--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:47:29 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2035/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -359.25 -362.16
2 -359.23 -362.31
--------------------------------------
TOTAL -359.24 -362.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.913035 0.094792 0.328037 1.502781 0.885668 643.44 693.61 1.000
r(A<->C){all} 0.176202 0.021430 0.000654 0.464556 0.140049 58.55 60.28 1.006
r(A<->G){all} 0.202882 0.026774 0.000121 0.535247 0.160441 45.12 69.14 0.999
r(A<->T){all} 0.161634 0.021688 0.000276 0.469016 0.111189 97.42 115.31 0.999
r(C<->G){all} 0.157389 0.018910 0.000007 0.438624 0.118910 49.20 83.67 1.012
r(C<->T){all} 0.158624 0.020037 0.000010 0.438250 0.116774 39.89 43.64 1.001
r(G<->T){all} 0.143269 0.013524 0.000114 0.372520 0.116206 82.35 152.26 1.007
pi(A){all} 0.211751 0.000643 0.161923 0.263637 0.211150 576.90 647.15 1.001
pi(C){all} 0.290935 0.000785 0.239990 0.350081 0.290371 400.16 575.58 0.999
pi(G){all} 0.298183 0.000833 0.245797 0.354285 0.297871 544.10 619.35 0.999
pi(T){all} 0.199130 0.000563 0.155800 0.244781 0.198205 632.04 691.52 1.003
alpha{1,2} 0.402549 0.194935 0.000155 1.287097 0.242155 527.71 536.64 0.999
alpha{3} 0.444797 0.212011 0.000169 1.388870 0.297561 390.20 481.20 1.004
pinvar{all} 0.993818 0.000055 0.979147 0.999990 0.996152 570.53 588.65 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -348.152806
Model 2: PositiveSelection -348.152797
Model 0: one-ratio -348.152804
Model 3: discrete -348.152798
Model 7: beta -348.152798
Model 8: beta&w>1 -348.152795
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 1.799999995455437E-5
Model 8 vs 7 5.999999984851456E-6
>C1
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C2
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C3
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C4
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C5
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C6
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87
C1 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C2 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C3 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C4 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C5 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C6 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
**************************************************
C1 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C2 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C3 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C4 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C5 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C6 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2610]--->[2610]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.609 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C2 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C3 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C4 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C5 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
C6 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
**************************************************
C1 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C2 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C3 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C4 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C5 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
C6 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
*************************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
C2 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
C3 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
C4 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
C5 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
C6 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
**************************************************
C1 TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
C2 TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
C3 TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
C4 TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
C5 TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
C6 TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
**************************************************
C1 ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
C2 ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
C3 ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
C4 ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
C5 ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
C6 ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
**************************************************
C1 CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
C2 CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
C3 CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
C4 CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
C5 CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
C6 CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
**************************************************
C1 GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
C2 GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
C3 GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
C4 GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
C5 GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
C6 GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
**************************************************
C1 ACGAGCCACAC
C2 ACGAGCCACAC
C3 ACGAGCCACAC
C4 ACGAGCCACAC
C5 ACGAGCCACAC
C6 ACGAGCCACAC
***********
>C1
GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
ACGAGCCACAC
>C2
GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
ACGAGCCACAC
>C3
GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
ACGAGCCACAC
>C4
GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
ACGAGCCACAC
>C5
GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
ACGAGCCACAC
>C6
GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG
TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG
ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT
CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA
GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA
ACGAGCCACAC
>C1
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C2
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C3
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C4
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C5
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
>C6
VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 261 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855601
Setting output file names to "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1225261728
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5348094258
Seed = 177530384
Swapseed = 1579855601
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -584.130513 -- -24.965149
Chain 2 -- -584.130479 -- -24.965149
Chain 3 -- -584.130479 -- -24.965149
Chain 4 -- -584.130513 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -584.130424 -- -24.965149
Chain 2 -- -584.130513 -- -24.965149
Chain 3 -- -584.130479 -- -24.965149
Chain 4 -- -584.130513 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-584.131] (-584.130) (-584.130) (-584.131) * [-584.130] (-584.131) (-584.130) (-584.131)
500 -- (-372.881) [-364.965] (-368.839) (-367.937) * (-375.688) (-366.751) (-363.020) [-364.057] -- 0:00:00
1000 -- (-370.391) [-369.126] (-372.296) (-369.613) * (-365.405) (-364.934) [-363.501] (-367.831) -- 0:00:00
1500 -- (-373.692) (-374.596) [-377.748] (-364.055) * (-369.661) (-366.351) (-366.968) [-364.109] -- 0:00:00
2000 -- (-375.152) [-364.554] (-370.004) (-364.841) * [-368.868] (-367.127) (-363.838) (-370.075) -- 0:00:00
2500 -- (-364.024) (-375.196) [-363.981] (-370.527) * [-366.286] (-379.367) (-372.093) (-369.029) -- 0:00:00
3000 -- [-367.005] (-363.919) (-369.571) (-363.431) * [-371.392] (-371.078) (-371.393) (-368.983) -- 0:00:00
3500 -- (-368.402) (-365.358) [-363.262] (-365.603) * (-369.615) (-375.853) (-370.888) [-371.902] -- 0:00:00
4000 -- (-367.875) (-375.938) [-365.432] (-371.358) * (-369.515) [-367.560] (-366.934) (-373.825) -- 0:00:00
4500 -- (-371.789) (-375.793) [-367.889] (-374.257) * (-368.070) [-364.798] (-368.009) (-369.667) -- 0:01:50
5000 -- (-368.425) (-370.686) (-371.087) [-366.045] * (-371.277) (-371.365) [-364.246] (-369.646) -- 0:01:39
Average standard deviation of split frequencies: 0.089791
5500 -- (-363.741) [-367.227] (-371.470) (-363.478) * (-365.082) (-368.224) [-367.270] (-367.080) -- 0:01:29
6000 -- (-367.357) (-365.297) [-367.406] (-365.457) * (-368.472) (-368.110) (-374.627) [-366.206] -- 0:01:22
6500 -- (-380.409) (-367.133) [-376.357] (-376.539) * (-368.544) (-371.572) [-369.876] (-369.144) -- 0:01:15
7000 -- (-379.659) (-369.538) (-366.888) [-369.355] * (-377.023) [-365.222] (-367.659) (-368.793) -- 0:01:10
7500 -- (-370.898) (-366.460) [-362.663] (-377.826) * (-373.396) (-380.295) (-364.686) [-363.688] -- 0:01:05
8000 -- (-365.131) [-368.961] (-370.708) (-370.587) * (-366.181) [-364.839] (-370.869) (-371.155) -- 0:01:01
8500 -- (-358.331) (-372.121) [-368.095] (-373.193) * (-366.380) (-366.865) [-369.507] (-368.482) -- 0:00:57
9000 -- [-359.239] (-365.745) (-364.297) (-369.585) * [-370.679] (-370.649) (-370.065) (-370.762) -- 0:00:54
9500 -- (-360.485) [-372.157] (-368.802) (-371.138) * [-372.383] (-376.819) (-366.363) (-366.651) -- 0:00:51
10000 -- [-359.310] (-367.055) (-372.027) (-374.161) * (-377.334) (-365.814) (-370.593) [-365.189] -- 0:00:49
Average standard deviation of split frequencies: 0.079550
10500 -- [-359.425] (-375.058) (-374.550) (-372.971) * (-362.136) (-374.860) [-369.267] (-373.679) -- 0:00:46
11000 -- [-360.097] (-370.755) (-366.118) (-365.004) * (-360.098) [-363.730] (-374.415) (-373.644) -- 0:00:44
11500 -- [-358.225] (-373.868) (-370.260) (-371.771) * (-360.522) [-373.313] (-364.389) (-380.212) -- 0:00:42
12000 -- (-359.129) (-373.180) (-366.807) [-369.531] * [-359.278] (-368.534) (-369.400) (-365.290) -- 0:00:40
12500 -- (-360.739) (-370.515) [-364.078] (-375.851) * [-360.501] (-378.775) (-376.038) (-377.104) -- 0:00:39
13000 -- (-362.138) (-377.159) [-371.380] (-382.474) * (-359.010) (-368.783) [-363.160] (-363.238) -- 0:00:37
13500 -- [-360.042] (-374.087) (-373.205) (-368.785) * (-361.171) (-358.854) (-370.919) [-367.874] -- 0:00:36
14000 -- [-360.632] (-370.571) (-366.155) (-365.542) * [-358.565] (-360.138) (-361.866) (-368.036) -- 0:00:34
14500 -- (-362.333) [-370.052] (-367.323) (-369.066) * [-360.301] (-361.957) (-365.280) (-365.048) -- 0:00:33
15000 -- (-360.227) (-375.359) (-372.924) [-366.789] * [-358.464] (-362.269) (-364.077) (-378.547) -- 0:00:32
Average standard deviation of split frequencies: 0.060476
15500 -- (-358.766) (-369.971) [-368.856] (-367.121) * [-358.921] (-358.878) (-362.513) (-369.470) -- 0:00:31
16000 -- [-358.542] (-364.421) (-379.560) (-368.432) * [-359.433] (-357.830) (-358.658) (-368.981) -- 0:00:30
16500 -- (-360.063) (-360.295) (-377.900) [-367.789] * (-361.676) [-357.535] (-360.040) (-373.773) -- 0:00:29
17000 -- [-360.015] (-362.525) (-371.281) (-363.754) * [-360.235] (-358.873) (-360.753) (-376.895) -- 0:00:28
17500 -- (-360.068) (-359.880) (-360.104) [-369.829] * (-358.944) (-361.133) (-360.435) [-362.775] -- 0:00:27
18000 -- (-361.051) [-359.193] (-359.714) (-365.711) * (-361.701) (-359.335) [-358.712] (-365.100) -- 0:00:26
18500 -- (-360.858) (-359.099) [-361.168] (-365.680) * (-358.640) [-361.794] (-359.244) (-369.287) -- 0:00:26
19000 -- [-361.193] (-362.874) (-364.170) (-369.928) * (-361.335) [-359.356] (-358.477) (-377.156) -- 0:00:25
