- (-573.406) (-571.487) (-569.708) [-569.619] * (-572.270) [-572.311] (-572.596) (-569.196) -- 0:00:19
212000 -- (-570.177) (-570.534) (-569.069) [-569.815] * [-569.634] (-570.945) (-573.765) (-569.597) -- 0:00:19
212500 -- (-570.834) (-570.868) (-572.805) [-572.956] * [-570.912] (-569.789) (-570.171) (-573.099) -- 0:00:18
213000 -- (-569.899) (-570.773) [-569.423] (-570.669) * (-569.151) (-570.419) (-570.452) [-570.530] -- 0:00:18
213500 -- (-574.505) (-572.828) [-569.008] (-570.758) * (-569.918) (-571.061) [-569.369] (-572.888) -- 0:00:18
214000 -- (-573.305) (-573.463) [-569.534] (-570.732) * [-570.895] (-570.531) (-570.209) (-573.368) -- 0:00:18
214500 -- (-572.508) [-569.199] (-568.868) (-571.044) * (-569.909) (-572.712) [-569.467] (-575.766) -- 0:00:18
215000 -- (-569.300) [-570.529] (-570.739) (-570.375) * (-570.603) (-571.230) [-571.824] (-570.514) -- 0:00:18
Average standard deviation of split frequencies: 0.014513
215500 -- (-571.073) (-571.887) [-572.517] (-569.011) * [-570.486] (-570.955) (-569.424) (-571.584) -- 0:00:18
216000 -- (-574.346) (-569.333) (-570.371) [-571.011] * [-573.330] (-571.163) (-569.513) (-575.070) -- 0:00:18
216500 -- (-571.986) (-574.504) (-569.565) [-569.296] * (-573.327) (-574.625) [-571.641] (-572.063) -- 0:00:18
217000 -- (-569.008) (-571.348) (-571.764) [-571.862] * (-570.453) (-568.984) (-570.536) [-571.145] -- 0:00:18
217500 -- (-569.457) [-569.095] (-570.529) (-570.538) * (-570.817) (-569.232) (-571.393) [-571.872] -- 0:00:18
218000 -- (-569.007) [-570.511] (-571.392) (-571.506) * [-569.477] (-571.437) (-571.003) (-570.043) -- 0:00:18
218500 -- [-569.212] (-576.081) (-573.750) (-570.106) * (-571.237) (-571.431) (-569.293) [-569.849] -- 0:00:18
219000 -- (-573.553) [-573.602] (-569.193) (-570.523) * [-569.377] (-576.071) (-571.202) (-570.096) -- 0:00:17
219500 -- (-570.840) [-571.215] (-573.211) (-570.116) * (-568.793) (-570.962) (-571.282) [-570.850] -- 0:00:17
220000 -- (-571.801) (-569.202) [-575.215] (-569.343) * [-570.191] (-570.556) (-573.025) (-574.225) -- 0:00:17
Average standard deviation of split frequencies: 0.014313
220500 -- (-571.519) [-571.426] (-574.483) (-570.417) * (-570.489) [-569.656] (-574.834) (-572.614) -- 0:00:19
221000 -- (-570.308) (-571.702) [-573.790] (-569.049) * (-577.252) (-573.202) (-572.584) [-574.215] -- 0:00:18
221500 -- (-570.516) [-572.294] (-573.907) (-570.934) * [-574.567] (-571.364) (-570.063) (-571.720) -- 0:00:18
222000 -- [-571.476] (-572.346) (-571.212) (-574.020) * (-572.839) (-572.693) [-569.012] (-572.090) -- 0:00:18
222500 -- [-570.224] (-572.814) (-573.351) (-572.739) * (-576.456) [-569.158] (-571.145) (-570.550) -- 0:00:18
223000 -- (-571.641) (-572.041) (-571.915) [-572.222] * (-576.049) (-571.614) [-569.754] (-570.869) -- 0:00:18
223500 -- [-569.737] (-568.777) (-572.793) (-570.511) * (-573.238) (-571.385) (-573.011) [-571.511] -- 0:00:18
224000 -- [-571.027] (-571.073) (-571.810) (-571.615) * (-573.362) (-572.697) (-573.185) [-570.281] -- 0:00:18
224500 -- (-577.651) (-569.330) (-570.866) [-571.301] * (-570.146) (-571.831) [-571.787] (-571.697) -- 0:00:18
225000 -- (-570.430) [-573.017] (-572.627) (-571.784) * (-570.724) (-570.938) (-570.943) [-571.092] -- 0:00:18
Average standard deviation of split frequencies: 0.014288
225500 -- (-569.916) (-568.963) (-574.134) [-571.855] * [-571.800] (-570.620) (-570.057) (-571.802) -- 0:00:18
226000 -- (-571.148) [-568.723] (-576.631) (-571.783) * [-570.573] (-569.196) (-569.794) (-572.341) -- 0:00:18
226500 -- (-570.381) (-570.196) (-576.200) [-571.278] * (-570.968) [-570.729] (-571.016) (-570.770) -- 0:00:18
227000 -- (-571.903) (-571.056) [-573.522] (-570.714) * (-572.234) (-572.935) [-572.552] (-569.348) -- 0:00:18
227500 -- (-573.482) (-572.891) [-575.448] (-570.587) * (-574.454) [-572.140] (-575.964) (-569.541) -- 0:00:17
228000 -- [-570.770] (-571.212) (-574.162) (-569.355) * (-569.970) (-571.523) (-575.361) [-570.070] -- 0:00:17
228500 -- (-570.837) (-573.433) (-571.059) [-569.011] * (-571.910) (-572.735) [-572.395] (-569.088) -- 0:00:17
229000 -- [-569.299] (-573.363) (-574.061) (-571.552) * (-571.520) [-568.889] (-577.377) (-569.159) -- 0:00:17
229500 -- (-571.347) (-570.910) (-569.759) [-571.347] * (-569.375) (-569.384) (-577.306) [-569.566] -- 0:00:17
230000 -- (-579.578) (-575.006) [-569.128] (-572.037) * (-569.444) (-571.905) (-577.355) [-569.942] -- 0:00:17
Average standard deviation of split frequencies: 0.015274
230500 -- (-569.041) (-574.067) (-569.383) [-570.681] * (-570.876) [-571.897] (-573.173) (-571.078) -- 0:00:17
231000 -- [-574.428] (-569.207) (-569.848) (-570.360) * [-572.469] (-571.389) (-569.866) (-572.750) -- 0:00:17
231500 -- (-570.205) [-569.836] (-571.361) (-569.772) * (-571.266) [-571.231] (-572.121) (-570.054) -- 0:00:17
232000 -- (-570.478) (-569.958) [-571.536] (-571.036) * (-569.813) (-572.020) [-570.273] (-573.928) -- 0:00:17
232500 -- [-571.866] (-571.615) (-572.161) (-570.623) * (-571.802) (-570.787) [-571.497] (-569.607) -- 0:00:17
233000 -- [-570.257] (-574.174) (-569.295) (-568.842) * (-571.800) (-571.367) [-570.512] (-570.093) -- 0:00:17
233500 -- (-570.791) (-571.054) (-570.389) [-572.918] * (-575.957) [-570.723] (-571.076) (-571.818) -- 0:00:17
234000 -- [-569.402] (-572.931) (-572.454) (-573.702) * [-570.134] (-569.263) (-570.191) (-571.090) -- 0:00:17
234500 -- (-569.235) [-569.067] (-570.168) (-572.035) * (-573.085) [-570.996] (-569.740) (-571.164) -- 0:00:16
235000 -- (-569.525) (-571.846) (-571.142) [-570.904] * (-576.657) (-569.971) [-571.811] (-572.646) -- 0:00:16
Average standard deviation of split frequencies: 0.013882
235500 -- (-573.715) (-572.900) (-571.920) [-570.353] * [-572.339] (-569.340) (-572.280) (-571.782) -- 0:00:16
236000 -- (-574.352) (-573.699) (-571.362) [-572.329] * (-570.719) (-575.294) [-570.979] (-571.773) -- 0:00:16
236500 -- [-571.393] (-574.500) (-572.846) (-571.758) * [-569.354] (-573.040) (-572.020) (-569.567) -- 0:00:17
237000 -- [-569.544] (-572.009) (-573.408) (-571.454) * (-570.376) (-573.983) [-571.428] (-571.136) -- 0:00:17
237500 -- (-569.358) (-571.716) (-572.610) [-572.393] * (-572.387) (-570.762) (-569.853) [-574.759] -- 0:00:17
238000 -- [-570.391] (-569.531) (-570.234) (-569.892) * [-569.726] (-569.815) (-569.599) (-571.816) -- 0:00:17
238500 -- (-570.345) (-570.257) (-568.916) [-573.004] * [-570.375] (-572.861) (-569.821) (-570.348) -- 0:00:17
239000 -- [-571.067] (-570.143) (-570.841) (-571.798) * (-571.129) (-572.305) (-574.929) [-571.660] -- 0:00:17
239500 -- (-570.523) (-570.283) (-570.595) [-571.383] * [-570.693] (-572.892) (-570.835) (-569.932) -- 0:00:17
240000 -- [-571.249] (-572.708) (-571.119) (-572.900) * (-569.309) (-571.560) (-570.214) [-573.522] -- 0:00:17
Average standard deviation of split frequencies: 0.014433
240500 -- (-572.547) [-571.154] (-574.367) (-577.806) * (-570.114) (-571.904) (-570.028) [-570.794] -- 0:00:17
241000 -- (-569.333) (-572.715) (-573.717) [-571.109] * (-571.222) (-572.538) [-572.014] (-572.154) -- 0:00:17
241500 -- (-569.471) (-569.449) [-570.103] (-574.510) * [-572.818] (-569.138) (-571.248) (-574.027) -- 0:00:17
242000 -- (-571.895) (-569.655) [-572.653] (-571.105) * (-570.892) (-569.380) (-572.572) [-570.557] -- 0:00:17
242500 -- (-575.217) (-570.059) (-570.730) [-571.024] * (-572.352) [-570.795] (-573.031) (-569.423) -- 0:00:16
243000 -- (-572.258) (-570.898) [-571.647] (-569.303) * (-572.235) [-569.842] (-569.922) (-570.216) -- 0:00:16
243500 -- [-569.939] (-578.083) (-570.200) (-573.372) * (-572.171) (-574.293) [-572.041] (-572.247) -- 0:00:16
244000 -- (-571.103) (-570.703) (-570.468) [-571.309] * (-572.283) [-570.799] (-571.745) (-575.176) -- 0:00:16
244500 -- (-571.237) (-568.931) [-570.023] (-570.318) * (-575.657) [-571.066] (-570.698) (-568.837) -- 0:00:16
245000 -- (-573.365) [-569.494] (-572.981) (-572.208) * [-575.623] (-571.330) (-572.006) (-570.811) -- 0:00:16
Average standard deviation of split frequencies: 0.014523
245500 -- (-572.596) (-569.644) [-574.506] (-571.251) * (-571.405) (-571.379) [-570.169] (-571.105) -- 0:00:16
246000 -- (-570.519) (-569.333) (-571.606) [-570.715] * (-569.918) (-573.171) (-574.974) [-571.318] -- 0:00:16
246500 -- (-571.859) [-570.907] (-574.414) (-570.246) * [-570.255] (-574.397) (-573.093) (-577.116) -- 0:00:16
247000 -- (-571.819) (-573.474) (-569.319) [-569.578] * (-569.671) (-572.412) (-571.059) [-571.353] -- 0:00:16
247500 -- [-570.917] (-571.880) (-570.832) (-570.795) * (-571.962) (-572.304) (-570.920) [-572.229] -- 0:00:16
248000 -- (-570.968) [-573.067] (-568.992) (-572.296) * (-573.876) [-573.319] (-573.333) (-573.655) -- 0:00:16
248500 -- (-570.418) [-570.589] (-575.155) (-571.586) * [-570.706] (-570.149) (-573.321) (-574.464) -- 0:00:16
249000 -- (-571.185) [-568.920] (-569.895) (-572.447) * (-571.175) (-571.352) [-571.708] (-570.202) -- 0:00:16
249500 -- (-572.130) [-571.235] (-570.451) (-570.128) * (-570.638) (-572.900) [-571.508] (-570.170) -- 0:00:16
250000 -- [-570.066] (-571.517) (-572.095) (-570.296) * (-573.622) (-569.443) (-572.211) [-570.949] -- 0:00:16
Average standard deviation of split frequencies: 0.013373
250500 -- (-569.525) (-571.940) (-571.922) [-575.776] * (-571.914) (-571.686) (-570.383) [-571.867] -- 0:00:15
251000 -- (-568.962) [-573.376] (-571.222) (-570.346) * (-573.685) [-570.108] (-569.184) (-569.803) -- 0:00:15
251500 -- (-569.244) (-574.942) [-569.957] (-572.800) * (-568.742) [-570.310] (-570.478) (-574.189) -- 0:00:15
252000 -- [-570.579] (-569.553) (-570.355) (-569.534) * (-570.403) [-570.481] (-571.330) (-570.213) -- 0:00:16
252500 -- (-572.450) (-571.960) (-569.988) [-569.773] * [-570.592] (-571.189) (-570.809) (-569.921) -- 0:00:16
253000 -- (-570.421) [-572.802] (-571.677) (-571.528) * [-569.966] (-572.097) (-572.708) (-569.599) -- 0:00:16
253500 -- [-570.872] (-570.438) (-572.304) (-572.319) * [-570.279] (-574.142) (-573.091) (-571.040) -- 0:00:16
254000 -- (-571.886) (-574.113) (-573.191) [-574.780] * (-571.486) (-572.416) (-571.754) [-571.646] -- 0:00:16
254500 -- (-570.255) (-576.412) [-569.628] (-573.533) * (-570.599) (-576.571) (-569.316) [-571.208] -- 0:00:16
255000 -- [-570.173] (-577.931) (-571.680) (-570.612) * (-569.568) (-574.778) [-570.854] (-570.848) -- 0:00:16
Average standard deviation of split frequencies: 0.012276
255500 -- [-572.522] (-574.816) (-569.534) (-569.455) * [-569.932] (-571.563) (-569.595) (-574.270) -- 0:00:16
256000 -- [-570.642] (-570.676) (-572.007) (-571.478) * (-570.560) [-570.362] (-574.299) (-570.228) -- 0:00:16
256500 -- (-570.138) [-571.413] (-569.141) (-575.723) * (-575.727) (-571.206) [-570.395] (-569.048) -- 0:00:16
257000 -- (-573.102) (-568.681) (-572.392) [-570.743] * (-570.173) [-574.327] (-570.448) (-572.390) -- 0:00:16
257500 -- (-571.019) [-569.737] (-572.339) (-570.190) * (-573.585) (-573.182) [-570.779] (-571.365) -- 0:00:16
258000 -- [-570.813] (-570.136) (-574.389) (-569.902) * (-570.243) [-572.953] (-571.809) (-571.409) -- 0:00:15
258500 -- (-570.605) (-572.725) (-572.414) [-570.933] * (-570.046) (-572.951) [-569.235] (-570.532) -- 0:00:15
259000 -- [-575.280] (-571.862) (-570.858) (-570.279) * (-570.168) (-572.349) [-569.560] (-571.573) -- 0:00:15
259500 -- [-576.043] (-569.613) (-578.612) (-572.691) * (-571.256) (-571.423) (-570.318) [-570.194] -- 0:00:15
260000 -- (-569.327) (-569.808) (-575.542) [-573.043] * (-571.433) (-571.183) [-569.882] (-572.430) -- 0:00:15
Average standard deviation of split frequencies: 0.010549
260500 -- (-570.299) [-572.843] (-572.321) (-573.320) * (-572.068) [-570.658] (-570.720) (-570.088) -- 0:00:15
261000 -- [-571.279] (-569.829) (-571.772) (-575.953) * (-574.087) (-572.067) (-571.820) [-570.758] -- 0:00:15
261500 -- (-574.104) (-572.121) (-571.440) [-572.013] * (-571.259) (-573.332) (-571.230) [-569.633] -- 0:00:15
262000 -- (-574.818) (-571.127) [-573.133] (-572.406) * [-572.745] (-571.392) (-571.506) (-569.322) -- 0:00:15
262500 -- (-570.675) (-576.529) [-574.251] (-570.662) * (-570.452) [-569.916] (-573.076) (-573.108) -- 0:00:15
263000 -- [-571.201] (-572.966) (-570.419) (-571.012) * [-570.600] (-573.834) (-570.555) (-577.996) -- 0:00:15
263500 -- (-569.966) (-574.469) [-569.350] (-573.636) * (-575.445) (-572.156) [-570.950] (-573.284) -- 0:00:15
264000 -- (-569.607) [-570.231] (-570.810) (-572.887) * (-573.906) (-571.865) (-574.605) [-577.041] -- 0:00:15
264500 -- (-572.807) (-570.485) [-572.565] (-570.972) * (-574.993) (-573.375) [-570.992] (-571.544) -- 0:00:15
265000 -- (-570.075) (-569.769) (-571.377) [-570.763] * [-571.272] (-570.060) (-571.394) (-569.991) -- 0:00:15
Average standard deviation of split frequencies: 0.012126
265500 -- (-574.738) (-574.039) (-576.004) [-572.335] * (-574.480) [-570.441] (-571.032) (-569.841) -- 0:00:15
266000 -- [-569.885] (-571.394) (-569.888) (-571.567) * (-577.502) (-571.570) [-570.737] (-569.337) -- 0:00:15
266500 -- (-569.458) (-570.448) [-569.293] (-570.740) * [-573.490] (-569.706) (-569.910) (-571.536) -- 0:00:15
267000 -- [-569.944] (-573.094) (-573.188) (-570.853) * (-571.630) (-571.202) [-569.985] (-575.090) -- 0:00:15
267500 -- (-568.885) (-572.474) (-571.457) [-572.127] * [-572.231] (-571.443) (-569.292) (-570.852) -- 0:00:15
268000 -- (-571.197) (-569.950) (-574.055) [-570.573] * (-570.124) (-569.775) (-571.390) [-569.786] -- 0:00:15
268500 -- [-570.448] (-569.591) (-572.164) (-569.848) * (-571.958) [-570.928] (-570.521) (-570.742) -- 0:00:15
269000 -- [-569.969] (-571.176) (-573.547) (-574.617) * (-575.778) (-569.860) [-571.112] (-571.782) -- 0:00:15
269500 -- (-570.463) (-571.219) [-569.563] (-576.330) * (-570.018) [-570.017] (-570.179) (-571.657) -- 0:00:15
270000 -- (-571.700) [-570.637] (-570.863) (-571.079) * (-572.704) [-571.763] (-573.419) (-576.392) -- 0:00:15
Average standard deviation of split frequencies: 0.011708
270500 -- (-571.387) (-569.513) [-569.949] (-570.028) * (-575.018) (-570.294) [-570.368] (-570.753) -- 0:00:15
271000 -- (-573.168) [-572.446] (-570.331) (-573.089) * (-571.281) (-570.483) [-574.258] (-570.228) -- 0:00:15
271500 -- (-572.479) [-571.235] (-569.117) (-573.192) * (-574.170) (-568.920) [-570.517] (-572.169) -- 0:00:15
272000 -- (-573.767) (-570.857) [-569.333] (-572.921) * (-571.833) (-569.760) (-571.303) [-568.904] -- 0:00:15
272500 -- (-572.213) (-571.909) [-569.265] (-578.366) * (-573.914) (-569.024) [-575.669] (-569.843) -- 0:00:15
273000 -- (-571.974) (-572.985) [-569.821] (-574.858) * (-569.928) [-569.024] (-569.374) (-571.257) -- 0:00:14
273500 -- (-570.563) [-571.938] (-572.492) (-571.019) * (-571.946) (-570.622) [-571.931] (-575.114) -- 0:00:14
274000 -- (-575.500) [-571.277] (-571.225) (-569.514) * (-570.467) [-572.665] (-573.035) (-572.207) -- 0:00:14
274500 -- [-571.105] (-570.122) (-574.063) (-570.334) * (-571.620) [-575.247] (-572.396) (-572.193) -- 0:00:14
275000 -- (-575.011) (-569.329) [-569.999] (-570.832) * (-571.884) (-572.993) [-571.453] (-570.790) -- 0:00:14
Average standard deviation of split frequencies: 0.011292
275500 -- (-572.877) (-570.328) [-569.667] (-573.405) * [-573.176] (-570.297) (-571.866) (-572.198) -- 0:00:14
276000 -- (-571.009) (-572.650) [-572.602] (-574.133) * [-571.604] (-571.686) (-572.386) (-569.173) -- 0:00:14
276500 -- (-574.212) (-570.212) (-572.173) [-571.907] * (-570.955) (-571.034) [-570.936] (-571.499) -- 0:00:14
277000 -- (-573.864) (-571.042) [-569.330] (-569.846) * (-571.529) (-573.359) [-574.170] (-571.404) -- 0:00:14
277500 -- [-572.912] (-572.901) (-572.519) (-569.768) * (-571.184) [-571.778] (-573.106) (-575.046) -- 0:00:14
278000 -- [-569.197] (-572.644) (-570.987) (-569.128) * (-571.776) (-571.690) (-575.998) [-579.995] -- 0:00:14
278500 -- [-570.326] (-571.891) (-571.932) (-569.213) * [-571.723] (-573.875) (-570.977) (-569.213) -- 0:00:14
279000 -- (-570.161) (-571.537) [-571.758] (-569.930) * (-571.878) (-571.815) (-570.421) [-573.240] -- 0:00:14
279500 -- (-570.231) [-570.298] (-573.491) (-575.192) * (-571.014) [-569.701] (-571.239) (-572.906) -- 0:00:14
280000 -- (-570.610) (-569.245) [-571.267] (-572.600) * (-571.811) [-570.040] (-571.328) (-570.571) -- 0:00:14
Average standard deviation of split frequencies: 0.011477
280500 -- (-571.438) [-568.756] (-570.931) (-570.755) * [-569.218] (-573.089) (-569.573) (-570.767) -- 0:00:14
281000 -- (-572.833) (-569.612) (-569.694) [-570.790] * [-571.838] (-571.228) (-571.914) (-575.551) -- 0:00:14
281500 -- (-569.664) (-570.541) [-570.046] (-572.557) * (-572.144) (-570.450) (-574.189) [-570.724] -- 0:00:14
282000 -- (-572.341) (-569.718) (-569.849) [-571.722] * (-571.957) (-570.614) [-571.321] (-570.885) -- 0:00:14
282500 -- (-570.976) [-570.948] (-569.738) (-575.863) * (-571.125) (-570.007) [-572.592] (-570.688) -- 0:00:14
283000 -- (-570.563) [-569.416] (-570.892) (-570.963) * (-571.546) (-573.551) (-575.514) [-571.235] -- 0:00:14
283500 -- (-571.198) (-570.623) (-570.688) [-570.459] * (-572.325) (-571.147) [-571.675] (-570.327) -- 0:00:14
284000 -- (-570.420) [-570.365] (-572.237) (-570.219) * (-570.609) (-570.115) (-569.354) [-570.728] -- 0:00:14
284500 -- (-572.438) [-570.441] (-571.280) (-570.735) * (-576.500) (-571.582) (-570.399) [-568.805] -- 0:00:14
285000 -- (-573.201) (-571.723) [-570.822] (-570.267) * (-578.366) (-572.873) (-574.353) [-571.287] -- 0:00:14
Average standard deviation of split frequencies: 0.010531
285500 -- [-571.580] (-570.008) (-571.423) (-572.608) * (-573.007) [-570.404] (-570.563) (-580.466) -- 0:00:14
286000 -- (-572.843) (-570.338) [-574.201] (-571.235) * (-574.395) (-571.052) [-570.970] (-574.228) -- 0:00:14
286500 -- (-570.277) (-572.697) [-571.057] (-571.023) * (-570.946) (-569.742) (-570.713) [-572.016] -- 0:00:14
287000 -- (-571.087) [-572.691] (-573.515) (-570.556) * (-570.118) [-570.589] (-575.030) (-571.614) -- 0:00:14
287500 -- (-570.903) (-572.357) (-572.090) [-570.803] * [-570.562] (-572.508) (-571.309) (-570.896) -- 0:00:14
288000 -- [-572.027] (-572.159) (-571.757) (-569.649) * (-572.133) (-572.566) (-570.532) [-572.267] -- 0:00:13
288500 -- (-571.368) (-575.476) [-570.627] (-572.615) * (-570.908) (-571.609) (-570.894) [-570.893] -- 0:00:13
289000 -- (-570.028) [-570.816] (-571.907) (-575.455) * (-573.464) (-571.309) (-571.510) [-569.692] -- 0:00:13
289500 -- (-569.136) [-570.304] (-570.405) (-570.379) * (-570.386) (-573.504) [-571.690] (-570.043) -- 0:00:13
290000 -- (-573.697) (-570.271) [-570.542] (-570.589) * (-574.324) (-569.424) (-572.904) [-569.414] -- 0:00:13
Average standard deviation of split frequencies: 0.010271
290500 -- [-570.217] (-576.598) (-570.061) (-569.816) * [-572.040] (-574.224) (-570.379) (-575.551) -- 0:00:13
291000 -- (-570.691) (-570.391) [-570.011] (-570.444) * (-573.587) [-571.710] (-569.290) (-568.892) -- 0:00:13
291500 -- (-570.042) (-571.621) [-570.250] (-570.108) * [-572.018] (-570.301) (-572.480) (-570.366) -- 0:00:13
292000 -- (-571.615) (-569.607) [-571.526] (-572.255) * (-579.634) (-569.693) [-569.827] (-571.233) -- 0:00:13
292500 -- (-569.609) [-570.846] (-569.229) (-569.819) * (-574.012) (-569.193) (-571.753) [-570.405] -- 0:00:13
293000 -- (-570.900) (-570.387) (-573.126) [-572.301] * (-571.693) (-569.622) (-574.575) [-573.324] -- 0:00:13
293500 -- (-570.914) (-570.306) [-571.780] (-575.189) * (-569.960) (-571.056) [-571.449] (-572.231) -- 0:00:13
294000 -- [-570.216] (-570.094) (-571.334) (-571.552) * (-570.129) [-570.584] (-569.814) (-572.784) -- 0:00:13
294500 -- (-569.949) (-571.298) [-569.656] (-568.860) * (-573.172) (-573.799) [-569.443] (-573.171) -- 0:00:13
295000 -- (-570.947) (-571.153) [-571.207] (-569.962) * (-572.262) [-573.630] (-570.529) (-569.916) -- 0:00:13
Average standard deviation of split frequencies: 0.010086
295500 -- (-572.264) [-571.498] (-569.696) (-570.343) * (-569.598) (-572.626) (-570.931) [-569.910] -- 0:00:13
296000 -- (-572.104) [-569.968] (-571.868) (-570.357) * [-569.494] (-569.090) (-573.324) (-571.630) -- 0:00:13
296500 -- (-570.344) (-571.545) (-576.669) [-569.820] * (-572.077) (-569.263) (-572.449) [-570.339] -- 0:00:13
297000 -- (-571.525) (-574.392) (-574.674) [-572.727] * (-569.210) [-570.239] (-577.240) (-570.972) -- 0:00:13
297500 -- [-571.228] (-572.404) (-569.484) (-570.698) * [-571.256] (-570.720) (-571.311) (-574.306) -- 0:00:13
298000 -- [-570.993] (-572.654) (-569.882) (-572.337) * (-573.768) (-570.921) [-569.769] (-574.896) -- 0:00:13
298500 -- (-571.804) (-571.843) (-571.013) [-573.668] * (-571.072) (-576.412) (-570.978) [-572.334] -- 0:00:13
299000 -- (-571.582) (-571.384) [-570.175] (-570.718) * [-571.072] (-574.975) (-572.054) (-573.010) -- 0:00:13
299500 -- (-572.244) [-570.268] (-575.892) (-569.477) * [-569.327] (-576.513) (-569.681) (-571.958) -- 0:00:13
300000 -- (-570.468) [-569.344] (-573.787) (-570.284) * (-571.053) (-574.338) [-572.755] (-570.915) -- 0:00:13
Average standard deviation of split frequencies: 0.010365
300500 -- [-570.186] (-573.898) (-569.921) (-572.323) * (-571.599) (-576.185) [-575.578] (-572.343) -- 0:00:13
301000 -- (-571.120) [-570.494] (-573.289) (-570.594) * (-571.439) (-570.618) (-573.472) [-571.590] -- 0:00:13
301500 -- [-570.892] (-573.755) (-578.955) (-570.891) * (-573.023) [-570.209] (-572.520) (-570.896) -- 0:00:13
302000 -- (-571.966) (-572.536) (-576.158) [-570.726] * [-575.105] (-569.591) (-569.526) (-571.753) -- 0:00:13
302500 -- (-569.989) (-569.719) (-575.542) [-570.886] * (-573.985) [-570.194] (-570.823) (-572.601) -- 0:00:13
303000 -- [-573.350] (-569.912) (-570.553) (-573.061) * (-570.599) [-571.268] (-571.576) (-575.399) -- 0:00:13
303500 -- (-570.011) [-570.660] (-569.991) (-570.510) * (-572.538) (-573.433) (-572.054) [-569.610] -- 0:00:12
304000 -- (-570.032) (-572.205) (-570.300) [-569.665] * (-572.000) (-571.044) (-572.077) [-570.992] -- 0:00:12
304500 -- (-578.380) (-569.876) (-571.223) [-573.221] * (-572.681) (-569.831) [-571.505] (-571.621) -- 0:00:12
305000 -- (-570.963) (-572.148) [-570.483] (-571.293) * (-572.905) (-570.756) [-571.079] (-572.177) -- 0:00:12
Average standard deviation of split frequencies: 0.009842
305500 -- (-570.481) [-572.070] (-571.111) (-570.937) * (-570.771) (-569.919) [-568.844] (-572.026) -- 0:00:12
306000 -- (-569.435) (-570.884) (-571.690) [-571.511] * (-569.640) [-570.090] (-568.993) (-571.273) -- 0:00:12
306500 -- [-573.007] (-570.616) (-575.423) (-571.312) * [-571.876] (-570.613) (-570.086) (-576.483) -- 0:00:12
307000 -- [-572.090] (-569.903) (-573.492) (-572.799) * [-571.324] (-569.579) (-570.584) (-572.510) -- 0:00:12
307500 -- (-571.204) (-569.221) (-572.716) [-571.022] * (-574.453) (-573.415) [-571.157] (-574.193) -- 0:00:12
308000 -- (-572.675) (-569.768) [-572.513] (-572.006) * [-569.909] (-570.238) (-575.197) (-578.674) -- 0:00:12
308500 -- (-571.847) [-574.422] (-571.855) (-572.583) * (-569.744) (-569.793) (-569.881) [-571.757] -- 0:00:12
309000 -- (-570.449) (-570.990) (-574.051) [-570.281] * (-571.419) (-574.144) (-569.414) [-574.564] -- 0:00:12
309500 -- (-570.895) [-570.722] (-573.368) (-570.191) * [-572.439] (-571.488) (-569.461) (-571.307) -- 0:00:12
310000 -- [-572.996] (-570.270) (-575.732) (-570.432) * [-573.858] (-570.713) (-570.349) (-570.739) -- 0:00:12
Average standard deviation of split frequencies: 0.010369
310500 -- (-570.532) (-569.391) [-570.412] (-575.235) * (-572.418) (-569.996) [-570.526] (-571.205) -- 0:00:12
311000 -- [-571.487] (-572.212) (-570.282) (-572.586) * (-571.665) (-571.595) [-571.352] (-570.483) -- 0:00:12
311500 -- (-572.253) (-571.313) (-569.481) [-571.267] * (-571.568) (-574.785) [-571.957] (-573.257) -- 0:00:12