19500 -- (-362.906) [-358.639] (-367.493) (-366.786) * [-358.071] (-360.741) (-363.066) (-378.663) -- 0:00:24
20000 -- (-358.338) (-363.887) (-359.480) [-365.545] * (-358.104) [-359.176] (-362.942) (-382.989) -- 0:00:48
Average standard deviation of split frequencies: 0.042936
20500 -- [-359.192] (-359.034) (-362.951) (-366.235) * (-358.764) (-363.460) [-361.694] (-368.660) -- 0:00:46
21000 -- [-361.285] (-361.298) (-360.511) (-372.964) * (-363.161) (-362.718) (-361.884) [-360.995] -- 0:00:45
21500 -- [-361.534] (-359.520) (-359.291) (-376.511) * (-364.904) (-362.065) [-359.338] (-360.243) -- 0:00:44
22000 -- (-359.399) (-359.447) [-358.117] (-374.673) * (-359.329) (-359.340) [-359.873] (-363.124) -- 0:00:43
22500 -- [-359.586] (-358.761) (-363.800) (-374.303) * (-362.487) (-359.218) [-360.272] (-360.374) -- 0:00:42
23000 -- (-358.114) [-358.493] (-360.312) (-369.673) * (-360.868) (-361.770) [-358.547] (-364.035) -- 0:00:41
23500 -- (-359.650) (-359.672) [-363.579] (-369.500) * [-359.289] (-361.123) (-358.874) (-365.847) -- 0:00:40
24000 -- (-360.837) (-363.001) (-360.007) [-375.434] * (-361.088) (-360.782) [-359.001] (-363.020) -- 0:00:39
24500 -- [-359.526] (-364.145) (-360.042) (-366.160) * (-363.484) (-359.240) [-359.254] (-359.476) -- 0:00:38
25000 -- (-359.494) (-361.591) (-358.100) [-366.774] * (-360.350) (-362.879) (-360.822) [-358.149] -- 0:00:38
Average standard deviation of split frequencies: 0.048667
25500 -- (-359.834) [-360.495] (-363.625) (-374.004) * (-365.374) (-359.383) [-359.462] (-358.493) -- 0:00:37
26000 -- (-358.894) (-361.402) (-362.458) [-368.612] * [-364.189] (-359.609) (-363.408) (-361.045) -- 0:00:36
26500 -- (-359.871) (-359.821) [-359.742] (-386.119) * (-361.195) (-358.898) (-362.719) [-362.672] -- 0:00:35
27000 -- (-358.851) (-359.775) [-362.954] (-386.961) * (-362.914) (-358.296) [-361.336] (-368.369) -- 0:00:35
27500 -- (-358.108) [-359.546] (-359.087) (-382.009) * (-362.481) [-358.775] (-360.842) (-366.981) -- 0:00:34
28000 -- (-361.069) (-360.341) [-358.635] (-379.895) * [-361.587] (-361.155) (-363.776) (-363.441) -- 0:00:33
28500 -- [-358.179] (-360.052) (-359.621) (-371.522) * (-359.838) (-360.615) (-358.907) [-361.805] -- 0:00:33
29000 -- [-358.226] (-358.754) (-364.471) (-365.752) * [-359.060] (-359.972) (-361.666) (-364.815) -- 0:00:32
29500 -- (-362.036) (-359.757) [-359.379] (-361.754) * (-359.531) [-360.359] (-360.614) (-359.537) -- 0:00:31
30000 -- (-359.113) (-359.983) [-359.881] (-360.779) * (-359.741) (-358.840) (-360.993) [-358.839] -- 0:00:31
Average standard deviation of split frequencies: 0.041846
30500 -- [-361.595] (-358.218) (-363.650) (-358.868) * (-360.153) (-360.823) (-363.038) [-360.458] -- 0:00:30
31000 -- [-358.327] (-359.474) (-365.713) (-357.890) * (-360.885) (-359.014) [-358.729] (-360.780) -- 0:00:30
31500 -- [-360.521] (-358.466) (-360.589) (-359.536) * (-359.235) (-359.866) [-359.166] (-359.446) -- 0:00:29
32000 -- (-369.082) (-359.282) (-361.633) [-360.111] * (-360.568) [-361.926] (-361.174) (-360.514) -- 0:00:29
32500 -- [-360.447] (-360.543) (-360.384) (-365.091) * (-359.614) (-361.268) (-358.958) [-358.469] -- 0:00:28
33000 -- (-360.191) (-359.034) [-362.966] (-361.284) * [-359.245] (-358.753) (-362.089) (-358.863) -- 0:00:28
33500 -- (-359.472) [-359.836] (-358.124) (-360.667) * (-359.350) [-359.372] (-364.380) (-359.113) -- 0:00:27
34000 -- (-361.826) (-363.183) (-362.607) [-359.075] * (-363.538) [-360.856] (-361.238) (-359.820) -- 0:00:27
34500 -- (-358.569) [-361.976] (-359.120) (-361.900) * (-362.250) [-358.996] (-359.263) (-359.265) -- 0:00:26
35000 -- (-359.987) (-360.127) (-359.771) [-359.672] * (-366.035) (-357.802) [-362.093] (-360.078) -- 0:00:26
Average standard deviation of split frequencies: 0.037101
35500 -- (-365.450) (-359.101) [-358.063] (-360.936) * (-363.784) (-358.234) (-358.974) [-362.570] -- 0:00:26
36000 -- (-359.503) (-359.651) [-359.015] (-361.241) * (-360.248) [-363.234] (-360.817) (-359.899) -- 0:00:38
36500 -- (-359.421) (-359.455) [-359.519] (-365.844) * (-359.980) (-359.204) [-359.522] (-362.492) -- 0:00:38
37000 -- (-360.950) (-363.637) [-360.710] (-358.031) * (-360.391) [-360.361] (-358.518) (-359.886) -- 0:00:37
37500 -- (-362.400) [-359.137] (-358.498) (-358.462) * (-361.045) [-364.365] (-359.068) (-359.157) -- 0:00:37
38000 -- [-361.800] (-357.996) (-358.273) (-360.686) * (-364.213) (-361.815) (-360.075) [-358.561] -- 0:00:36
38500 -- (-361.623) [-360.345] (-358.524) (-360.452) * (-362.664) [-360.970] (-359.526) (-360.054) -- 0:00:35
39000 -- [-363.574] (-359.548) (-358.325) (-359.805) * [-358.776] (-363.350) (-359.508) (-359.252) -- 0:00:35
39500 -- (-361.668) (-361.608) [-359.398] (-361.578) * (-360.649) [-358.206] (-360.119) (-361.427) -- 0:00:34
40000 -- [-358.908] (-358.764) (-359.793) (-358.703) * [-362.092] (-359.160) (-359.429) (-360.329) -- 0:00:34
Average standard deviation of split frequencies: 0.031725
40500 -- (-360.503) (-361.342) [-362.112] (-363.672) * (-362.323) (-367.481) (-357.742) [-360.152] -- 0:00:34
41000 -- [-360.959] (-362.444) (-359.168) (-360.546) * (-360.140) (-362.602) (-358.679) [-358.922] -- 0:00:33
41500 -- (-358.323) (-362.854) (-361.129) [-361.491] * (-359.690) (-361.141) [-358.287] (-358.539) -- 0:00:33
42000 -- (-358.142) (-362.589) (-359.033) [-360.491] * (-361.335) (-359.628) (-357.583) [-360.819] -- 0:00:32
42500 -- (-361.720) [-361.001] (-359.013) (-362.070) * (-360.646) [-358.140] (-359.557) (-359.722) -- 0:00:32
43000 -- (-358.372) [-359.191] (-360.366) (-363.810) * (-362.827) (-358.089) [-362.411] (-361.123) -- 0:00:31
43500 -- (-359.466) [-362.865] (-367.159) (-362.425) * (-361.823) [-358.829] (-359.287) (-359.164) -- 0:00:31
44000 -- (-357.943) [-361.092] (-357.695) (-364.222) * (-358.406) [-360.125] (-360.866) (-359.997) -- 0:00:31
44500 -- [-359.924] (-363.096) (-360.609) (-361.734) * [-358.267] (-361.721) (-358.020) (-361.697) -- 0:00:30