312000 -- (-569.973) (-574.741) (-570.818) [-571.606] * (-571.901) (-570.685) [-573.611] (-569.441) -- 0:00:12
312500 -- (-569.315) (-576.158) (-573.460) [-573.301] * (-571.228) (-572.781) [-571.649] (-570.950) -- 0:00:12
313000 -- [-572.765] (-575.185) (-570.017) (-574.633) * (-571.224) (-576.468) (-571.246) [-570.575] -- 0:00:12
313500 -- (-571.527) [-569.791] (-570.245) (-576.072) * (-569.840) (-573.381) [-569.762] (-569.276) -- 0:00:12
314000 -- (-571.669) (-569.031) (-570.012) [-570.424] * (-569.045) (-571.484) (-575.728) [-573.678] -- 0:00:12
314500 -- (-569.997) (-569.780) (-574.463) [-569.802] * (-570.707) (-571.202) [-573.225] (-575.182) -- 0:00:12
315000 -- (-572.643) [-569.516] (-572.300) (-570.811) * (-570.638) (-571.208) (-569.199) [-574.730] -- 0:00:12
Average standard deviation of split frequencies: 0.010111
315500 -- (-570.154) (-570.039) (-572.190) [-570.307] * [-572.359] (-572.299) (-570.111) (-575.531) -- 0:00:12
316000 -- (-569.243) [-571.368] (-569.828) (-569.951) * (-574.984) [-570.348] (-573.315) (-573.589) -- 0:00:12
316500 -- [-569.554] (-570.533) (-569.596) (-572.184) * (-570.684) (-575.258) [-572.075] (-570.740) -- 0:00:12
317000 -- (-572.694) [-571.476] (-569.666) (-569.819) * (-570.267) (-576.534) (-573.280) [-571.386] -- 0:00:12
317500 -- (-569.516) (-568.949) (-569.870) [-570.095] * (-571.948) (-572.441) (-573.997) [-572.213] -- 0:00:12
318000 -- (-571.240) [-570.366] (-571.722) (-569.717) * (-571.199) [-570.820] (-572.186) (-570.211) -- 0:00:12
318500 -- (-572.726) (-570.893) (-573.681) [-569.965] * (-569.887) (-573.544) [-573.293] (-569.984) -- 0:00:11
319000 -- (-571.037) (-571.215) [-568.946] (-570.581) * (-571.602) (-571.517) (-573.407) [-569.445] -- 0:00:11
319500 -- (-574.071) (-572.323) (-571.135) [-569.196] * (-571.841) (-570.491) (-573.542) [-568.991] -- 0:00:11
320000 -- (-570.257) (-571.548) (-572.268) [-570.329] * [-572.346] (-569.789) (-572.795) (-573.478) -- 0:00:11
Average standard deviation of split frequencies: 0.008820
320500 -- (-571.092) [-570.260] (-572.389) (-570.988) * (-572.658) [-569.932] (-569.303) (-574.675) -- 0:00:11
321000 -- [-572.319] (-571.463) (-574.480) (-569.429) * (-571.438) (-570.760) [-569.745] (-573.549) -- 0:00:11
321500 -- (-575.822) (-572.350) (-575.992) [-569.482] * (-572.802) [-570.956] (-574.090) (-571.485) -- 0:00:11
322000 -- [-572.569] (-573.037) (-572.706) (-569.439) * (-573.267) (-570.242) [-571.798] (-572.852) -- 0:00:11
322500 -- (-573.186) (-573.678) [-570.100] (-573.115) * (-572.937) [-572.252] (-571.546) (-570.301) -- 0:00:11
323000 -- (-574.360) [-569.688] (-572.135) (-575.414) * (-572.175) (-569.361) (-570.249) [-570.957] -- 0:00:11
323500 -- (-574.108) [-572.623] (-571.238) (-576.167) * (-571.123) (-570.287) [-571.525] (-575.635) -- 0:00:11
324000 -- [-573.273] (-571.178) (-569.394) (-569.508) * (-571.991) (-569.678) [-570.725] (-577.303) -- 0:00:11
324500 -- (-569.840) (-570.794) [-573.438] (-579.383) * (-569.320) (-570.421) (-569.537) [-572.336] -- 0:00:11
325000 -- (-572.386) [-570.624] (-570.807) (-573.377) * (-571.526) (-569.694) [-569.543] (-572.293) -- 0:00:11
Average standard deviation of split frequencies: 0.009721
325500 -- (-570.585) (-573.813) [-572.813] (-570.126) * [-570.282] (-569.065) (-571.858) (-571.441) -- 0:00:11
326000 -- (-571.720) (-569.079) (-571.048) [-571.058] * [-570.353] (-569.862) (-571.511) (-569.084) -- 0:00:11
326500 -- (-571.614) (-569.888) [-570.333] (-571.228) * (-569.933) (-569.532) (-571.078) [-572.506] -- 0:00:11
327000 -- (-570.523) (-570.307) (-573.925) [-571.036] * (-571.994) (-572.763) (-571.453) [-571.610] -- 0:00:11
327500 -- (-569.412) (-570.845) [-570.288] (-570.469) * (-571.729) (-570.870) (-571.685) [-570.240] -- 0:00:11
328000 -- (-570.895) [-570.507] (-570.981) (-571.009) * [-572.826] (-573.663) (-571.622) (-570.632) -- 0:00:11
328500 -- (-570.317) [-571.772] (-570.642) (-572.812) * (-570.481) (-572.238) [-573.695] (-571.567) -- 0:00:11
329000 -- (-574.049) [-569.670] (-571.872) (-571.199) * [-569.408] (-570.706) (-574.768) (-572.329) -- 0:00:11
329500 -- [-572.548] (-573.856) (-581.498) (-572.140) * [-570.249] (-570.781) (-578.494) (-572.103) -- 0:00:11
330000 -- (-570.604) (-571.645) (-571.854) [-571.057] * [-570.401] (-571.517) (-572.973) (-573.306) -- 0:00:11
Average standard deviation of split frequencies: 0.011088
330500 -- (-570.848) (-569.632) (-570.190) [-569.898] * [-571.161] (-570.916) (-571.675) (-570.984) -- 0:00:11
331000 -- [-570.029] (-570.304) (-574.060) (-574.559) * (-570.773) (-573.076) (-574.794) [-569.836] -- 0:00:11
331500 -- [-571.029] (-573.036) (-572.527) (-574.694) * (-572.589) (-571.885) (-571.599) [-570.163] -- 0:00:11
332000 -- (-574.506) (-570.031) (-569.327) [-572.566] * (-574.786) [-573.929] (-570.861) (-568.782) -- 0:00:11
332500 -- (-571.925) (-569.712) [-570.390] (-570.483) * [-569.573] (-572.276) (-570.437) (-569.515) -- 0:00:11
333000 -- [-570.130] (-570.617) (-571.659) (-569.734) * (-570.029) (-570.530) (-571.673) [-569.863] -- 0:00:11
333500 -- (-569.979) (-570.494) (-571.467) [-570.126] * [-570.829] (-571.144) (-570.939) (-570.015) -- 0:00:10
334000 -- (-570.211) (-574.123) (-571.274) [-571.728] * (-572.923) (-571.747) [-569.349] (-570.218) -- 0:00:10
334500 -- [-570.792] (-571.602) (-570.332) (-571.047) * (-574.617) (-572.225) (-570.301) [-570.493] -- 0:00:10
335000 -- [-571.931] (-575.318) (-569.557) (-571.757) * (-571.407) (-571.220) [-568.939] (-569.994) -- 0:00:10
Average standard deviation of split frequencies: 0.011847
335500 -- (-572.313) (-569.319) (-572.540) [-571.261] * (-573.761) (-570.131) (-569.839) [-576.628] -- 0:00:10
336000 -- [-572.225] (-569.319) (-573.821) (-574.933) * (-570.186) [-574.088] (-569.542) (-575.644) -- 0:00:10
336500 -- (-570.078) (-571.706) (-571.968) [-571.985] * [-572.215] (-571.242) (-571.423) (-570.820) -- 0:00:10
337000 -- (-571.274) (-572.136) (-582.001) [-570.551] * (-571.385) (-571.542) [-572.521] (-570.193) -- 0:00:10
337500 -- (-572.352) (-574.290) (-569.996) [-571.613] * (-570.068) (-571.219) [-576.588] (-569.040) -- 0:00:10
338000 -- (-574.691) (-569.713) [-569.575] (-572.298) * (-570.864) (-571.098) (-571.129) [-569.382] -- 0:00:10
338500 -- (-574.277) [-569.709] (-580.164) (-572.440) * (-572.453) [-569.860] (-572.145) (-575.439) -- 0:00:10
339000 -- (-573.145) [-570.380] (-569.475) (-573.383) * (-571.450) (-571.358) [-570.474] (-569.353) -- 0:00:10
339500 -- [-573.421] (-569.902) (-570.294) (-573.282) * (-582.854) (-569.908) (-568.921) [-570.759] -- 0:00:10
340000 -- (-572.619) (-575.131) (-573.430) [-571.200] * (-574.013) [-572.550] (-569.249) (-569.758) -- 0:00:10
Average standard deviation of split frequencies: 0.011301
340500 -- [-570.971] (-571.579) (-570.940) (-571.038) * (-575.023) (-572.166) [-571.137] (-572.997) -- 0:00:10
341000 -- (-570.860) [-569.572] (-569.857) (-574.787) * [-571.911] (-573.015) (-569.809) (-571.968) -- 0:00:10
341500 -- (-570.185) (-568.919) (-570.704) [-571.197] * (-572.316) [-576.381] (-569.892) (-571.789) -- 0:00:10
342000 -- (-571.133) [-570.303] (-570.822) (-569.910) * [-572.324] (-574.548) (-569.443) (-570.307) -- 0:00:10
342500 -- [-573.414] (-570.628) (-570.216) (-569.723) * (-574.655) (-573.873) [-571.269] (-572.348) -- 0:00:10
343000 -- [-569.889] (-570.256) (-572.165) (-571.445) * (-571.045) (-570.744) [-569.226] (-573.894) -- 0:00:10
343500 -- (-569.669) (-569.768) [-569.642] (-570.878) * (-573.115) (-569.803) [-568.778] (-573.399) -- 0:00:10
344000 -- (-571.448) (-570.870) [-572.104] (-572.708) * (-573.337) (-571.091) [-570.417] (-570.146) -- 0:00:10
344500 -- (-569.844) [-573.212] (-572.664) (-574.178) * [-571.613] (-569.755) (-577.256) (-572.817) -- 0:00:10
345000 -- (-571.671) (-569.956) [-572.411] (-572.548) * (-572.198) [-570.675] (-572.983) (-569.482) -- 0:00:10
Average standard deviation of split frequencies: 0.012111
345500 -- (-570.784) [-569.986] (-574.402) (-573.953) * (-569.677) (-570.619) [-570.151] (-571.317) -- 0:00:10
346000 -- [-572.310] (-570.969) (-572.988) (-576.842) * [-570.290] (-569.634) (-571.915) (-569.745) -- 0:00:10
346500 -- (-572.957) (-570.044) [-571.067] (-571.618) * (-570.095) (-577.462) (-575.069) [-570.988] -- 0:00:10
347000 -- (-569.696) (-570.337) (-570.071) [-572.090] * (-569.206) (-569.593) [-573.196] (-576.515) -- 0:00:10
347500 -- (-573.268) [-572.840] (-574.303) (-571.320) * [-570.329] (-570.104) (-573.864) (-571.612) -- 0:00:10
348000 -- (-570.689) (-577.508) (-575.605) [-571.320] * (-570.428) (-569.834) [-570.678] (-569.613) -- 0:00:10
348500 -- (-572.410) (-569.570) (-571.190) [-573.211] * [-572.124] (-574.630) (-570.452) (-571.927) -- 0:00:09
349000 -- (-573.028) (-573.791) [-569.398] (-569.919) * (-572.820) (-571.143) [-570.366] (-572.414) -- 0:00:09
349500 -- (-574.101) (-575.080) (-573.809) [-569.773] * (-571.673) [-571.244] (-572.772) (-576.033) -- 0:00:09
350000 -- (-572.610) (-572.493) [-570.792] (-569.321) * [-573.385] (-570.149) (-570.581) (-570.775) -- 0:00:09
Average standard deviation of split frequencies: 0.011277
350500 -- [-570.730] (-570.129) (-570.641) (-570.531) * (-570.804) (-572.627) [-573.252] (-573.162) -- 0:00:09
351000 -- (-571.993) (-571.086) [-573.579] (-569.589) * (-570.220) [-575.574] (-569.905) (-572.548) -- 0:00:09
351500 -- (-570.666) (-571.340) [-570.307] (-578.432) * (-570.948) (-572.703) (-570.090) [-570.992] -- 0:00:09
352000 -- [-570.768] (-576.564) (-569.573) (-579.889) * [-572.260] (-572.458) (-568.867) (-575.497) -- 0:00:09
352500 -- (-569.356) (-571.327) [-569.585] (-572.374) * (-570.774) (-569.300) [-569.533] (-574.357) -- 0:00:09
353000 -- [-570.475] (-573.295) (-570.736) (-570.012) * (-571.774) (-572.841) (-572.381) [-570.237] -- 0:00:09
353500 -- [-570.278] (-569.450) (-572.682) (-569.254) * (-570.127) [-568.904] (-571.654) (-569.338) -- 0:00:09
354000 -- (-570.950) (-569.253) (-570.183) [-570.272] * [-569.522] (-574.284) (-571.491) (-569.514) -- 0:00:09
354500 -- (-571.116) (-575.000) (-573.622) [-569.663] * (-569.526) [-572.150] (-574.885) (-569.019) -- 0:00:09
355000 -- (-572.695) (-572.951) (-573.245) [-570.892] * [-569.758] (-569.452) (-570.037) (-569.712) -- 0:00:09
Average standard deviation of split frequencies: 0.011476
355500 -- (-570.605) (-572.236) [-572.718] (-572.158) * [-574.371] (-570.032) (-573.089) (-572.316) -- 0:00:09
356000 -- (-569.520) [-569.810] (-572.381) (-573.015) * [-573.701] (-569.077) (-571.106) (-570.512) -- 0:00:09
356500 -- [-569.597] (-572.911) (-571.473) (-569.884) * (-576.539) [-569.983] (-573.649) (-569.737) -- 0:00:09
357000 -- (-570.664) (-571.007) [-573.096] (-571.520) * (-569.553) [-570.505] (-571.081) (-572.228) -- 0:00:09
357500 -- (-571.310) (-571.467) [-569.153] (-571.530) * [-574.052] (-571.181) (-572.432) (-571.061) -- 0:00:09
358000 -- [-570.342] (-571.308) (-571.890) (-570.888) * (-570.915) [-570.802] (-569.411) (-570.211) -- 0:00:09
358500 -- (-570.890) (-568.987) [-569.106] (-570.249) * (-573.919) [-572.683] (-569.743) (-570.477) -- 0:00:09
359000 -- (-569.611) (-575.930) (-570.319) [-569.257] * [-574.957] (-569.642) (-571.277) (-570.363) -- 0:00:09
359500 -- (-570.364) [-569.772] (-571.984) (-570.524) * [-570.086] (-572.453) (-572.336) (-569.252) -- 0:00:09
360000 -- (-570.397) (-569.335) [-573.970] (-572.523) * [-571.756] (-570.520) (-570.974) (-573.735) -- 0:00:09
Average standard deviation of split frequencies: 0.010747
360500 -- (-572.789) (-569.076) (-571.179) [-570.031] * (-572.984) (-577.670) (-569.815) [-573.014] -- 0:00:09
361000 -- (-573.354) (-569.068) [-570.323] (-569.347) * [-572.435] (-573.481) (-574.164) (-572.275) -- 0:00:09
361500 -- (-570.681) (-570.128) (-572.611) [-570.110] * [-570.252] (-572.141) (-569.066) (-569.072) -- 0:00:09
362000 -- (-570.221) (-569.572) (-570.632) [-570.163] * (-569.528) (-572.160) (-570.577) [-570.096] -- 0:00:09
362500 -- (-571.953) [-570.203] (-571.043) (-573.583) * (-569.658) (-571.243) [-571.967] (-570.449) -- 0:00:09
363000 -- (-574.146) (-570.194) (-570.448) [-573.678] * (-569.358) [-571.931] (-575.590) (-569.229) -- 0:00:09
363500 -- (-573.146) (-570.901) (-570.656) [-571.163] * (-569.668) [-570.822] (-569.780) (-569.792) -- 0:00:09
364000 -- (-572.907) (-569.580) [-571.638] (-569.913) * [-568.875] (-570.878) (-570.433) (-571.285) -- 0:00:08
364500 -- (-571.048) (-573.525) [-568.870] (-570.823) * (-569.081) (-569.976) [-570.318] (-569.139) -- 0:00:08
365000 -- (-574.253) [-571.881] (-572.820) (-571.418) * (-572.395) (-572.679) (-572.765) [-569.301] -- 0:00:08
Average standard deviation of split frequencies: 0.011019
365500 -- (-570.247) [-572.899] (-570.140) (-570.108) * (-570.654) (-569.334) [-570.974] (-570.266) -- 0:00:08
366000 -- (-572.025) (-571.364) (-571.016) [-572.195] * (-570.426) (-570.658) [-570.369] (-572.323) -- 0:00:08
366500 -- (-570.636) (-572.260) [-570.522] (-571.150) * (-572.502) [-569.532] (-571.947) (-571.204) -- 0:00:08
367000 -- (-572.855) [-569.605] (-575.541) (-570.238) * [-574.303] (-576.147) (-570.714) (-571.233) -- 0:00:08
367500 -- (-573.548) [-570.254] (-570.542) (-570.506) * (-570.829) (-575.268) (-569.455) [-570.091] -- 0:00:08
368000 -- [-570.552] (-569.843) (-570.743) (-571.665) * (-569.480) (-573.767) (-569.735) [-571.977] -- 0:00:08
368500 -- (-572.645) (-570.887) (-569.534) [-571.347] * (-570.390) (-571.773) (-570.568) [-574.431] -- 0:00:08
369000 -- [-571.328] (-571.042) (-569.550) (-573.188) * (-570.455) (-575.174) [-569.198] (-574.646) -- 0:00:08
369500 -- (-574.263) (-571.590) (-573.758) [-571.046] * (-570.352) (-570.287) [-574.650] (-571.616) -- 0:00:08
370000 -- (-572.132) (-570.973) [-569.780] (-575.820) * (-570.025) (-572.891) [-570.630] (-570.232) -- 0:00:08
Average standard deviation of split frequencies: 0.011446
370500 -- (-572.092) [-573.353] (-569.658) (-578.201) * [-570.315] (-572.218) (-575.599) (-570.790) -- 0:00:08
371000 -- [-571.196] (-571.214) (-570.860) (-571.492) * [-571.225] (-571.062) (-576.426) (-569.504) -- 0:00:08
371500 -- (-570.750) (-572.334) [-571.532] (-572.174) * (-570.411) (-573.866) (-575.134) [-572.623] -- 0:00:08
372000 -- (-570.879) (-572.922) (-570.917) [-570.544] * [-569.298] (-573.263) (-570.941) (-570.445) -- 0:00:08
372500 -- [-571.823] (-574.010) (-571.400) (-569.066) * (-571.773) (-572.797) [-572.205] (-570.649) -- 0:00:08
373000 -- (-573.177) (-571.984) [-571.928] (-570.506) * (-573.292) (-569.859) [-572.089] (-571.295) -- 0:00:08
373500 -- (-572.978) [-571.001] (-570.354) (-571.756) * [-569.356] (-572.355) (-570.020) (-573.505) -- 0:00:08
374000 -- (-572.204) (-570.530) (-570.281) [-569.952] * (-570.215) (-569.311) [-570.165] (-571.314) -- 0:00:08
374500 -- (-571.272) (-573.177) [-570.656] (-572.066) * (-572.120) (-570.765) [-569.464] (-570.182) -- 0:00:08
375000 -- (-570.973) (-572.918) (-573.526) [-569.773] * [-570.476] (-570.937) (-571.265) (-570.702) -- 0:00:08
Average standard deviation of split frequencies: 0.010399
375500 -- (-571.349) (-577.653) [-572.853] (-572.166) * (-570.044) [-569.179] (-572.379) (-572.341) -- 0:00:08
376000 -- (-570.639) (-569.326) (-571.568) [-572.883] * (-570.380) [-571.426] (-571.920) (-569.393) -- 0:00:08
376500 -- (-572.612) [-569.653] (-569.614) (-571.163) * (-572.690) [-571.030] (-570.584) (-570.022) -- 0:00:08
377000 -- [-571.167] (-570.357) (-571.053) (-569.838) * (-571.572) (-570.130) (-575.701) [-570.278] -- 0:00:08
377500 -- (-571.008) (-571.432) [-571.658] (-574.431) * (-570.212) [-570.746] (-575.646) (-570.428) -- 0:00:08
378000 -- (-572.299) (-572.716) (-569.964) [-572.648] * [-570.634] (-574.249) (-573.606) (-570.977) -- 0:00:08
378500 -- (-571.082) [-568.616] (-573.281) (-570.553) * (-570.070) (-572.961) (-572.962) [-571.230] -- 0:00:08
379000 -- (-575.909) (-571.701) [-570.016] (-570.449) * (-572.830) [-573.409] (-570.448) (-571.357) -- 0:00:07
379500 -- [-570.839] (-572.249) (-574.605) (-569.169) * (-572.360) (-571.850) (-569.199) [-573.616] -- 0:00:07
380000 -- (-572.365) [-569.971] (-571.397) (-569.096) * (-572.353) [-569.959] (-570.018) (-572.375) -- 0:00:07
Average standard deviation of split frequencies: 0.009688
380500 -- [-572.301] (-569.315) (-574.584) (-569.119) * (-570.035) [-570.932] (-570.618) (-572.849) -- 0:00:07
381000 -- (-577.045) (-570.104) [-572.264] (-571.038) * (-570.480) (-569.271) (-575.633) [-574.769] -- 0:00:07
381500 -- (-576.495) (-571.558) (-570.852) [-569.394] * [-569.569] (-569.591) (-572.017) (-570.992) -- 0:00:07
382000 -- (-572.252) [-574.897] (-574.408) (-570.941) * [-570.113] (-568.873) (-569.703) (-571.263) -- 0:00:07
382500 -- (-572.621) (-572.920) [-571.259] (-570.724) * [-572.763] (-569.572) (-570.707) (-570.610) -- 0:00:07
383000 -- (-570.098) (-570.126) [-569.146] (-571.194) * (-569.545) (-569.383) (-570.331) [-570.961] -- 0:00:07
383500 -- (-569.357) (-569.638) [-571.795] (-571.623) * (-573.225) (-573.109) [-568.923] (-570.355) -- 0:00:07
384000 -- (-572.039) (-570.991) [-571.874] (-576.445) * [-571.515] (-576.461) (-570.165) (-572.110) -- 0:00:07
384500 -- [-569.796] (-569.301) (-570.646) (-572.305) * (-569.802) (-570.123) (-572.543) [-568.943] -- 0:00:07
385000 -- (-571.653) (-571.869) [-572.661] (-570.354) * [-572.552] (-570.894) (-571.549) (-569.124) -- 0:00:07
Average standard deviation of split frequencies: 0.009267
385500 -- (-571.607) (-570.449) (-573.380) [-570.487] * (-575.474) [-570.895] (-569.366) (-570.595) -- 0:00:07
386000 -- (-570.607) (-569.512) [-570.145] (-569.590) * (-571.545) (-572.000) [-571.851] (-572.597) -- 0:00:07
386500 -- [-572.336] (-571.109) (-569.244) (-569.896) * [-571.066] (-570.093) (-574.578) (-571.248) -- 0:00:07
387000 -- [-570.730] (-572.153) (-575.871) (-571.118) * (-570.000) [-570.295] (-569.498) (-570.022) -- 0:00:07
387500 -- (-573.848) [-571.930] (-570.300) (-570.835) * (-571.219) (-572.888) [-569.425] (-569.510) -- 0:00:07
388000 -- (-573.538) (-569.405) (-569.697) [-571.658] * (-569.472) (-575.822) (-572.266) [-570.107] -- 0:00:07
388500 -- (-573.997) [-570.090] (-568.746) (-572.385) * (-571.260) [-572.602] (-573.224) (-572.157) -- 0:00:07
389000 -- (-573.599) (-570.129) (-570.775) [-570.351] * (-575.066) (-573.626) (-570.651) [-570.068] -- 0:00:07
389500 -- [-571.093] (-573.951) (-572.804) (-572.424) * (-569.975) (-571.608) (-571.013) [-576.033] -- 0:00:07
390000 -- [-570.077] (-572.730) (-569.555) (-573.853) * (-570.326) (-571.691) [-570.242] (-574.722) -- 0:00:07
Average standard deviation of split frequencies: 0.009586
390500 -- (-579.019) (-573.143) (-572.311) [-570.314] * (-570.672) (-574.777) [-570.943] (-576.563) -- 0:00:07
391000 -- (-580.668) (-570.187) [-570.441] (-570.782) * (-572.126) (-572.398) (-570.802) [-569.707] -- 0:00:07
391500 -- (-571.803) (-570.145) (-570.213) [-574.452] * (-575.304) [-571.176] (-570.520) (-570.884) -- 0:00:07
392000 -- (-575.543) (-569.912) [-570.530] (-575.000) * (-571.662) (-570.643) (-569.782) [-570.229] -- 0:00:07
392500 -- (-571.277) [-570.444] (-569.792) (-570.039) * (-570.931) (-571.401) (-572.760) [-571.903] -- 0:00:07
393000 -- (-574.615) (-569.836) [-571.747] (-571.970) * [-569.921] (-569.357) (-571.002) (-570.199) -- 0:00:07
393500 -- (-572.783) (-573.683) [-570.045] (-570.029) * [-568.940] (-569.192) (-572.719) (-570.181) -- 0:00:07
394000 -- [-569.984] (-569.561) (-570.410) (-570.803) * (-568.809) [-570.717] (-570.619) (-572.251) -- 0:00:06
394500 -- (-569.751) [-571.850] (-570.541) (-570.482) * [-569.659] (-572.299) (-570.019) (-570.813) -- 0:00:06
395000 -- (-576.420) (-572.043) [-572.761] (-572.234) * (-569.518) (-572.433) (-569.022) [-571.651] -- 0:00:06
Average standard deviation of split frequencies: 0.008613
395500 -- [-570.092] (-574.065) (-572.795) (-571.163) * (-573.644) [-570.302] (-571.886) (-571.026) -- 0:00:06
396000 -- (-570.371) (-573.640) (-572.564) [-570.146] * [-573.090] (-569.883) (-576.342) (-568.787) -- 0:00:06
396500 -- [-571.448] (-573.868) (-569.734) (-569.712) * (-577.959) (-569.980) [-577.299] (-569.837) -- 0:00:06
397000 -- (-571.369) (-570.244) (-569.841) [-569.097] * (-578.027) (-570.844) [-577.853] (-573.613) -- 0:00:06
397500 -- (-572.084) [-570.082] (-570.054) (-570.518) * (-571.951) (-570.262) (-570.666) [-575.972] -- 0:00:06
398000 -- (-572.025) [-570.623] (-571.007) (-573.439) * (-569.939) (-570.591) [-572.463] (-573.475) -- 0:00:06
398500 -- (-570.574) [-570.518] (-569.876) (-570.993) * (-572.955) (-572.418) (-571.924) [-571.460] -- 0:00:06
399000 -- (-569.585) [-570.443] (-573.866) (-573.250) * (-573.653) (-569.838) [-570.805] (-568.772) -- 0:00:06
399500 -- (-570.341) [-572.266] (-569.861) (-572.203) * (-571.045) (-570.470) (-571.918) [-569.115] -- 0:00:06
400000 -- (-572.083) [-570.157] (-579.619) (-574.323) * [-571.847] (-570.928) (-573.560) (-569.384) -- 0:00:06
Average standard deviation of split frequencies: 0.008443
400500 -- (-573.533) (-573.446) [-570.505] (-570.529) * [-570.118] (-570.546) (-570.166) (-569.647) -- 0:00:06
401000 -- (-576.223) [-576.138] (-570.043) (-570.371) * [-570.011] (-573.853) (-570.230) (-568.862) -- 0:00:06
401500 -- (-573.631) (-574.087) [-569.976] (-571.522) * (-569.410) (-570.257) [-569.623] (-571.647) -- 0:00:06
402000 -- (-570.398) [-569.532] (-570.392) (-572.223) * (-569.946) (-570.288) (-573.063) [-572.785] -- 0:00:06
402500 -- (-571.642) [-569.551] (-570.531) (-571.847) * (-570.641) (-569.806) (-570.140) [-570.350] -- 0:00:06
403000 -- (-573.823) (-571.231) [-570.439] (-570.710) * (-571.767) (-569.415) [-570.400] (-577.152) -- 0:00:06
403500 -- (-572.877) (-569.582) (-572.481) [-570.236] * (-574.450) (-570.499) [-570.895] (-574.071) -- 0:00:06
404000 -- (-570.851) (-569.763) (-570.729) [-569.985] * (-573.084) (-569.217) (-571.925) [-575.819] -- 0:00:06
404500 -- (-571.290) (-569.456) [-572.384] (-571.022) * (-572.134) (-574.397) [-571.687] (-575.636) -- 0:00:06
405000 -- (-570.296) [-574.429] (-574.584) (-569.562) * (-572.921) (-573.869) [-574.001] (-574.029) -- 0:00:06
Average standard deviation of split frequencies: 0.008606
405500 -- (-568.996) [-570.786] (-571.416) (-569.400) * (-574.846) (-569.262) (-573.746) [-575.190] -- 0:00:06
406000 -- (-570.462) [-570.370] (-570.950) (-573.267) * (-572.796) [-573.693] (-574.038) (-571.641) -- 0:00:06
406500 -- (-573.366) (-570.708) [-569.948] (-571.800) * (-572.754) (-575.571) (-570.169) [-572.871] -- 0:00:05
407000 -- (-569.943) (-573.939) (-569.794) [-572.134] * (-570.361) (-573.468) [-574.542] (-574.995) -- 0:00:06
407500 -- (-570.907) (-570.088) (-573.065) [-571.624] * (-571.734) (-572.900) [-570.590] (-569.673) -- 0:00:06
408000 -- (-570.801) [-572.631] (-571.818) (-568.956) * (-571.524) (-576.204) (-571.037) [-571.274] -- 0:00:06
408500 -- (-570.591) (-569.899) [-571.102] (-571.172) * (-571.429) [-572.641] (-570.112) (-570.607) -- 0:00:06
409000 -- (-572.071) (-570.694) (-570.498) [-571.050] * (-571.921) [-569.470] (-570.895) (-570.202) -- 0:00:06
409500 -- (-570.611) (-568.703) (-570.839) [-571.631] * (-569.444) [-570.055] (-570.724) (-570.974) -- 0:00:05
410000 -- (-569.411) (-569.066) (-571.864) [-570.238] * (-569.904) [-571.790] (-576.566) (-569.278) -- 0:00:05
Average standard deviation of split frequencies: 0.008942
410500 -- (-572.416) [-570.687] (-572.624) (-571.143) * (-572.824) [-569.658] (-573.085) (-571.428) -- 0:00:05
411000 -- [-569.470] (-572.042) (-570.687) (-570.137) * (-573.322) (-572.449) [-570.278] (-570.385) -- 0:00:05
411500 -- (-571.681) (-576.353) (-570.109) [-569.627] * (-571.307) (-575.863) [-569.786] (-570.409) -- 0:00:05
412000 -- [-574.064] (-571.680) (-569.762) (-569.623) * (-571.317) [-572.096] (-570.949) (-569.804) -- 0:00:05