45000 -- [-359.329] (-362.212) (-360.495) (-359.581) * (-358.886) [-360.251] (-361.453) (-362.076) -- 0:00:30
Average standard deviation of split frequencies: 0.027816
45500 -- (-363.914) (-358.793) (-361.064) [-357.628] * (-361.282) (-358.691) [-359.283] (-360.831) -- 0:00:29
46000 -- (-362.278) (-366.232) (-358.614) [-358.217] * (-363.346) (-358.926) (-358.846) [-358.290] -- 0:00:29
46500 -- (-359.016) [-358.166] (-359.571) (-358.687) * (-362.823) (-362.685) [-360.080] (-359.024) -- 0:00:29
47000 -- [-358.414] (-360.571) (-360.108) (-361.184) * (-362.965) [-364.068] (-361.653) (-359.072) -- 0:00:28
47500 -- (-360.092) [-363.668] (-361.936) (-358.485) * (-359.491) [-360.181] (-360.157) (-361.746) -- 0:00:28
48000 -- (-358.666) (-359.441) [-362.904] (-361.192) * [-358.645] (-361.437) (-361.384) (-358.922) -- 0:00:28
48500 -- [-359.004] (-360.799) (-359.353) (-359.222) * (-358.423) [-359.557] (-361.055) (-361.129) -- 0:00:27
49000 -- (-361.050) [-359.991] (-359.257) (-358.998) * [-359.620] (-358.987) (-361.028) (-360.487) -- 0:00:27
49500 -- [-357.950] (-360.482) (-358.678) (-360.159) * (-365.287) [-360.203] (-359.026) (-359.197) -- 0:00:27
50000 -- (-361.918) (-363.963) (-358.624) [-360.663] * (-363.738) (-362.190) (-361.239) [-360.798] -- 0:00:27
Average standard deviation of split frequencies: 0.031634
50500 -- [-359.563] (-358.946) (-358.162) (-359.562) * (-360.232) (-363.649) [-359.870] (-358.809) -- 0:00:26
51000 -- (-360.683) [-359.223] (-359.329) (-360.630) * (-360.399) (-360.799) [-361.863] (-358.250) -- 0:00:26
51500 -- (-359.305) (-361.565) (-357.801) [-360.812] * (-358.950) [-358.525] (-361.442) (-359.237) -- 0:00:26
52000 -- [-363.206] (-361.094) (-360.834) (-358.957) * (-358.370) (-358.575) [-359.343] (-362.101) -- 0:00:34
52500 -- (-361.774) (-360.153) (-358.317) [-361.542] * (-359.502) [-364.763] (-361.568) (-357.942) -- 0:00:34
53000 -- (-360.441) [-358.162] (-357.745) (-359.385) * (-362.831) [-359.814] (-362.113) (-359.856) -- 0:00:33
53500 -- (-359.655) [-360.874] (-360.571) (-360.261) * (-364.587) [-359.274] (-360.219) (-360.564) -- 0:00:33
54000 -- [-361.545] (-360.361) (-365.065) (-361.053) * [-359.098] (-359.531) (-359.421) (-360.197) -- 0:00:33
54500 -- (-359.074) (-364.628) (-366.894) [-360.464] * (-360.608) (-361.357) (-361.816) [-359.470] -- 0:00:32
55000 -- (-358.964) [-361.665] (-359.524) (-358.961) * [-361.800] (-358.650) (-361.862) (-358.900) -- 0:00:32
Average standard deviation of split frequencies: 0.035355
55500 -- (-358.646) [-360.831] (-361.953) (-358.228) * (-361.929) (-359.337) (-361.979) [-358.569] -- 0:00:32
56000 -- (-360.042) (-362.933) (-359.263) [-359.421] * (-362.656) [-358.348] (-362.008) (-358.760) -- 0:00:31
56500 -- (-361.867) (-363.403) [-361.342] (-363.916) * (-361.436) (-358.948) [-361.186] (-358.775) -- 0:00:31
57000 -- (-360.820) (-360.321) [-358.881] (-357.949) * [-360.607] (-359.097) (-361.844) (-360.718) -- 0:00:31
57500 -- (-361.381) (-359.558) [-358.492] (-358.566) * (-358.785) [-358.579] (-359.813) (-359.459) -- 0:00:30
58000 -- (-358.252) [-358.990] (-361.767) (-359.117) * (-360.281) (-360.123) [-359.982] (-362.943) -- 0:00:30
58500 -- (-359.651) (-359.853) [-358.604] (-361.067) * (-359.986) (-358.976) [-359.206] (-362.176) -- 0:00:30
59000 -- (-361.696) (-360.588) [-362.547] (-361.048) * (-358.904) (-359.960) [-358.884] (-358.617) -- 0:00:29
59500 -- (-359.953) (-360.922) [-358.427] (-360.740) * [-359.046] (-362.596) (-361.133) (-358.981) -- 0:00:29
60000 -- (-360.896) [-360.337] (-360.146) (-359.870) * (-361.617) [-360.082] (-361.266) (-360.011) -- 0:00:29
Average standard deviation of split frequencies: 0.034762
60500 -- (-360.480) (-358.962) [-360.317] (-360.184) * (-362.233) (-359.641) [-360.562] (-359.016) -- 0:00:29
61000 -- [-360.099] (-361.992) (-359.253) (-359.303) * (-361.653) (-359.321) [-359.420] (-360.073) -- 0:00:28
61500 -- [-362.249] (-365.113) (-358.949) (-358.814) * (-364.167) [-358.532] (-361.065) (-360.422) -- 0:00:28
62000 -- (-362.496) (-359.435) [-359.321] (-367.904) * [-362.445] (-362.689) (-360.885) (-360.239) -- 0:00:28
62500 -- [-361.737] (-361.211) (-361.964) (-360.036) * (-360.108) (-362.210) (-362.679) [-359.482] -- 0:00:28
63000 -- (-360.038) (-360.430) (-365.697) [-360.636] * [-360.708] (-359.535) (-359.560) (-357.847) -- 0:00:27
63500 -- (-361.609) [-360.814] (-364.119) (-365.491) * (-360.561) [-358.979] (-358.555) (-358.427) -- 0:00:27
64000 -- (-359.156) [-357.997] (-358.992) (-362.976) * (-358.859) (-360.789) [-359.094] (-359.284) -- 0:00:27
64500 -- (-364.459) (-360.245) [-359.662] (-359.028) * (-359.136) (-359.236) [-359.568] (-361.421) -- 0:00:27
65000 -- (-363.788) [-357.967] (-361.881) (-359.306) * [-359.937] (-361.684) (-358.267) (-363.302) -- 0:00:26
Average standard deviation of split frequencies: 0.028910
65500 -- (-359.629) [-363.817] (-359.352) (-364.326) * (-361.192) (-362.252) [-362.632] (-359.288) -- 0:00:26
66000 -- (-359.891) (-363.192) [-359.084] (-359.575) * (-359.163) [-361.098] (-361.591) (-360.733) -- 0:00:26
66500 -- (-360.658) (-360.282) (-360.450) [-360.942] * [-359.508] (-362.547) (-361.265) (-361.567) -- 0:00:26
67000 -- (-361.341) [-361.071] (-357.683) (-359.318) * (-362.864) [-359.905] (-361.990) (-365.302) -- 0:00:25
67500 -- [-359.729] (-360.335) (-360.684) (-359.697) * (-359.103) (-359.525) [-358.678] (-360.039) -- 0:00:25
68000 -- [-361.419] (-358.735) (-360.388) (-358.884) * (-359.273) (-358.826) (-359.634) [-362.177] -- 0:00:25
68500 -- (-358.022) (-358.049) (-360.770) [-362.765] * (-360.610) (-360.197) [-359.837] (-362.302) -- 0:00:25
69000 -- (-359.662) (-360.878) (-363.025) [-358.603] * (-361.552) [-358.308] (-358.560) (-359.707) -- 0:00:24
69500 -- [-358.793] (-361.218) (-361.488) (-360.224) * (-358.527) [-362.019] (-362.363) (-363.116) -- 0:00:30
70000 -- (-360.501) (-359.340) (-359.924) [-359.012] * (-360.896) [-357.852] (-361.388) (-360.484) -- 0:00:30
Average standard deviation of split frequencies: 0.024348