412500 -- (-570.255) (-568.958) (-572.853) [-571.784] * (-574.360) (-571.365) (-569.536) [-570.031] -- 0:00:05
413000 -- [-571.505] (-570.571) (-571.224) (-569.412) * (-573.302) (-569.706) (-570.515) [-568.965] -- 0:00:05
413500 -- (-571.220) (-572.509) (-573.411) [-569.793] * [-570.293] (-570.488) (-573.573) (-572.926) -- 0:00:05
414000 -- (-569.104) [-568.864] (-570.100) (-569.822) * (-569.617) (-570.089) (-570.903) [-574.024] -- 0:00:05
414500 -- (-575.331) (-573.224) (-570.087) [-570.408] * (-569.485) (-570.226) (-571.669) [-569.615] -- 0:00:05
415000 -- (-573.185) (-569.890) (-569.649) [-570.661] * (-569.852) (-571.415) (-570.446) [-572.368] -- 0:00:05
Average standard deviation of split frequencies: 0.008310
415500 -- (-571.637) (-570.170) (-570.465) [-570.587] * (-569.859) (-574.771) (-572.146) [-570.343] -- 0:00:05
416000 -- (-569.578) (-573.900) [-569.526] (-571.600) * [-573.486] (-574.716) (-569.904) (-569.605) -- 0:00:05
416500 -- (-570.709) [-570.361] (-570.783) (-570.738) * [-570.305] (-575.876) (-572.633) (-569.758) -- 0:00:05
417000 -- (-569.619) (-574.186) [-574.456] (-570.649) * (-571.162) (-575.983) (-569.676) [-569.361] -- 0:00:05
417500 -- [-571.991] (-571.632) (-574.937) (-572.655) * (-571.827) (-571.029) [-576.175] (-573.944) -- 0:00:05
418000 -- [-571.033] (-570.834) (-571.348) (-574.280) * (-572.894) [-569.879] (-572.745) (-572.797) -- 0:00:05
418500 -- (-570.326) (-570.413) (-572.931) [-570.327] * (-573.633) [-570.563] (-572.009) (-572.825) -- 0:00:05
419000 -- (-571.144) [-571.491] (-571.814) (-570.201) * (-572.975) [-572.908] (-573.971) (-572.208) -- 0:00:05
419500 -- (-573.823) (-569.772) (-573.066) [-570.922] * [-570.443] (-572.701) (-574.963) (-570.642) -- 0:00:05
420000 -- (-571.834) (-569.702) (-571.549) [-569.901] * [-570.710] (-570.062) (-573.863) (-574.039) -- 0:00:05
Average standard deviation of split frequencies: 0.008670
420500 -- (-571.302) [-570.843] (-569.462) (-572.165) * (-572.885) [-570.820] (-571.615) (-571.701) -- 0:00:05
421000 -- (-570.959) [-570.089] (-570.661) (-569.718) * (-571.754) (-569.912) [-572.985] (-569.374) -- 0:00:05
421500 -- (-570.221) [-569.204] (-571.344) (-569.243) * (-572.167) (-570.498) [-570.217] (-571.765) -- 0:00:05
422000 -- (-570.733) [-576.113] (-570.774) (-571.461) * (-569.193) (-570.476) (-569.361) [-570.719] -- 0:00:04
422500 -- [-571.101] (-575.840) (-570.303) (-570.409) * [-572.812] (-574.985) (-571.317) (-570.628) -- 0:00:04
423000 -- (-572.574) (-569.790) [-570.120] (-570.986) * (-570.396) (-573.755) (-573.180) [-568.890] -- 0:00:04
423500 -- [-570.373] (-569.975) (-569.729) (-571.326) * (-570.869) (-574.847) [-574.436] (-570.057) -- 0:00:04
424000 -- [-573.097] (-572.556) (-570.736) (-570.816) * (-570.320) (-575.094) [-569.067] (-570.493) -- 0:00:04
424500 -- (-574.679) (-570.203) (-570.993) [-569.577] * (-569.638) [-570.320] (-572.163) (-573.300) -- 0:00:04
425000 -- (-574.492) (-571.354) [-573.400] (-571.593) * [-569.768] (-572.124) (-571.004) (-574.649) -- 0:00:04
Average standard deviation of split frequencies: 0.009260
425500 -- [-569.799] (-570.450) (-570.536) (-569.803) * [-570.782] (-576.422) (-572.992) (-572.244) -- 0:00:04
426000 -- (-569.158) [-569.467] (-572.733) (-570.374) * (-570.656) (-573.475) [-570.716] (-570.260) -- 0:00:04
426500 -- (-571.066) [-569.614] (-573.432) (-572.943) * (-571.048) (-571.236) [-569.905] (-569.366) -- 0:00:04
427000 -- (-571.721) (-569.866) [-570.773] (-570.604) * (-571.877) (-571.200) (-569.427) [-568.755] -- 0:00:04
427500 -- (-570.733) [-574.583] (-569.228) (-568.749) * (-571.243) (-569.571) (-572.131) [-571.172] -- 0:00:04
428000 -- (-573.383) (-570.083) [-570.318] (-570.477) * [-569.472] (-572.302) (-573.060) (-574.241) -- 0:00:04
428500 -- (-573.534) [-570.020] (-575.965) (-573.995) * (-570.725) [-570.086] (-575.801) (-570.469) -- 0:00:04
429000 -- (-569.339) (-569.818) [-569.988] (-574.872) * [-570.476] (-573.509) (-570.782) (-572.184) -- 0:00:04
429500 -- (-572.044) [-570.982] (-571.186) (-573.131) * (-571.465) (-569.395) (-572.045) [-570.449] -- 0:00:04
430000 -- (-572.545) (-571.060) (-570.287) [-570.512] * [-571.084] (-568.741) (-576.329) (-569.908) -- 0:00:04
Average standard deviation of split frequencies: 0.009275
430500 -- [-570.436] (-570.046) (-571.529) (-570.830) * [-570.136] (-570.064) (-571.141) (-569.893) -- 0:00:04
431000 -- (-570.920) (-572.555) (-569.767) [-570.979] * (-575.899) (-572.700) (-573.460) [-569.402] -- 0:00:04
431500 -- (-572.367) (-572.513) [-569.983] (-569.535) * (-572.210) (-570.842) (-569.411) [-570.850] -- 0:00:04
432000 -- (-571.748) (-573.270) [-570.784] (-573.038) * (-570.152) (-572.694) (-569.834) [-572.539] -- 0:00:04
432500 -- [-568.892] (-571.282) (-570.774) (-574.588) * (-571.042) [-572.177] (-572.690) (-572.422) -- 0:00:04
433000 -- (-572.111) (-570.571) (-571.773) [-569.380] * (-570.749) (-570.744) (-570.850) [-572.498] -- 0:00:04
433500 -- [-569.207] (-570.806) (-571.374) (-571.679) * (-570.145) [-570.271] (-570.559) (-569.844) -- 0:00:04
434000 -- [-569.305] (-575.195) (-576.738) (-575.688) * [-569.409] (-569.171) (-573.017) (-572.575) -- 0:00:04
434500 -- [-569.407] (-574.347) (-571.328) (-573.544) * (-569.343) (-571.269) (-573.218) [-570.586] -- 0:00:04
435000 -- [-573.449] (-574.350) (-573.522) (-569.218) * (-570.333) [-569.752] (-571.655) (-571.087) -- 0:00:04
Average standard deviation of split frequencies: 0.009971
435500 -- (-575.312) (-573.111) (-571.096) [-571.755] * (-571.157) (-571.273) (-573.763) [-575.050] -- 0:00:04
436000 -- (-575.982) (-574.190) (-570.067) [-569.735] * (-572.284) (-573.551) [-571.075] (-573.455) -- 0:00:04
436500 -- (-570.232) (-575.627) [-570.591] (-571.777) * (-570.296) (-571.261) [-569.472] (-573.515) -- 0:00:04
437000 -- (-569.839) (-573.049) (-573.224) [-571.537] * (-571.535) (-571.958) [-570.647] (-571.311) -- 0:00:04
437500 -- (-572.515) [-571.274] (-571.446) (-570.409) * (-571.885) (-574.179) (-569.839) [-570.122] -- 0:00:04
438000 -- (-573.012) (-570.194) (-572.766) [-571.253] * [-571.821] (-574.100) (-570.433) (-573.602) -- 0:00:03
438500 -- (-572.029) [-569.629] (-571.930) (-569.375) * (-570.894) (-575.025) (-572.123) [-571.155] -- 0:00:03
439000 -- (-570.157) (-569.122) (-569.712) [-570.871] * (-569.766) (-576.466) [-570.335] (-571.154) -- 0:00:03
439500 -- (-574.613) (-569.596) [-573.470] (-570.812) * (-570.266) (-573.828) [-569.573] (-571.021) -- 0:00:03
440000 -- [-569.603] (-568.846) (-570.326) (-571.482) * (-570.543) (-570.528) (-571.262) [-572.394] -- 0:00:03
Average standard deviation of split frequencies: 0.009747
440500 -- (-569.715) (-571.138) [-570.345] (-569.397) * [-570.824] (-570.907) (-571.583) (-571.331) -- 0:00:03
441000 -- [-570.457] (-572.590) (-573.059) (-570.333) * [-570.695] (-570.641) (-570.995) (-571.804) -- 0:00:03
441500 -- (-576.051) [-572.260] (-570.521) (-572.868) * (-571.914) (-571.089) (-570.552) [-570.732] -- 0:00:03
442000 -- (-574.844) (-570.550) [-570.204] (-570.067) * (-571.607) (-570.929) (-574.888) [-574.796] -- 0:00:03
442500 -- (-570.919) [-570.929] (-572.732) (-569.861) * (-569.416) (-571.665) [-570.913] (-570.728) -- 0:00:03
443000 -- (-574.523) (-570.303) (-569.839) [-569.308] * (-569.185) (-573.309) [-570.712] (-571.379) -- 0:00:03
443500 -- (-569.679) (-571.800) (-572.137) [-570.365] * (-571.246) (-570.629) (-570.189) [-570.358] -- 0:00:03
444000 -- [-569.759] (-571.707) (-575.139) (-570.667) * (-569.924) (-568.914) [-571.381] (-578.418) -- 0:00:03
444500 -- (-569.721) (-571.355) (-573.676) [-570.619] * (-569.223) (-569.262) (-575.373) [-572.884] -- 0:00:03
445000 -- (-574.213) [-571.270] (-572.390) (-571.514) * [-571.141] (-570.124) (-574.904) (-574.054) -- 0:00:03
Average standard deviation of split frequencies: 0.009179
445500 -- [-570.578] (-571.900) (-571.857) (-569.173) * [-573.833] (-573.668) (-569.989) (-572.972) -- 0:00:03
446000 -- (-571.677) (-570.606) [-568.818] (-570.595) * [-570.373] (-571.664) (-572.111) (-572.107) -- 0:00:03
446500 -- (-569.987) [-569.470] (-570.726) (-568.870) * [-573.323] (-574.914) (-570.494) (-572.469) -- 0:00:03
447000 -- (-570.003) [-569.739] (-572.332) (-568.870) * (-569.977) (-573.158) [-570.927] (-571.510) -- 0:00:03
447500 -- (-573.145) (-572.190) [-574.863] (-570.315) * (-571.248) (-569.970) (-571.017) [-571.257] -- 0:00:03
448000 -- (-571.031) (-569.362) (-569.135) [-570.723] * (-572.152) (-571.945) (-573.311) [-570.371] -- 0:00:03
448500 -- (-570.289) [-571.913] (-570.006) (-573.371) * (-571.835) (-571.489) [-572.332] (-570.315) -- 0:00:03
449000 -- [-569.491] (-570.964) (-570.357) (-570.732) * (-570.474) (-574.157) [-571.581] (-578.487) -- 0:00:03
449500 -- [-573.713] (-573.070) (-571.596) (-569.783) * [-571.840] (-571.359) (-573.146) (-573.136) -- 0:00:03
450000 -- [-571.531] (-570.260) (-569.041) (-571.174) * [-571.136] (-575.000) (-572.152) (-572.694) -- 0:00:03
Average standard deviation of split frequencies: 0.009007
450500 -- (-576.242) [-570.869] (-571.262) (-571.096) * [-569.122] (-573.140) (-568.857) (-569.870) -- 0:00:03
451000 -- (-572.438) (-570.695) (-569.296) [-570.159] * [-571.651] (-570.110) (-569.835) (-573.008) -- 0:00:03
451500 -- (-569.986) (-569.598) [-569.714] (-570.700) * (-571.382) (-569.319) (-570.872) [-570.378] -- 0:00:03
452000 -- (-570.372) [-573.078] (-571.583) (-570.365) * (-570.794) [-571.219] (-571.469) (-570.920) -- 0:00:03
452500 -- [-575.600] (-569.609) (-571.877) (-570.855) * [-570.390] (-574.099) (-569.309) (-572.215) -- 0:00:03
453000 -- (-571.387) (-574.900) [-569.652] (-569.178) * (-570.081) (-570.965) (-570.649) [-572.678] -- 0:00:03
453500 -- (-571.287) [-570.093] (-572.988) (-571.265) * (-569.527) (-572.877) [-569.358] (-571.830) -- 0:00:02
454000 -- (-571.548) (-570.558) (-570.912) [-569.554] * [-572.293] (-570.846) (-568.911) (-573.159) -- 0:00:02
454500 -- (-571.039) (-571.180) (-570.715) [-569.918] * [-569.384] (-571.036) (-568.860) (-573.979) -- 0:00:02
455000 -- (-570.670) (-569.588) (-576.953) [-571.238] * (-570.450) (-569.670) (-571.487) [-571.722] -- 0:00:02
Average standard deviation of split frequencies: 0.008787
455500 -- (-571.911) (-573.782) (-575.854) [-569.481] * (-569.069) [-570.067] (-571.867) (-571.465) -- 0:00:02
456000 -- [-570.167] (-569.305) (-570.794) (-576.226) * (-572.032) (-575.309) [-571.476] (-570.758) -- 0:00:02
456500 -- (-571.104) (-570.205) (-570.216) [-569.322] * [-573.087] (-574.397) (-570.355) (-570.120) -- 0:00:02
457000 -- [-571.754] (-573.263) (-572.638) (-569.427) * (-573.837) (-569.088) (-572.889) [-572.939] -- 0:00:02
457500 -- (-570.967) (-570.271) [-571.222] (-570.417) * (-574.643) [-572.428] (-570.063) (-570.643) -- 0:00:02
458000 -- (-571.698) [-571.183] (-572.286) (-571.068) * (-569.839) [-572.875] (-571.575) (-569.640) -- 0:00:02
458500 -- [-570.300] (-572.942) (-572.152) (-571.345) * (-569.851) (-574.688) (-570.264) [-571.103] -- 0:00:02
459000 -- (-573.221) [-569.903] (-569.608) (-572.670) * (-568.799) (-573.798) (-570.611) [-569.467] -- 0:00:02
459500 -- (-571.137) (-569.150) [-571.651] (-570.931) * (-571.575) (-570.956) [-571.423] (-570.597) -- 0:00:02
460000 -- (-572.518) (-571.301) [-571.333] (-575.431) * (-574.974) (-569.423) [-570.647] (-570.061) -- 0:00:02
Average standard deviation of split frequencies: 0.009210
460500 -- (-569.256) [-571.100] (-572.810) (-574.608) * (-570.313) [-570.101] (-575.629) (-576.900) -- 0:00:02
461000 -- (-569.509) [-571.315] (-574.711) (-578.363) * (-571.033) (-570.629) (-571.521) [-572.065] -- 0:00:02
461500 -- (-570.855) (-573.482) (-569.915) [-576.958] * (-571.184) (-574.375) (-572.305) [-570.757] -- 0:00:02
462000 -- [-571.047] (-571.405) (-571.795) (-571.454) * (-572.447) (-575.191) (-571.755) [-571.144] -- 0:00:02
462500 -- [-570.577] (-574.044) (-569.466) (-573.852) * [-570.309] (-574.792) (-572.045) (-571.954) -- 0:00:02
463000 -- (-570.879) (-571.285) [-570.690] (-573.293) * (-571.760) [-572.843] (-569.446) (-571.461) -- 0:00:02
463500 -- (-569.899) [-570.496] (-573.476) (-570.566) * [-571.278] (-570.264) (-574.484) (-570.848) -- 0:00:02
464000 -- (-572.866) (-570.171) [-570.775] (-570.501) * (-570.170) [-570.222] (-573.119) (-573.058) -- 0:00:02
464500 -- (-572.062) [-569.222] (-572.344) (-572.082) * (-569.315) [-571.705] (-574.982) (-572.038) -- 0:00:02
465000 -- (-569.227) (-569.438) (-573.636) [-573.076] * (-569.557) [-570.358] (-573.778) (-570.626) -- 0:00:02
Average standard deviation of split frequencies: 0.008823
465500 -- (-570.610) (-571.770) [-571.474] (-571.126) * [-570.079] (-569.938) (-570.169) (-571.953) -- 0:00:02
466000 -- (-572.171) [-571.875] (-570.887) (-569.464) * (-569.339) [-573.146] (-573.507) (-571.830) -- 0:00:02
466500 -- [-572.846] (-570.728) (-569.811) (-570.705) * (-569.559) (-572.132) [-572.855] (-570.385) -- 0:00:02
467000 -- [-571.578] (-574.693) (-571.660) (-571.526) * (-571.153) (-573.383) (-571.734) [-569.178] -- 0:00:02
467500 -- (-571.841) (-570.946) (-574.381) [-571.057] * [-570.821] (-571.168) (-573.711) (-570.801) -- 0:00:02
468000 -- (-571.003) (-571.841) [-570.879] (-570.490) * (-571.544) [-572.018] (-575.067) (-570.938) -- 0:00:02
468500 -- (-571.818) (-571.371) (-572.066) [-570.688] * [-569.153] (-569.245) (-568.990) (-571.981) -- 0:00:02
469000 -- (-569.298) (-572.497) [-569.000] (-570.773) * [-569.826] (-573.047) (-571.165) (-570.675) -- 0:00:01
469500 -- (-571.502) [-571.278] (-571.760) (-575.793) * (-570.004) [-569.624] (-572.211) (-570.103) -- 0:00:01
470000 -- (-572.172) [-570.979] (-575.737) (-571.989) * (-573.490) (-572.909) [-571.818] (-568.880) -- 0:00:01
Average standard deviation of split frequencies: 0.008346
470500 -- (-571.580) [-570.338] (-569.956) (-571.539) * [-573.701] (-569.486) (-569.634) (-570.732) -- 0:00:01
471000 -- [-571.939] (-571.979) (-571.817) (-571.635) * (-570.492) [-568.852] (-572.030) (-572.703) -- 0:00:01
471500 -- [-573.894] (-573.435) (-572.619) (-570.362) * (-572.415) (-570.413) (-573.317) [-577.662] -- 0:00:01
472000 -- (-569.714) [-572.081] (-575.379) (-570.149) * [-572.107] (-570.810) (-569.580) (-572.017) -- 0:00:01
472500 -- (-571.488) [-571.138] (-572.919) (-574.235) * (-573.842) (-576.502) (-569.774) [-571.708] -- 0:00:01
473000 -- [-574.565] (-570.518) (-571.514) (-568.894) * (-573.864) [-572.878] (-569.264) (-573.448) -- 0:00:01
473500 -- (-573.026) (-573.391) (-574.824) [-569.556] * (-572.440) (-573.550) [-571.916] (-571.499) -- 0:00:01
474000 -- (-578.253) (-570.437) (-569.991) [-569.475] * [-572.603] (-571.635) (-571.895) (-569.325) -- 0:00:01
474500 -- (-571.208) [-569.270] (-572.775) (-570.471) * [-569.217] (-570.422) (-572.856) (-570.508) -- 0:00:01
475000 -- [-570.743] (-573.589) (-573.017) (-571.949) * (-570.478) (-573.170) (-570.781) [-570.480] -- 0:00:01
Average standard deviation of split frequencies: 0.008680
475500 -- (-571.289) (-570.990) (-573.628) [-573.132] * [-570.127] (-568.951) (-571.223) (-570.349) -- 0:00:01
476000 -- (-572.360) (-571.012) [-570.198] (-572.721) * (-574.596) [-570.574] (-571.423) (-573.099) -- 0:00:01
476500 -- [-571.768] (-571.597) (-570.872) (-571.512) * (-570.938) (-570.814) [-573.344] (-569.542) -- 0:00:01
477000 -- (-575.079) [-572.318] (-572.310) (-572.293) * (-570.008) [-569.958] (-571.432) (-578.587) -- 0:00:01
477500 -- [-572.557] (-571.511) (-569.442) (-570.180) * [-569.301] (-570.805) (-571.011) (-569.874) -- 0:00:01
478000 -- (-580.620) (-575.536) (-570.580) [-571.560] * (-570.162) [-573.135] (-573.648) (-569.518) -- 0:00:01
478500 -- (-579.246) [-570.359] (-570.553) (-570.978) * (-577.715) (-570.820) (-571.670) [-570.546] -- 0:00:01
479000 -- [-571.421] (-570.675) (-572.019) (-571.299) * (-571.997) [-571.956] (-571.718) (-569.457) -- 0:00:01
479500 -- (-569.595) [-570.334] (-569.386) (-576.190) * (-571.858) [-572.767] (-569.892) (-571.530) -- 0:00:01
480000 -- (-572.461) (-570.820) (-571.729) [-574.100] * (-570.635) (-570.191) (-574.184) [-572.760] -- 0:00:01
Average standard deviation of split frequencies: 0.007788
480500 -- (-569.287) (-570.604) (-570.705) [-568.869] * (-571.345) [-569.544] (-571.631) (-574.006) -- 0:00:01
481000 -- [-571.431] (-571.784) (-570.907) (-572.917) * (-570.128) (-575.206) [-573.017] (-571.452) -- 0:00:01
481500 -- [-570.209] (-571.409) (-572.239) (-570.832) * (-570.034) [-570.180] (-578.712) (-569.395) -- 0:00:01
482000 -- (-570.130) [-570.447] (-572.766) (-570.565) * (-570.292) [-570.505] (-575.016) (-569.638) -- 0:00:01
482500 -- (-572.519) (-569.527) [-570.688] (-569.888) * (-570.818) [-570.050] (-571.528) (-570.076) -- 0:00:01
483000 -- (-573.241) [-569.704] (-573.741) (-571.952) * (-569.932) [-570.442] (-572.380) (-569.435) -- 0:00:01
483500 -- (-572.741) [-570.267] (-569.882) (-574.962) * (-570.266) (-573.008) [-571.659] (-571.792) -- 0:00:01
484000 -- (-569.567) (-569.791) [-570.792] (-571.942) * (-570.589) (-570.725) (-572.791) [-572.840] -- 0:00:01
484500 -- (-571.725) (-570.423) (-569.912) [-571.786] * (-569.985) [-571.024] (-570.372) (-573.208) -- 0:00:00
485000 -- [-569.056] (-570.809) (-571.158) (-571.910) * (-571.226) (-569.250) (-570.534) [-570.594] -- 0:00:00
Average standard deviation of split frequencies: 0.007706
485500 -- (-573.090) (-571.050) [-570.781] (-570.409) * (-572.638) (-570.595) [-570.316] (-571.499) -- 0:00:00
486000 -- [-575.473] (-570.824) (-570.154) (-574.310) * (-572.702) (-572.831) [-571.063] (-570.927) -- 0:00:00
486500 -- (-572.842) (-572.300) [-571.553] (-571.185) * (-572.030) (-571.037) (-570.640) [-568.763] -- 0:00:00
487000 -- (-569.412) (-574.482) (-571.979) [-572.285] * (-570.165) [-569.038] (-571.212) (-570.179) -- 0:00:00
487500 -- (-571.355) [-569.531] (-570.008) (-572.438) * (-569.988) (-571.871) [-575.563] (-569.238) -- 0:00:00
488000 -- (-571.057) [-569.417] (-571.537) (-569.035) * [-569.707] (-570.747) (-575.102) (-569.191) -- 0:00:00
488500 -- [-574.023] (-570.668) (-569.962) (-571.828) * [-569.976] (-571.851) (-570.554) (-569.405) -- 0:00:00
489000 -- (-571.829) (-569.845) [-570.833] (-569.892) * (-571.025) (-578.339) [-573.155] (-570.641) -- 0:00:00
489500 -- (-569.547) [-569.370] (-569.899) (-572.386) * [-570.114] (-571.221) (-575.606) (-570.153) -- 0:00:00
490000 -- (-571.292) (-569.220) [-570.789] (-573.986) * [-570.415] (-569.967) (-570.324) (-571.991) -- 0:00:00
Average standard deviation of split frequencies: 0.008006
490500 -- (-569.667) (-571.199) (-570.257) [-571.972] * (-570.098) (-572.762) (-574.871) [-570.678] -- 0:00:00
491000 -- (-573.053) (-572.619) [-569.796] (-570.476) * (-570.572) (-573.200) [-571.210] (-571.302) -- 0:00:00
491500 -- (-570.594) (-571.828) [-572.015] (-572.756) * (-569.864) (-572.694) [-569.762] (-572.332) -- 0:00:00
492000 -- (-570.477) (-571.155) [-570.602] (-571.903) * (-574.015) [-571.232] (-569.333) (-569.867) -- 0:00:00
492500 -- (-571.989) (-571.433) (-574.511) [-572.945] * (-574.211) (-569.226) (-569.596) [-570.180] -- 0:00:00
493000 -- (-571.003) (-571.440) [-573.767] (-571.283) * (-572.218) (-570.546) (-573.060) [-569.995] -- 0:00:00
493500 -- (-573.488) (-571.204) (-570.958) [-572.335] * [-569.548] (-571.459) (-569.984) (-570.052) -- 0:00:00
494000 -- (-570.967) [-570.564] (-570.964) (-569.986) * (-569.369) (-574.204) [-569.393] (-572.234) -- 0:00:00
494500 -- [-571.771] (-575.564) (-573.637) (-570.909) * (-570.664) (-569.993) (-569.795) [-570.017] -- 0:00:00
495000 -- (-571.899) (-570.271) (-571.976) [-569.872] * [-570.831] (-572.456) (-570.133) (-570.748) -- 0:00:00
Average standard deviation of split frequencies: 0.008501
495500 -- [-571.998] (-572.897) (-575.751) (-569.003) * (-570.599) (-571.093) [-570.705] (-570.170) -- 0:00:00
496000 -- (-571.609) [-571.521] (-571.484) (-571.394) * [-570.437] (-574.820) (-569.500) (-571.281) -- 0:00:00
496500 -- (-571.406) (-572.423) (-572.158) [-569.552] * (-570.414) [-572.170] (-569.896) (-574.046) -- 0:00:00
497000 -- (-571.608) (-570.153) [-570.111] (-569.358) * [-570.384] (-575.387) (-570.535) (-575.537) -- 0:00:00
497500 -- (-571.451) [-570.989] (-574.649) (-570.088) * (-573.418) [-571.332] (-570.963) (-572.328) -- 0:00:00
498000 -- (-573.589) [-570.376] (-571.113) (-570.777) * (-578.145) (-569.229) (-572.061) [-578.075] -- 0:00:00
498500 -- (-571.478) (-571.083) [-571.204] (-571.233) * [-573.131] (-570.495) (-576.924) (-573.556) -- 0:00:00
499000 -- [-569.993] (-572.069) (-568.791) (-570.894) * (-568.758) (-573.967) [-569.756] (-574.453) -- 0:00:00
499500 -- (-570.622) (-575.298) [-569.106] (-570.258) * [-569.581] (-569.935) (-570.956) (-575.753) -- 0:00:00
500000 -- (-570.296) [-574.931] (-569.545) (-569.568) * (-572.192) [-575.629] (-572.652) (-572.259) -- 0:00:00
Average standard deviation of split frequencies: 0.009363
Analysis completed in 32 seconds
Analysis used 30.94 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -568.62
Likelihood of best state for "cold" chain of run 2 was -568.62
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.8 % ( 80 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.9 % ( 37 %) Dirichlet(Pi{all})
40.7 % ( 39 %) Slider(Pi{all})
88.2 % ( 85 %) Multiplier(Alpha{1,2})
88.3 % ( 89 %) Multiplier(Alpha{3})
25.3 % ( 19 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.1 % ( 91 %) ParsSPR(Tau{all},V{all})
30.7 % ( 27 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
35.8 % ( 40 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
77.6 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
37.9 % ( 32 %) Dirichlet(Pi{all})
39.8 % ( 33 %) Slider(Pi{all})
87.9 % ( 77 %) Multiplier(Alpha{1,2})
88.1 % ( 86 %) Multiplier(Alpha{3})
24.5 % ( 33 %) Slider(Pinvar{all})
98.5 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
30.8 % ( 30 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
35.8 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83102 0.82 0.67
3 | 83329 83289 0.84
4 | 83416 83612 83252
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.80 0.63 0.50
2 | 83927 0.82 0.66
3 | 83067 83072 0.84
4 | 83274 83563 83097
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -570.17
| 2 1 2 |
| 1 1 |
| 2 * 1 2 2 |
|2 1 1 1 2 1 1 1 2 1 1 |
| 1 1 2 2 22 2 1 2 11 2* 1 2 2 1 1 1* 21|
| 2 2 11 2 1 2 1 1 2 1 1 1 2 2 1 |
| * 12 1 *111 *22 2 11 |
|1 1 111 1 1 2 2 1 2 1 |
| 1 2 2 2 2 1 |
| 2 2 21 21 2 2|
| 2 2 2 1 2 2 2 |
| 2 1 22 2 |
| |
| 1 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -572.53
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -570.36 -572.68
2 -570.40 -574.21
--------------------------------------
TOTAL -570.38 -573.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897527 0.085006 0.365387 1.472430 0.872662 723.83 737.41 1.000
r(A<->C){all} 0.173044 0.020027 0.000029 0.448808 0.138304 36.06 58.08 1.010
r(A<->G){all} 0.159232 0.017567 0.000355 0.432440 0.125097 65.99 151.16 1.037
r(A<->T){all} 0.157080 0.018241 0.000126 0.434739 0.115238 80.11 86.56 1.003
r(C<->G){all} 0.186149 0.020859 0.000038 0.473758 0.158134 89.78 109.15 1.009
r(C<->T){all} 0.164531 0.020024 0.000042 0.438922 0.126295 66.27 73.29 0.999
r(G<->T){all} 0.159963 0.017044 0.000008 0.420360 0.127102 96.82 118.40 1.002
pi(A){all} 0.166453 0.000348 0.130794 0.205748 0.166158 424.08 505.02 1.002
pi(C){all} 0.253229 0.000440 0.214434 0.294664 0.252702 470.23 575.03 1.000
pi(G){all} 0.300141 0.000510 0.253950 0.342913 0.299573 559.93 655.47 0.999
pi(T){all} 0.280177 0.000495 0.238935 0.324266 0.279563 615.94 618.61 1.000
alpha{1,2} 0.392802 0.196383 0.000744 1.312228 0.222128 306.99 425.03 0.999
alpha{3} 0.451219 0.238381 0.000156 1.437551 0.288856 440.69 478.81 0.999
pinvar{all} 0.996114 0.000021 0.987654 0.999999 0.997621 629.43 635.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**.**
9 -- .****.