70500 -- [-361.941] (-361.366) (-358.268) (-360.726) * (-358.550) [-363.073] (-362.936) (-360.475) -- 0:00:30
71000 -- (-361.208) [-359.520] (-359.347) (-359.434) * [-359.213] (-361.212) (-358.161) (-360.583) -- 0:00:30
71500 -- (-361.436) (-361.382) [-360.305] (-361.520) * (-358.220) [-358.826] (-358.667) (-358.758) -- 0:00:29
72000 -- (-361.867) (-358.374) (-362.431) [-366.860] * (-360.799) [-360.087] (-361.847) (-360.251) -- 0:00:29
72500 -- (-362.424) [-360.765] (-361.038) (-359.211) * (-359.220) (-358.832) [-359.498] (-358.725) -- 0:00:29
73000 -- [-361.435] (-360.169) (-362.027) (-358.449) * (-364.181) (-358.981) (-361.422) [-360.290] -- 0:00:29
73500 -- (-358.757) (-358.151) [-363.670] (-357.827) * [-359.705] (-359.158) (-358.196) (-359.981) -- 0:00:29
74000 -- [-360.228] (-362.463) (-358.368) (-360.837) * (-362.786) (-362.943) [-358.944] (-361.481) -- 0:00:28
74500 -- (-359.646) (-361.182) (-363.575) [-360.420] * [-359.697] (-362.090) (-361.962) (-360.044) -- 0:00:28
75000 -- [-359.589] (-358.535) (-362.747) (-358.484) * (-357.945) (-363.678) [-359.476] (-361.616) -- 0:00:28
Average standard deviation of split frequencies: 0.025155
75500 -- [-358.903] (-361.075) (-360.140) (-358.597) * (-357.738) (-360.788) [-361.963] (-358.863) -- 0:00:28
76000 -- [-359.430] (-361.219) (-359.816) (-362.986) * (-359.741) (-362.677) (-362.945) [-358.860] -- 0:00:27
76500 -- (-361.716) (-361.018) [-358.777] (-359.365) * [-359.726] (-360.335) (-366.470) (-358.310) -- 0:00:27
77000 -- (-361.227) (-358.899) [-359.690] (-360.451) * [-359.059] (-361.476) (-360.724) (-361.757) -- 0:00:27
77500 -- [-364.214] (-361.904) (-359.531) (-358.656) * [-358.815] (-360.027) (-360.832) (-360.702) -- 0:00:27
78000 -- [-359.458] (-362.830) (-362.036) (-360.284) * (-362.066) (-359.683) [-359.163] (-364.151) -- 0:00:27
78500 -- [-360.932] (-361.927) (-359.905) (-360.941) * (-361.339) (-358.330) [-358.284] (-358.112) -- 0:00:26
79000 -- (-360.593) [-360.521] (-361.027) (-360.912) * (-360.660) (-361.210) (-358.053) [-358.073] -- 0:00:26
79500 -- [-361.801] (-361.583) (-360.442) (-358.673) * (-360.590) (-362.669) [-361.811] (-359.180) -- 0:00:26
80000 -- [-364.339] (-360.878) (-358.905) (-360.054) * (-361.028) (-361.256) [-359.145] (-360.418) -- 0:00:26
Average standard deviation of split frequencies: 0.025648
80500 -- [-358.326] (-361.186) (-359.742) (-360.185) * (-363.398) (-358.062) (-360.135) [-357.705] -- 0:00:26
81000 -- (-364.376) (-358.475) (-359.048) [-358.545] * [-364.014] (-358.747) (-359.982) (-359.043) -- 0:00:25
81500 -- (-359.346) (-358.111) (-360.841) [-360.994] * (-360.199) (-359.147) (-358.228) [-358.552] -- 0:00:25
82000 -- (-360.688) (-364.675) (-364.239) [-360.024] * [-362.030] (-359.903) (-358.070) (-363.982) -- 0:00:25
82500 -- (-357.998) [-364.352] (-359.531) (-359.964) * (-360.470) [-360.478] (-362.473) (-362.514) -- 0:00:25
83000 -- (-359.191) [-362.497] (-358.736) (-359.386) * [-358.925] (-360.692) (-360.311) (-358.367) -- 0:00:25
83500 -- (-359.570) (-360.338) (-359.948) [-359.971] * (-358.491) (-362.276) [-360.677] (-359.521) -- 0:00:24
84000 -- (-360.260) (-358.378) (-359.250) [-359.625] * [-358.846] (-360.098) (-360.029) (-360.055) -- 0:00:24
84500 -- (-359.529) [-362.005] (-362.087) (-359.097) * (-362.873) (-362.094) [-359.825] (-360.188) -- 0:00:24
85000 -- (-362.447) [-360.610] (-362.868) (-359.625) * [-358.911] (-362.037) (-365.373) (-359.386) -- 0:00:24
Average standard deviation of split frequencies: 0.023570
85500 -- (-361.059) (-358.458) (-363.478) [-360.257] * [-358.937] (-363.693) (-366.357) (-358.225) -- 0:00:24
86000 -- [-359.481] (-359.141) (-361.019) (-362.896) * (-359.655) (-361.606) (-360.645) [-359.469] -- 0:00:24
86500 -- [-359.148] (-360.251) (-360.168) (-359.042) * (-358.167) (-359.167) [-357.694] (-359.431) -- 0:00:28
87000 -- (-359.483) (-363.633) (-358.726) [-360.864] * [-358.858] (-361.042) (-358.452) (-359.505) -- 0:00:28
87500 -- (-360.744) [-359.833] (-365.232) (-360.011) * [-359.379] (-359.804) (-358.475) (-358.779) -- 0:00:28
88000 -- [-359.957] (-362.565) (-366.910) (-361.682) * (-357.614) (-358.802) (-362.284) [-360.292] -- 0:00:28
88500 -- (-359.495) [-358.829] (-358.998) (-360.929) * (-362.509) (-367.705) (-362.061) [-361.681] -- 0:00:27
89000 -- (-360.713) [-358.767] (-360.679) (-363.556) * [-360.447] (-361.715) (-359.535) (-359.993) -- 0:00:27
89500 -- (-364.525) (-359.917) [-359.225] (-360.136) * (-358.880) (-357.967) (-359.664) [-359.739] -- 0:00:27
90000 -- [-360.451] (-360.427) (-357.808) (-357.866) * (-359.320) (-359.858) (-362.161) [-359.051] -- 0:00:27
Average standard deviation of split frequencies: 0.025176
90500 -- [-358.656] (-362.711) (-357.619) (-359.397) * (-358.429) (-360.439) (-360.527) [-359.533] -- 0:00:27
91000 -- (-359.346) (-362.186) [-363.307] (-359.242) * (-359.068) (-361.400) (-360.425) [-362.725] -- 0:00:26
91500 -- (-360.396) [-359.875] (-361.374) (-358.782) * [-358.903] (-361.866) (-359.265) (-360.784) -- 0:00:26
92000 -- (-359.402) (-362.314) (-358.724) [-361.279] * (-364.886) [-360.856] (-361.654) (-361.502) -- 0:00:26
92500 -- [-359.457] (-358.826) (-359.951) (-358.811) * (-360.138) (-361.438) [-359.929] (-361.768) -- 0:00:26
93000 -- [-360.212] (-359.151) (-357.922) (-360.334) * [-360.948] (-362.560) (-360.482) (-358.230) -- 0:00:26
93500 -- [-359.109] (-361.521) (-359.908) (-359.583) * (-360.911) [-364.331] (-360.747) (-358.811) -- 0:00:26
94000 -- [-359.840] (-363.607) (-361.645) (-358.666) * (-360.874) [-359.392] (-369.701) (-362.764) -- 0:00:25
94500 -- [-361.166] (-366.187) (-360.944) (-359.035) * [-359.298] (-362.358) (-363.715) (-361.004) -- 0:00:25
95000 -- [-358.977] (-359.094) (-361.681) (-360.645) * [-359.910] (-359.580) (-363.871) (-358.441) -- 0:00:25
Average standard deviation of split frequencies: 0.020934
95500 -- (-358.791) (-358.834) [-359.152] (-359.070) * (-361.959) (-364.270) [-361.168] (-360.553) -- 0:00:25