10 -- .**...
11 -- ..*..*
12 -- ....**
13 -- ...**.
14 -- .*.***
15 -- .*...*
16 -- ...*.*
17 -- .*.*..
18 -- ..*.*.
19 -- ..****
20 -- ..**..
21 -- .***.*
22 -- .*.**.
23 -- .**.*.
24 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 266 0.177097 0.011299 0.169108 0.185087 2
8 249 0.165779 0.002825 0.163782 0.167776 2
9 228 0.151798 0.009416 0.145140 0.158455 2
10 220 0.146471 0.003766 0.143808 0.149134 2
11 219 0.145806 0.010357 0.138482 0.153129 2
12 216 0.143808 0.005649 0.139814 0.147803 2
13 215 0.143142 0.002825 0.141145 0.145140 2
14 211 0.140479 0.021656 0.125166 0.155792 2
15 210 0.139814 0.005649 0.135819 0.143808 2
16 207 0.137816 0.023539 0.121172 0.154461 2
17 204 0.135819 0.001883 0.134487 0.137150 2
18 199 0.132490 0.004708 0.129161 0.135819 2
19 188 0.125166 0.003766 0.122503 0.127830 2
20 187 0.124501 0.012240 0.115846 0.133156 2
21 181 0.120506 0.004708 0.117177 0.123835 2
22 152 0.101198 0.020714 0.086551 0.115846 2
23 151 0.100533 0.006591 0.095872 0.105193 2
24 134 0.089214 0.016948 0.077230 0.101198 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102491 0.010605 0.000175 0.315784 0.070679 1.002 2
length{all}[2] 0.100270 0.010033 0.000010 0.302294 0.069163 1.001 2
length{all}[3] 0.099738 0.009693 0.000017 0.298301 0.069571 1.003 2
length{all}[4] 0.098539 0.009810 0.000004 0.301428 0.067851 1.000 2
length{all}[5] 0.101141 0.010082 0.000036 0.300315 0.069617 0.999 2
length{all}[6] 0.099459 0.010305 0.000006 0.304343 0.065575 1.000 2
length{all}[7] 0.095678 0.008846 0.000264 0.268898 0.064334 1.003 2
length{all}[8] 0.094732 0.009979 0.001485 0.283492 0.059979 0.998 2
length{all}[9] 0.113793 0.011630 0.000061 0.312766 0.081968 0.999 2
length{all}[10] 0.098062 0.008254 0.000067 0.282442 0.074749 0.998 2
length{all}[11] 0.093258 0.010398 0.000034 0.296292 0.064455 0.999 2
length{all}[12] 0.095351 0.011069 0.000173 0.323758 0.062210 1.006 2
length{all}[13] 0.091119 0.009190 0.000022 0.309177 0.062956 1.010 2
length{all}[14] 0.098005 0.010459 0.000302 0.316768 0.064177 1.002 2
length{all}[15] 0.102585 0.011436 0.000170 0.346633 0.068406 0.995 2
length{all}[16] 0.112251 0.009722 0.000099 0.325771 0.084230 0.995 2
length{all}[17] 0.101018 0.012966 0.000157 0.274473 0.071360 1.000 2
length{all}[18] 0.093748 0.007607 0.000384 0.245835 0.070765 0.999 2
length{all}[19] 0.100888 0.010648 0.000676 0.261216 0.071161 1.002 2
length{all}[20] 0.115710 0.010981 0.002857 0.325711 0.088516 1.003 2
length{all}[21] 0.091045 0.008513 0.000746 0.289938 0.068287 0.999 2
length{all}[22] 0.098710 0.009556 0.001456 0.266499 0.077927 1.010 2
length{all}[23] 0.090511 0.006983 0.000392 0.273436 0.060701 0.993 2
length{all}[24] 0.089849 0.009878 0.000005 0.268634 0.064436 0.993 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009363
Maximum standard deviation of split frequencies = 0.023539
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 88 trees
95 % credible set contains 95 trees
99 % credible set contains 102 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 417
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 139 / 139 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 139 / 139 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046607 0.017317 0.060142 0.080998 0.091829 0.071146 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -588.600709
Iterating by ming2
Initial: fx= 588.600709
x= 0.04661 0.01732 0.06014 0.08100 0.09183 0.07115 0.30000 1.30000
1 h-m-p 0.0000 0.0001 335.1104 ++ 574.492530 m 0.0001 13 | 1/8
2 h-m-p 0.0014 0.0644 27.5828 -----------.. | 1/8
3 h-m-p 0.0000 0.0002 306.4394 +++ 554.388410 m 0.0002 45 | 2/8
4 h-m-p 0.0021 0.0740 27.2198 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 275.4034 ++ 546.875764 m 0.0001 77 | 3/8
6 h-m-p 0.0009 0.0884 25.8894 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 238.9086 ++ 542.270372 m 0.0001 108 | 4/8
8 h-m-p 0.0007 0.1156 20.9921 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 195.3045 ++ 539.509249 m 0.0001 139 | 5/8
10 h-m-p 0.0007 0.1708 14.8169 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 138.2268 ++ 537.985234 m 0.0001 170 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 --------C 537.985234 0 0.0000 189 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 -Y 537.985234 0 0.0010 203
Out..
lnL = -537.985234
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084918 0.050654 0.029017 0.029686 0.085975 0.098848 0.300116 0.594452 0.204278
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.167727
np = 9
lnL0 = -586.852987
Iterating by ming2
Initial: fx= 586.852987
x= 0.08492 0.05065 0.02902 0.02969 0.08597 0.09885 0.30012 0.59445 0.20428
1 h-m-p 0.0000 0.0002 297.7465 +++ 565.307870 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 186.4131 ++ 564.862589 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0002 363.2995 ++ 554.917453 m 0.0002 39 | 3/9
4 h-m-p 0.0000 0.0002 699.2201 ++ 540.439850 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 964.4330 ++ 540.093327 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 4660.8816 ++ 539.447425 m 0.0000 75 | 6/9
7 h-m-p 0.0019 0.0527 7.1098 ------------.. | 6/9
8 h-m-p 0.0000 0.0001 134.7978 ++ 537.985185 m 0.0001 109 | 7/9
9 h-m-p 1.3751 8.0000 0.0000 ++ 537.985185 m 8.0000 121 | 7/9
10 h-m-p 0.0358 8.0000 0.0011 ++++ 537.985185 m 8.0000 137 | 7/9
11 h-m-p 0.1169 4.0122 0.0719 +Y 537.985185 0 1.0188 152 | 7/9
12 h-m-p 1.6000 8.0000 0.0001 +Y 537.985185 0 4.7619 167 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 537.985185 m 8.0000 181 | 7/9
14 h-m-p 0.0160 8.0000 0.0103 +++Y 537.985185 0 1.7660 198 | 7/9
15 h-m-p 1.6000 8.0000 0.0001 ++ 537.985184 m 8.0000 212 | 7/9
16 h-m-p 0.0086 4.2894 0.3315 ---------C 537.985184 0 0.0000 235 | 7/9
17 h-m-p 0.0004 0.2137 1.6544 +++++ 537.985071 m 0.2137 252 | 8/9
18 h-m-p 0.7972 8.0000 0.0001 ++ 537.985071 m 8.0000 264 | 8/9
19 h-m-p 0.0160 8.0000 0.0681 ----------C 537.985071 0 0.0000 287 | 8/9
20 h-m-p 0.0160 8.0000 1.8187 -------------.. | 8/9
21 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985071 m 8.0000 326 | 8/9
22 h-m-p 0.0160 8.0000 0.3876 -------------.. | 8/9
23 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985070 m 8.0000 366 | 8/9
24 h-m-p 0.0160 8.0000 0.8581 -------------.. | 8/9
25 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985070 m 8.0000 406 | 8/9
26 h-m-p 0.0160 8.0000 0.8556 ------------Y 537.985070 0 0.0000 431 | 8/9
27 h-m-p 0.0160 8.0000 0.0000 ------C 537.985070 0 0.0000 450 | 8/9
28 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985069 m 8.0000 466 | 8/9
29 h-m-p 0.0026 1.3156 0.1612 +++++ 537.985006 m 1.3156 482 | 9/9
30 h-m-p 0.0160 8.0000 0.0000 Y 537.985006 0 0.0160 495 | 9/9
31 h-m-p 0.0160 8.0000 0.0000 Y 537.985006 0 0.0160 507
Out..
lnL = -537.985006
508 lfun, 1524 eigenQcodon, 6096 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092148 0.100536 0.022632 0.072901 0.041744 0.055048 0.000100 1.714612 0.267209 0.477131 1.319731
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.936456
np = 11
lnL0 = -589.098035
Iterating by ming2
Initial: fx= 589.098035
x= 0.09215 0.10054 0.02263 0.07290 0.04174 0.05505 0.00011 1.71461 0.26721 0.47713 1.31973
1 h-m-p 0.0000 0.0000 315.2888 ++ 588.581589 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 246.8404 +++ 570.860103 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0004 109.9793 ++ 559.881129 m 0.0004 45 | 3/11
4 h-m-p 0.0008 0.0040 39.7260 ++ 546.157241 m 0.0040 59 | 4/11
5 h-m-p 0.0000 0.0000 4100612.8443 ++ 540.381227 m 0.0000 73 | 5/11
6 h-m-p 0.0001 0.0003 265.7813 ++ 538.252031 m 0.0003 87 | 6/11
7 h-m-p 0.0000 0.0000 2295012.6092 ++ 537.985173 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 537.985173 m 8.0000 115 | 7/11
9 h-m-p 0.0007 0.0338 2.5898 +++ 537.985159 m 0.0338 134 | 8/11
10 h-m-p 0.2273 8.0000 0.1601 -----------Y 537.985159 0 0.0000 159 | 8/11
11 h-m-p 0.0160 8.0000 0.0008 +++++ 537.985158 m 8.0000 179 | 8/11
12 h-m-p 0.0160 8.0000 3.2295 ------------N 537.985158 0 0.0000 208 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985158 m 8.0000 225 | 8/11
14 h-m-p 0.0160 8.0000 33.1317 -------------.. | 8/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 537.985158 m 8.0000 270 | 8/11
16 h-m-p 0.0004 0.1948 2.5838 +++++ 537.985123 m 0.1948 290 | 9/11
17 h-m-p 0.0876 8.0000 5.1481 -------------C 537.985123 0 0.0000 317 | 9/11
18 h-m-p 0.0160 8.0000 7.0351 ++++Y 537.985006 0 4.0960 335 | 9/11
19 h-m-p 1.6000 8.0000 0.0000 Y 537.985006 0 1.6000 349 | 9/11
20 h-m-p 0.0160 8.0000 0.0000 N 537.985006 0 0.0160 365
Out..
lnL = -537.985006
366 lfun, 1464 eigenQcodon, 6588 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -538.017411 S = -537.985659 -0.012213
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:04
did 20 / 46 patterns 0:04
did 30 / 46 patterns 0:04
did 40 / 46 patterns 0:04
did 46 / 46 patterns 0:04
Time used: 0:04
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.083604 0.078106 0.043162 0.094137 0.038061 0.059697 0.000100 0.514317 0.374305 0.649955 1.460476 2.298951
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 6.381804
np = 12
lnL0 = -590.440372
Iterating by ming2
Initial: fx= 590.440372
x= 0.08360 0.07811 0.04316 0.09414 0.03806 0.05970 0.00011 0.51432 0.37430 0.64995 1.46048 2.29895
1 h-m-p 0.0000 0.0000 308.7041 ++ 588.666032 m 0.0000 17 | 1/12
2 h-m-p 0.0001 0.0034 101.9776 +++ 558.198565 m 0.0034 33 | 2/12
3 h-m-p 0.0000 0.0000 811.7038 ++ 555.107186 m 0.0000 48 | 3/12
4 h-m-p 0.0002 0.0018 147.2642 ++ 545.568877 m 0.0018 63 | 4/12
5 h-m-p 0.0000 0.0000 19612.3444 ++ 542.361921 m 0.0000 78 | 5/12
6 h-m-p 0.0090 0.8318 4.3544 -------------.. | 5/12
7 h-m-p 0.0000 0.0000 232.9005 ++ 539.963302 m 0.0000 119 | 6/12
8 h-m-p 0.0022 1.1128 3.7036 ------------.. | 6/12
9 h-m-p 0.0000 0.0000 193.1621 ++ 538.957039 m 0.0000 159 | 7/12
10 h-m-p 0.0033 1.6413 2.2202 ------------.. | 7/12
11 h-m-p 0.0000 0.0001 137.3915 ++ 537.985235 m 0.0001 199 | 8/12
12 h-m-p 0.0909 8.0000 0.0000 ++++ 537.985235 m 8.0000 216 | 7/12
13 h-m-p -0.0000 -0.0000 0.0037
h-m-p: -0.00000000e+00 -0.00000000e+00 3.69545362e-03 537.985235
.. | 7/12
14 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985235 m 8.0000 255 | 7/12
15 h-m-p 0.0073 3.6469 1.1769 +++Y 537.985214 0 0.9969 278 | 7/12
16 h-m-p 1.6000 8.0000 0.0495 Y 537.985214 0 0.8606 293 | 7/12
17 h-m-p 1.6000 8.0000 0.0001 ++ 537.985214 m 8.0000 313 | 7/12
18 h-m-p 0.0300 8.0000 0.0255 +++C 537.985214 0 1.7931 336 | 7/12
19 h-m-p 1.6000 8.0000 0.0033 ++ 537.985214 m 8.0000 356 | 7/12
20 h-m-p 0.1018 8.0000 0.2578 ---------N 537.985214 0 0.0000 385 | 7/12
21 h-m-p 0.0160 8.0000 0.0881 +++C 537.985214 0 1.0891 408 | 7/12
22 h-m-p 1.6000 8.0000 0.0001 --------C 537.985214 0 0.0000 436
Out..