96000 -- (-358.737) (-360.328) [-358.139] (-358.552) * (-359.491) (-359.802) [-359.670] (-359.329) -- 0:00:25
96500 -- [-361.779] (-361.685) (-362.396) (-359.312) * [-361.706] (-359.903) (-358.847) (-362.368) -- 0:00:25
97000 -- (-361.949) (-361.033) (-358.965) [-358.176] * [-359.797] (-358.745) (-360.469) (-358.545) -- 0:00:24
97500 -- (-360.345) [-359.857] (-364.581) (-361.766) * [-358.845] (-360.512) (-361.339) (-360.766) -- 0:00:24
98000 -- (-361.866) [-358.206] (-362.965) (-358.904) * (-361.955) [-360.119] (-361.183) (-361.688) -- 0:00:24
98500 -- (-358.790) (-358.591) [-358.554] (-359.065) * (-363.738) (-361.622) (-363.000) [-359.726] -- 0:00:24
99000 -- (-359.956) [-359.541] (-358.467) (-358.707) * [-360.033] (-360.943) (-359.740) (-360.007) -- 0:00:24
99500 -- (-358.338) (-360.831) (-362.653) [-360.340] * (-358.536) [-361.837] (-357.967) (-360.843) -- 0:00:24
100000 -- [-359.352] (-359.901) (-358.225) (-358.401) * (-359.017) [-360.242] (-361.331) (-359.067) -- 0:00:24
Average standard deviation of split frequencies: 0.019833
100500 -- (-358.634) (-368.807) (-358.994) [-358.830] * (-362.345) (-359.943) [-361.828] (-358.477) -- 0:00:23
101000 -- [-359.852] (-363.027) (-359.509) (-359.659) * [-361.262] (-360.358) (-359.296) (-360.808) -- 0:00:23
101500 -- (-361.760) (-359.915) [-358.510] (-359.129) * (-362.610) (-360.734) (-359.947) [-358.930] -- 0:00:23
102000 -- [-360.913] (-361.127) (-358.823) (-358.097) * (-360.283) (-360.616) (-360.609) [-362.226] -- 0:00:23
102500 -- (-359.670) (-364.994) (-358.519) [-358.036] * (-363.663) (-358.936) (-362.226) [-359.890] -- 0:00:23
103000 -- (-362.313) (-361.768) [-359.831] (-363.865) * [-359.892] (-360.970) (-360.974) (-359.858) -- 0:00:23
103500 -- (-363.399) (-360.477) [-360.267] (-361.801) * (-359.530) [-358.775] (-360.432) (-360.428) -- 0:00:22
104000 -- (-358.499) (-358.595) (-359.284) [-359.911] * [-361.480] (-359.159) (-363.796) (-360.032) -- 0:00:26
104500 -- [-359.815] (-359.150) (-358.626) (-361.387) * [-359.437] (-358.478) (-359.272) (-358.695) -- 0:00:26
105000 -- (-358.828) [-359.744] (-358.020) (-363.938) * [-361.423] (-363.015) (-359.223) (-363.229) -- 0:00:26
Average standard deviation of split frequencies: 0.020129
105500 -- (-359.805) (-359.545) [-358.874] (-359.289) * (-361.466) (-361.300) [-359.277] (-358.512) -- 0:00:26
106000 -- (-360.594) [-358.750] (-359.301) (-359.430) * [-362.365] (-360.870) (-358.273) (-359.751) -- 0:00:26
106500 -- (-361.794) [-358.446] (-360.735) (-361.433) * [-360.739] (-360.762) (-359.478) (-359.854) -- 0:00:25
107000 -- (-358.871) (-359.996) [-357.988] (-360.521) * (-360.813) (-359.868) [-360.898] (-360.934) -- 0:00:25
107500 -- (-362.047) (-361.720) [-358.807] (-360.369) * (-359.757) (-358.561) (-357.911) [-359.027] -- 0:00:25
108000 -- (-359.381) [-360.824] (-360.709) (-358.311) * (-360.815) (-360.547) [-358.209] (-359.506) -- 0:00:25
108500 -- (-358.128) (-359.292) [-360.677] (-358.459) * (-361.338) (-361.988) [-359.704] (-360.481) -- 0:00:25
109000 -- (-362.914) [-359.057] (-361.437) (-358.136) * [-361.032] (-360.158) (-359.033) (-358.450) -- 0:00:25
109500 -- (-360.804) (-360.784) [-358.197] (-360.093) * (-358.912) (-359.788) [-359.479] (-358.794) -- 0:00:24
110000 -- (-361.636) (-357.962) (-360.617) [-358.980] * (-358.889) (-358.496) [-358.503] (-361.195) -- 0:00:24
Average standard deviation of split frequencies: 0.018864
110500 -- [-360.370] (-359.036) (-358.523) (-358.011) * (-359.574) (-361.371) [-359.299] (-357.789) -- 0:00:24
111000 -- [-358.168] (-362.854) (-360.549) (-358.561) * (-362.944) (-363.231) (-359.233) [-358.677] -- 0:00:24
111500 -- (-358.475) (-358.869) (-360.194) [-359.121] * (-360.724) [-362.173] (-359.998) (-358.350) -- 0:00:24
112000 -- (-358.719) [-359.441] (-361.054) (-359.271) * (-360.482) (-360.332) (-359.319) [-361.423] -- 0:00:24
112500 -- (-358.925) (-363.747) (-363.567) [-361.197] * [-359.734] (-361.318) (-360.821) (-359.769) -- 0:00:24
113000 -- (-360.702) (-362.008) (-358.191) [-360.284] * [-360.140] (-359.485) (-359.666) (-363.370) -- 0:00:23
113500 -- (-357.922) (-359.362) (-360.503) [-360.054] * (-360.203) (-357.680) [-361.393] (-362.972) -- 0:00:23
114000 -- (-359.029) [-362.211] (-360.792) (-360.390) * (-359.057) (-359.838) [-358.921] (-363.972) -- 0:00:23
114500 -- (-358.991) (-363.054) [-359.201] (-360.490) * (-360.976) (-361.258) [-359.634] (-361.294) -- 0:00:23
115000 -- (-361.835) (-363.828) [-361.827] (-358.309) * [-359.624] (-361.867) (-359.360) (-363.405) -- 0:00:23
Average standard deviation of split frequencies: 0.019913
115500 -- [-358.659] (-361.378) (-360.695) (-360.368) * [-358.355] (-359.526) (-361.054) (-361.267) -- 0:00:23
116000 -- [-359.568] (-360.627) (-358.028) (-361.323) * (-360.404) (-358.468) [-360.081] (-360.297) -- 0:00:23
116500 -- (-361.451) [-363.430] (-358.155) (-360.267) * [-359.560] (-361.106) (-360.189) (-358.155) -- 0:00:23
117000 -- (-362.292) (-359.234) (-360.041) [-357.812] * (-360.938) [-364.805] (-360.062) (-359.028) -- 0:00:22
117500 -- [-361.078] (-360.337) (-359.375) (-360.775) * (-358.980) [-359.714] (-358.264) (-359.476) -- 0:00:22
118000 -- [-360.289] (-358.677) (-358.717) (-361.368) * (-362.918) [-358.832] (-357.791) (-358.908) -- 0:00:22
118500 -- [-360.725] (-363.383) (-358.725) (-359.299) * [-364.476] (-358.736) (-359.909) (-359.228) -- 0:00:22
119000 -- [-360.943] (-361.646) (-357.948) (-364.498) * [-359.068] (-358.155) (-359.360) (-359.630) -- 0:00:22
119500 -- (-359.784) (-361.440) [-360.787] (-359.088) * (-360.315) (-359.040) [-360.131] (-361.900) -- 0:00:22
120000 -- [-359.326] (-360.831) (-361.904) (-359.215) * (-360.758) (-360.601) [-358.841] (-359.248) -- 0:00:22
Average standard deviation of split frequencies: 0.021394
120500 -- (-362.555) (-359.626) [-364.357] (-362.397) * [-359.380] (-363.100) (-358.922) (-367.510) -- 0:00:22
121000 -- [-360.378] (-362.157) (-359.845) (-360.348) * (-359.801) (-359.593) (-359.758) [-363.938] -- 0:00:25
121500 -- (-358.934) (-359.725) (-358.749) [-361.198] * [-360.829] (-363.822) (-360.423) (-359.608) -- 0:00:24
122000 -- [-358.684] (-361.107) (-363.412) (-358.291) * (-363.039) (-361.855) (-359.205) [-359.277] -- 0:00:24
122500 -- (-361.422) (-361.875) [-362.178] (-363.607) * (-360.122) (-360.376) [-360.707] (-360.917) -- 0:00:24
123000 -- [-358.453] (-361.074) (-362.435) (-361.027) * (-360.391) (-361.539) [-360.584] (-359.071) -- 0:00:24
123500 -- (-359.556) (-361.579) [-359.334] (-362.160) * (-362.485) (-361.144) (-358.846) [-359.652] -- 0:00:24
124000 -- [-360.465] (-359.372) (-360.160) (-363.890) * (-359.874) [-358.597] (-358.990) (-364.122) -- 0:00:24
124500 -- (-359.077) (-358.782) (-359.315) [-360.621] * (-358.111) [-361.154] (-360.226) (-365.422) -- 0:00:24
125000 -- (-358.409) [-358.965] (-358.151) (-360.799) * [-358.029] (-358.847) (-359.315) (-360.778) -- 0:00:24
Average standard deviation of split frequencies: 0.021379
125500 -- (-358.729) (-364.941) (-358.774) [-359.304] * (-359.567) (-358.367) [-358.031] (-359.341) -- 0:00:23
126000 -- (-364.224) (-361.108) (-359.037) [-361.171] * [-360.470] (-360.841) (-359.199) (-360.056) -- 0:00:23
126500 -- (-364.344) (-358.952) (-360.120) [-361.980] * (-361.100) [-359.733] (-361.501) (-358.182) -- 0:00:23
127000 -- (-359.532) (-360.114) (-362.293) [-359.691] * [-360.109] (-360.319) (-360.616) (-364.908) -- 0:00:23
127500 -- (-358.109) (-363.747) [-364.499] (-358.429) * [-359.090] (-358.456) (-359.552) (-358.645) -- 0:00:23
128000 -- [-361.523] (-359.376) (-359.929) (-359.405) * (-361.715) (-360.598) [-360.619] (-358.811) -- 0:00:23
128500 -- (-359.691) (-358.812) [-360.107] (-359.171) * (-358.511) (-358.981) (-359.265) [-360.932] -- 0:00:23
129000 -- [-362.340] (-358.304) (-362.708) (-359.401) * [-358.126] (-361.953) (-363.205) (-361.540) -- 0:00:23
129500 -- (-362.900) (-361.876) (-360.792) [-361.010] * (-359.763) (-361.328) [-362.617] (-362.115) -- 0:00:22
130000 -- [-358.537] (-359.580) (-362.371) (-359.420) * (-358.398) (-360.685) (-361.075) [-361.375] -- 0:00:22
Average standard deviation of split frequencies: 0.021474
130500 -- [-359.681] (-360.171) (-363.575) (-361.198) * (-359.518) (-360.624) [-358.346] (-361.228) -- 0:00:22
131000 -- (-360.115) [-359.827] (-360.911) (-358.598) * (-359.303) (-363.158) (-359.640) [-358.175] -- 0:00:22
131500 -- [-362.553] (-359.877) (-361.406) (-358.821) * [-359.205] (-364.815) (-360.218) (-361.114) -- 0:00:22
132000 -- (-366.026) (-362.623) (-358.644) [-359.501] * (-361.234) (-363.570) (-361.196) [-360.835] -- 0:00:22
132500 -- (-364.182) [-360.622] (-359.173) (-359.738) * (-359.020) [-359.631] (-358.026) (-359.036) -- 0:00:22
133000 -- (-361.639) [-359.904] (-360.975) (-360.791) * [-357.760] (-362.649) (-358.616) (-359.820) -- 0:00:22
133500 -- (-358.207) [-360.474] (-358.851) (-363.232) * [-358.007] (-361.528) (-360.497) (-359.258) -- 0:00:21
134000 -- (-365.068) (-361.245) (-361.027) [-360.479] * (-361.557) (-362.089) (-359.944) [-359.155] -- 0:00:21
134500 -- (-358.552) [-361.665] (-364.117) (-363.048) * (-359.925) (-361.006) (-359.482) [-360.214] -- 0:00:21
135000 -- [-359.813] (-362.345) (-358.858) (-361.421) * (-360.273) (-360.135) [-359.995] (-362.177) -- 0:00:21
Average standard deviation of split frequencies: 0.019338
135500 -- (-359.647) [-363.479] (-359.511) (-361.006) * (-358.255) [-358.891] (-363.682) (-359.570) -- 0:00:21
136000 -- [-359.245] (-358.951) (-360.254) (-361.459) * (-365.390) [-359.784] (-358.064) (-364.831) -- 0:00:21
136500 -- (-359.712) (-359.674) (-358.018) [-359.080] * [-360.519] (-361.707) (-361.082) (-361.427) -- 0:00:21
137000 -- (-363.757) [-357.877] (-362.035) (-359.526) * (-359.546) (-363.343) [-363.713] (-362.058) -- 0:00:21
137500 -- (-358.938) [-359.026] (-364.148) (-365.810) * (-360.941) (-361.147) (-360.123) [-359.828] -- 0:00:21
138000 -- (-358.176) (-360.634) (-361.013) [-360.331] * (-358.764) [-358.627] (-359.895) (-363.046) -- 0:00:20
138500 -- (-361.597) [-358.230] (-359.977) (-359.869) * [-358.648] (-359.190) (-365.483) (-358.706) -- 0:00:23
139000 -- [-357.554] (-358.483) (-362.471) (-361.574) * (-358.753) (-361.185) (-363.452) [-359.241] -- 0:00:23
139500 -- (-358.041) [-360.754] (-360.195) (-359.129) * (-358.289) [-361.835] (-359.491) (-361.547) -- 0:00:23
140000 -- (-359.071) [-363.767] (-360.880) (-361.749) * (-362.129) (-361.181) (-365.828) [-361.330] -- 0:00:23
Average standard deviation of split frequencies: 0.016051
140500 -- (-358.073) (-362.612) [-360.451] (-359.583) * (-359.149) [-359.031] (-361.160) (-358.792) -- 0:00:23
141000 -- (-357.992) (-360.314) [-358.054] (-359.898) * (-360.158) (-361.857) (-363.637) [-358.457] -- 0:00:22
141500 -- (-362.705) (-359.965) (-358.054) [-359.884] * [-360.101] (-362.071) (-360.659) (-359.320) -- 0:00:22
142000 -- (-359.550) [-360.913] (-358.325) (-358.487) * [-359.899] (-360.002) (-360.637) (-362.497) -- 0:00:22
142500 -- [-359.057] (-362.845) (-359.204) (-360.213) * (-361.623) (-360.967) [-357.901] (-361.989) -- 0:00:22
143000 -- [-358.417] (-360.376) (-359.647) (-360.149) * (-358.507) (-360.765) [-358.531] (-362.274) -- 0:00:22
143500 -- (-359.178) (-363.385) [-359.897] (-359.900) * (-359.073) (-359.921) [-360.770] (-359.261) -- 0:00:22
144000 -- (-361.368) (-361.381) (-358.370) [-362.366] * (-358.956) (-360.287) (-359.035) [-361.284] -- 0:00:22
144500 -- (-361.172) (-360.112) [-360.206] (-363.625) * (-362.031) (-360.837) [-359.303] (-359.865) -- 0:00:22
145000 -- [-358.311] (-358.444) (-362.493) (-360.321) * [-360.269] (-361.196) (-360.378) (-362.928) -- 0:00:22
Average standard deviation of split frequencies: 0.015821
145500 -- [-359.579] (-357.680) (-359.600) (-357.980) * (-366.333) [-363.361] (-358.008) (-359.471) -- 0:00:21
146000 -- (-360.300) (-359.439) (-359.240) [-359.657] * (-362.566) (-359.660) (-360.102) [-359.615] -- 0:00:21