lnL = -537.985214
437 lfun, 1748 eigenQcodon, 7866 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038723 0.107651 0.071914 0.015442 0.102503 0.070370 0.829018 1.176196 1.896874
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.937610
np = 9
lnL0 = -591.803906
Iterating by ming2
Initial: fx= 591.803906
x= 0.03872 0.10765 0.07191 0.01544 0.10250 0.07037 0.82902 1.17620 1.89687
1 h-m-p 0.0000 0.0001 313.1763 ++ 580.010293 m 0.0001 14 | 1/9
2 h-m-p 0.0011 0.0429 29.6809 +++ 568.215255 m 0.0429 27 | 2/9
3 h-m-p 0.0000 0.0002 125.6518 ++ 565.970159 m 0.0002 39 | 3/9
4 h-m-p 0.0001 0.0010 196.7598 +++ 549.421164 m 0.0010 52 | 4/9
5 h-m-p 0.0000 0.0000 1370.1355 ++ 548.472116 m 0.0000 64 | 5/9
6 h-m-p 0.0002 0.0030 85.7241 ++ 541.841863 m 0.0030 76 | 6/9
7 h-m-p 0.0002 0.0008 206.1799 ++ 537.985065 m 0.0008 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 ++ 537.985065 m 8.0000 100 | 7/9
9 h-m-p 0.0160 8.0000 0.3901 -------------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985064 m 8.0000 142 | 7/9
11 h-m-p 0.0160 8.0000 0.8479 -------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985064 m 8.0000 184 | 7/9
13 h-m-p 0.0160 8.0000 0.8467 ------------Y 537.985064 0 0.0000 210 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985063 m 8.0000 227 | 7/9
15 h-m-p 0.0160 8.0000 1.7700 ------------N 537.985063 0 0.0000 253 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985063 m 8.0000 268 | 7/9
17 h-m-p 0.0037 1.8271 1.3686 ------------.. | 7/9
18 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985063 m 8.0000 307 | 7/9
19 h-m-p 0.0160 8.0000 3.2773 ------------Y 537.985063 0 0.0000 333 | 7/9
20 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985062 m 8.0000 348 | 7/9
21 h-m-p 0.0039 1.9435 1.2991 ------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985062 m 8.0000 387 | 7/9
23 h-m-p 0.0160 8.0000 1.8222 ------------C 537.985062 0 0.0000 413 | 7/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985062 m 8.0000 428 | 7/9
25 h-m-p 0.0160 8.0000 0.0011 +++++ 537.985060 m 8.0000 445 | 7/9
26 h-m-p 0.0160 8.0000 1.2773 -------------.. | 7/9
27 h-m-p 0.0160 8.0000 0.0003 +++++ 537.985060 m 8.0000 485 | 7/9
28 h-m-p 0.0160 8.0000 1.3381 ------------Y 537.985060 0 0.0000 511 | 7/9
29 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985060 m 8.0000 526 | 7/9
30 h-m-p 0.0160 8.0000 0.0010 +++++ 537.985058 m 8.0000 543 | 7/9
31 h-m-p 0.0080 3.1641 1.0338 -----------Y 537.985058 0 0.0000 568 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985058 m 8.0000 583 | 7/9
33 h-m-p 0.0160 8.0000 0.0010 +++++ 537.985057 m 8.0000 600 | 7/9
34 h-m-p 0.0028 0.7272 2.7739 -----------Y 537.985057 0 0.0000 625 | 7/9
35 h-m-p 0.0160 8.0000 0.0000 -Y 537.985057 0 0.0017 638 | 7/9
36 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985057 m 8.0000 655 | 7/9
37 h-m-p 0.0020 0.9751 2.0051 ----------Y 537.985057 0 0.0000 679 | 7/9
38 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985057 m 8.0000 694 | 7/9
39 h-m-p 0.0056 2.7797 1.2860 -----------Y 537.985057 0 0.0000 719 | 7/9
40 h-m-p 0.0160 8.0000 0.0000 +++++ 537.985057 m 8.0000 734 | 7/9
41 h-m-p 0.0160 8.0000 0.0011 +++++ 537.985057 m 8.0000 751 | 7/9
42 h-m-p 0.0160 8.0000 10.1148 ------------C 537.985057 0 0.0000 777 | 7/9
43 h-m-p 0.0160 8.0000 0.0000 -----------N 537.985057 0 0.0000 800 | 7/9
44 h-m-p 0.0160 8.0000 0.0000 -----------N 537.985057 0 0.0000 825
Out..
lnL = -537.985057
826 lfun, 9086 eigenQcodon, 49560 P(t)
Time used: 0:18
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.028354 0.013795 0.107434 0.058609 0.098164 0.040546 0.165898 0.900000 0.215663 1.818745 1.299910
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 19.332412
np = 11
lnL0 = -579.105912
Iterating by ming2
Initial: fx= 579.105912
x= 0.02835 0.01379 0.10743 0.05861 0.09816 0.04055 0.16590 0.90000 0.21566 1.81875 1.29991
1 h-m-p 0.0000 0.0001 261.8062 ++ 570.259695 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0004 174.6519 ++ 561.799880 m 0.0004 30 | 2/11
3 h-m-p 0.0000 0.0001 299.8861 ++ 555.948747 m 0.0001 44 | 3/11
4 h-m-p 0.0004 0.0019 81.6769 ++ 548.938169 m 0.0019 58 | 4/11
5 h-m-p 0.0000 0.0000 5994.7264 ++ 547.005043 m 0.0000 72 | 5/11
6 h-m-p 0.0020 0.0101 13.2773 ++ 545.778825 m 0.0101 86 | 6/11
7 h-m-p 0.0000 0.0000 85254.0756 ++ 543.746001 m 0.0000 100 | 7/11
8 h-m-p 0.0618 0.3091 2.0781 ++ 542.049730 m 0.3091 114 | 8/11
9 h-m-p 0.0038 0.0189 33.0531 ++ 537.985211 m 0.0189 128 | 9/11
10 h-m-p 1.6000 8.0000 0.0001 --------C 537.985211 0 0.0000 150 | 9/11
11 h-m-p 0.0160 8.0000 0.0000 -Y 537.985211 0 0.0010 167
Out..
lnL = -537.985211
168 lfun, 2016 eigenQcodon, 11088 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -537.994909 S = -537.982982 -0.005234
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:21
did 20 / 46 patterns 0:21
did 30 / 46 patterns 0:21
did 40 / 46 patterns 0:21
did 46 / 46 patterns 0:22
Time used: 0:22
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=139
NC_011896_1_WP_010908673_1_2146_MLBR_RS10195 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
NC_002677_1_NP_302353_1_1225_ML2012 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA
**************************************************
NC_011896_1_WP_010908673_1_2146_MLBR_RS10195 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
NC_002677_1_NP_302353_1_1225_ML2012 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320 VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH
**************************************************
NC_011896_1_WP_010908673_1_2146_MLBR_RS10195 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
NC_002677_1_NP_302353_1_1225_ML2012 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320 WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
***************************************
>NC_011896_1_WP_010908673_1_2146_MLBR_RS10195 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG GGCGCCGCACTTGCGAC >NC_002677_1_NP_302353_1_1225_ML2012 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG GGCGCCGCACTTGCGAC >NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG GGCGCCGCACTTGCGAC >NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG GGCGCCGCACTTGCGAC >NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG GGCGCCGCACTTGCGAC >NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320 ATGGCAAGATCTCCCGCCGTGGGTCCTTTTCTTGTTCGCGCTGCGTTGAC CAGTTTGGCGTTGTGGGTGGTCACCCAGTTCGTCCACGGCCTGAGCTTTG TCGGTGGCAACACGACCTTGCAGAGAGTAGGCATCATCTTCGTGGTGGCG GTGATCTTCGGTTTGGTCAACGCGATCATTAAGCCAATCGTGCAAATTTT GTCGATCCCGTTGTACATTTTGACCCTCGGCTTGTTTCACGTCGTCGTTA ACGCGTTGATGCTGTGGATAACGGCCCGAATCACGGGGAACACCACCCAC TGGGGATTGCAAATCGACCACTTCTGGTGGACTGCAATCTGGGCTGCGAT CGTGTTGTCAATTGTGAGCTGGGTGCTGTCGATGCTGATTCGAGGTGCTG GGCGCCGCACTTGCGAC
>NC_011896_1_WP_010908673_1_2146_MLBR_RS10195 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD >NC_002677_1_NP_302353_1_1225_ML2012 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD >NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD >NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD >NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD >NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320 MARSPAVGPFLVRAALTSLALWVVTQFVHGLSFVGGNTTLQRVGIIFVVA VIFGLVNAIIKPIVQILSIPLYILTLGLFHVVVNALMLWITARITGNTTH WGLQIDHFWWTAIWAAIVLSIVSWVLSMLIRGAGRRTCD
#NEXUS
[ID: 5655843461]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908673_1_2146_MLBR_RS10195
NC_002677_1_NP_302353_1_1225_ML2012
NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055
NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450
NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020
NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908673_1_2146_MLBR_RS10195,
2 NC_002677_1_NP_302353_1_1225_ML2012,
3 NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055,
4 NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450,
5 NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020,
6 NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07067946,2:0.06916287,3:0.06957134,4:0.06785145,5:0.06961721,6:0.06557463);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07067946,2:0.06916287,3:0.06957134,4:0.06785145,5:0.06961721,6:0.06557463);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -570.36 -572.68
2 -570.40 -574.21
--------------------------------------
TOTAL -570.38 -573.71
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2012/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897527 0.085006 0.365387 1.472430 0.872662 723.83 737.41 1.000
r(A<->C){all} 0.173044 0.020027 0.000029 0.448808 0.138304 36.06 58.08 1.010
r(A<->G){all} 0.159232 0.017567 0.000355 0.432440 0.125097 65.99 151.16 1.037
r(A<->T){all} 0.157080 0.018241 0.000126 0.434739 0.115238 80.11 86.56 1.003
r(C<->G){all} 0.186149 0.020859 0.000038 0.473758 0.158134 89.78 109.15 1.009
r(C<->T){all} 0.164531 0.020024 0.000042 0.438922 0.126295 66.27 73.29 0.999
r(G<->T){all} 0.159963 0.017044 0.000008 0.420360 0.127102 96.82 118.40 1.002
pi(A){all} 0.166453 0.000348 0.130794 0.205748 0.166158 424.08 505.02 1.002
pi(C){all} 0.253229 0.000440 0.214434 0.294664 0.252702 470.23 575.03 1.000
pi(G){all} 0.300141 0.000510 0.253950 0.342913 0.299573 559.93 655.47 0.999
pi(T){all} 0.280177 0.000495 0.238935 0.324266 0.279563 615.94 618.61 1.000
alpha{1,2} 0.392802 0.196383 0.000744 1.312228 0.222128 306.99 425.03 0.999
alpha{3} 0.451219 0.238381 0.000156 1.437551 0.288856 440.69 478.81 0.999
pinvar{all} 0.996114 0.000021 0.987654 0.999999 0.997621 629.43 635.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2012/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 139
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 12 12 12 12 12 12 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 4 4 4 4 4 4 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 10 10 10 10 10 10 | ACC 6 6 6 6 6 6 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 2 2 2 2 2 2
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 6 6 6 6 6 6 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 9 9 9 9 9 9 | GCG 6 6 6 6 6 6 | GAG 0 0 0 0 0 0 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908673_1_2146_MLBR_RS10195
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
#2: NC_002677_1_NP_302353_1_1225_ML2012
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
#3: NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
#4: NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
#5: NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
#6: NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 24 | TCC 0 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 72 | TCG 12 | TAG 0 | Trp W TGG 42
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 0
CTC 6 | CCC 6 | CAC 24 | CGC 18
CTA 0 | CCA 6 | Gln Q CAA 12 | CGA 12
CTG 24 | CCG 6 | CAG 12 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 60 | ACC 36 | AAC 24 | AGC 12
ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 12
Met M ATG 18 | ACG 18 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 18 | Asp D GAT 0 | Gly G GGT 24
GTC 36 | GCC 12 | GAC 12 | GGC 24
GTA 6 | GCA 12 | Glu E GAA 0 | GGA 6
GTG 54 | GCG 36 | GAG 0 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.23022 C:0.16547 A:0.28777 G:0.31655
position 2: T:0.44604 C:0.23022 A:0.11511 G:0.20863
position 3: T:0.16547 C:0.36691 A:0.09353 G:0.37410
Average T:0.28058 C:0.25420 A:0.16547 G:0.29976
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -537.985234 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300116 1.299910
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908673_1_2146_MLBR_RS10195: 0.000004, NC_002677_1_NP_302353_1_1225_ML2012: 0.000004, NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055: 0.000004, NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450: 0.000004, NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020: 0.000004, NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30012
omega (dN/dS) = 1.29991
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 327.5 89.5 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 327.5 89.5 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 327.5 89.5 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 327.5 89.5 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 327.5 89.5 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 327.5 89.5 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -537.985006 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908673_1_2146_MLBR_RS10195: 0.000004, NC_002677_1_NP_302353_1_1225_ML2012: 0.000004, NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055: 0.000004, NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450: 0.000004, NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020: 0.000004, NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -537.985006 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908673_1_2146_MLBR_RS10195: 0.000004, NC_002677_1_NP_302353_1_1225_ML2012: 0.000004, NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055: 0.000004, NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450: 0.000004, NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020: 0.000004, NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 331.2 85.8 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908673_1_2146_MLBR_RS10195)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -537.985214 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.829018 0.633710 0.190687 0.000001 1.023591 2.186067
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908673_1_2146_MLBR_RS10195: 0.000004, NC_002677_1_NP_302353_1_1225_ML2012: 0.000004, NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055: 0.000004, NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450: 0.000004, NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020: 0.000004, NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.82902
MLEs of dN/dS (w) for site classes (K=3)
p: 0.63371 0.19069 0.17560
w: 0.00000 1.02359 2.18607
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 323.0 94.0 0.5791 0.0000 0.0000 0.0 0.0
7..2 0.000 323.0 94.0 0.5791 0.0000 0.0000 0.0 0.0
7..3 0.000 323.0 94.0 0.5791 0.0000 0.0000 0.0 0.0
7..4 0.000 323.0 94.0 0.5791 0.0000 0.0000 0.0 0.0
7..5 0.000 323.0 94.0 0.5791 0.0000 0.0000 0.0 0.0
7..6 0.000 323.0 94.0 0.5791 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908673_1_2146_MLBR_RS10195)
Pr(w>1) post mean +- SE for w
Note: more than one w>1. Check rst for details
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -537.985057 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.165898 0.005000 1.921009
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908673_1_2146_MLBR_RS10195: 0.000004, NC_002677_1_NP_302353_1_1225_ML2012: 0.000004, NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055: 0.000004, NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450: 0.000004, NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020: 0.000004, NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16590
Parameters in M7 (beta):
p = 0.00500 q = 1.92101
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 329.0 88.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 329.0 88.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 329.0 88.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 329.0 88.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 329.0 88.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 329.0 88.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:18
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -537.985211 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.353896 0.005000 1.229060 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908673_1_2146_MLBR_RS10195: 0.000004, NC_002677_1_NP_302353_1_1225_ML2012: 0.000004, NZ_LVXE01000003_1_WP_010908673_1_1268_A3216_RS02055: 0.000004, NZ_LYPH01000033_1_WP_010908673_1_1348_A8144_RS06450: 0.000004, NZ_CP029543_1_WP_010908673_1_2165_DIJ64_RS11020: 0.000004, NZ_AP014567_1_WP_010908673_1_2225_JK2ML_RS11320: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.35390 p = 0.00500 q = 1.22906
(p1 = 0.64610) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.03539 0.03539 0.03539 0.03539 0.03539 0.03539 0.03539 0.03539 0.03539 0.03539 0.64610
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 331.2 85.8 0.6461 0.0000 0.0000 0.0 0.0
7..2 0.000 331.2 85.8 0.6461 0.0000 0.0000 0.0 0.0
7..3 0.000 331.2 85.8 0.6461 0.0000 0.0000 0.0 0.0
7..4 0.000 331.2 85.8 0.6461 0.0000 0.0000 0.0 0.0
7..5 0.000 331.2 85.8 0.6461 0.0000 0.0000 0.0 0.0
7..6 0.000 331.2 85.8 0.6461 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908673_1_2146_MLBR_RS10195)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:22
Model 1: NearlyNeutral -537.985006 Model 2: PositiveSelection -537.985006 Model 0: one-ratio -537.985234 Model 3: discrete -537.985214 Model 7: beta -537.985057 Model 8: beta&w>1 -537.985211 Model 0 vs 1 4.5599999998557905E-4 Model 2 vs 1 0.0 Model 8 vs 7 3.0800000013186946E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