146500 -- (-365.295) (-360.382) [-359.081] (-360.638) * (-360.225) [-359.682] (-358.831) (-360.433) -- 0:00:21
147000 -- (-361.438) (-359.756) [-362.652] (-364.889) * [-357.965] (-358.033) (-361.609) (-360.092) -- 0:00:21
147500 -- [-359.153] (-361.740) (-360.352) (-363.913) * (-362.675) (-357.898) (-360.242) [-358.979] -- 0:00:21
148000 -- (-360.890) [-358.866] (-361.440) (-368.044) * [-360.662] (-360.690) (-364.591) (-362.594) -- 0:00:21
148500 -- (-359.654) [-359.233] (-359.463) (-360.886) * [-359.854] (-358.460) (-361.224) (-370.028) -- 0:00:21
149000 -- (-360.638) (-361.910) (-363.084) [-357.871] * (-362.295) (-361.185) [-360.628] (-361.326) -- 0:00:21
149500 -- (-358.196) (-362.067) [-363.979] (-359.665) * (-364.619) [-361.821] (-360.746) (-360.716) -- 0:00:21
150000 -- (-359.926) [-359.544] (-358.738) (-360.973) * [-360.859] (-361.258) (-359.410) (-360.600) -- 0:00:21
Average standard deviation of split frequencies: 0.015973
150500 -- (-358.933) (-358.963) (-362.045) [-360.378] * (-358.678) (-359.814) [-359.328] (-359.363) -- 0:00:20
151000 -- (-358.224) (-358.353) [-359.592] (-358.975) * (-358.742) (-360.020) (-359.750) [-359.011] -- 0:00:20
151500 -- (-360.362) [-359.802] (-361.741) (-365.610) * [-358.063] (-359.954) (-360.642) (-361.298) -- 0:00:20
152000 -- (-358.575) (-364.111) [-359.714] (-364.296) * (-358.505) [-365.467] (-360.286) (-360.764) -- 0:00:20
152500 -- (-359.549) (-360.864) [-362.112] (-358.991) * (-360.442) (-362.133) [-359.632] (-362.000) -- 0:00:20
153000 -- (-359.043) (-360.269) [-358.056] (-363.863) * [-360.054] (-362.744) (-358.925) (-363.897) -- 0:00:20
153500 -- (-364.255) (-359.408) (-364.426) [-359.622] * (-361.779) [-358.531] (-360.068) (-357.996) -- 0:00:20
154000 -- (-365.388) [-360.785] (-363.455) (-363.098) * (-364.204) (-359.827) [-358.650] (-357.985) -- 0:00:20
154500 -- (-359.109) (-362.468) (-361.250) [-361.910] * [-360.820] (-359.735) (-359.141) (-368.542) -- 0:00:20
155000 -- (-367.777) (-360.408) (-358.392) [-358.348] * (-361.924) (-361.226) [-358.509] (-364.700) -- 0:00:20
Average standard deviation of split frequencies: 0.015427
155500 -- (-362.855) [-361.229] (-358.072) (-360.637) * (-361.299) (-360.749) [-363.587] (-358.801) -- 0:00:22
156000 -- (-362.868) (-366.015) [-357.886] (-358.909) * [-363.148] (-358.640) (-360.573) (-362.771) -- 0:00:22
156500 -- (-360.124) (-362.401) (-358.060) [-359.550] * (-358.842) (-358.833) [-359.605] (-359.391) -- 0:00:21
157000 -- (-359.553) [-362.581] (-358.582) (-362.033) * (-360.865) [-360.115] (-361.113) (-358.470) -- 0:00:21
157500 -- (-361.172) (-357.641) (-360.402) [-359.672] * [-359.169] (-362.870) (-363.251) (-360.413) -- 0:00:21
158000 -- (-362.245) (-358.391) (-359.630) [-358.272] * [-361.459] (-359.867) (-361.474) (-360.982) -- 0:00:21
158500 -- (-367.026) (-358.732) (-359.866) [-359.167] * (-365.864) (-358.314) [-359.704] (-358.445) -- 0:00:21
159000 -- (-360.441) (-360.338) (-359.127) [-360.088] * [-361.211] (-360.138) (-360.850) (-358.453) -- 0:00:21
159500 -- (-360.689) (-358.255) (-360.534) [-358.726] * (-362.746) (-360.900) [-361.538] (-360.347) -- 0:00:21
160000 -- (-360.538) (-362.614) (-358.569) [-359.494] * (-358.666) [-362.963] (-362.013) (-360.376) -- 0:00:21
Average standard deviation of split frequencies: 0.013435
160500 -- [-358.941] (-358.778) (-361.317) (-362.639) * (-363.838) (-360.801) [-360.354] (-358.714) -- 0:00:21
161000 -- (-360.009) (-358.979) (-361.826) [-360.302] * (-359.418) (-358.224) [-358.688] (-358.973) -- 0:00:21
161500 -- (-359.825) [-359.820] (-361.742) (-359.147) * (-360.957) (-358.084) [-358.476] (-359.178) -- 0:00:20
162000 -- (-363.680) [-361.521] (-363.155) (-360.931) * (-358.498) (-358.322) [-362.793] (-360.170) -- 0:00:20
162500 -- (-359.355) (-358.456) [-364.004] (-359.585) * [-358.620] (-360.759) (-361.800) (-368.581) -- 0:00:20
163000 -- (-363.104) [-358.628] (-365.596) (-364.630) * (-358.686) [-360.590] (-361.579) (-360.597) -- 0:00:20
163500 -- (-362.973) [-360.556] (-361.242) (-363.998) * (-358.951) (-360.432) [-359.324] (-358.702) -- 0:00:20
164000 -- (-357.904) (-359.150) (-359.829) [-359.908] * (-359.673) (-359.651) [-359.026] (-357.769) -- 0:00:20
164500 -- (-361.268) (-360.846) (-358.412) [-359.660] * [-358.612] (-360.802) (-360.400) (-357.888) -- 0:00:20
165000 -- (-359.843) [-360.161] (-359.645) (-358.848) * (-358.999) (-360.500) (-360.278) [-358.578] -- 0:00:20
Average standard deviation of split frequencies: 0.014348
165500 -- [-360.030] (-358.689) (-359.144) (-359.774) * (-360.238) [-362.113] (-359.799) (-358.910) -- 0:00:20
166000 -- (-361.377) [-358.903] (-359.586) (-360.163) * (-358.356) [-361.323] (-359.900) (-364.088) -- 0:00:20
166500 -- [-361.030] (-362.328) (-358.581) (-358.500) * [-360.003] (-358.183) (-358.834) (-360.364) -- 0:00:20
167000 -- [-359.350] (-360.453) (-358.273) (-361.487) * (-358.402) (-359.148) [-358.741] (-359.230) -- 0:00:19
167500 -- (-357.864) (-359.486) (-361.398) [-360.549] * (-361.768) [-360.070] (-363.851) (-363.246) -- 0:00:19
168000 -- (-363.486) [-362.795] (-358.755) (-360.152) * [-360.286] (-360.230) (-358.469) (-360.002) -- 0:00:19
168500 -- (-359.311) (-364.552) (-360.904) [-360.112] * (-361.520) (-363.695) (-358.963) [-358.373] -- 0:00:19
169000 -- (-359.487) (-361.474) (-360.987) [-359.477] * (-362.663) (-366.429) (-359.894) [-358.476] -- 0:00:19
169500 -- (-361.442) [-359.529] (-360.701) (-358.794) * (-359.607) (-361.681) (-359.300) [-358.045] -- 0:00:19
170000 -- (-361.993) (-358.966) [-359.887] (-359.060) * (-362.311) (-361.736) (-359.623) [-360.578] -- 0:00:19
Average standard deviation of split frequencies: 0.015991
170500 -- (-360.863) (-359.112) [-359.582] (-358.946) * (-364.765) (-362.259) (-362.227) [-363.843] -- 0:00:19
171000 -- (-358.660) (-359.876) [-361.133] (-358.548) * (-360.175) (-358.124) [-360.782] (-358.976) -- 0:00:19
171500 -- (-359.212) (-358.787) (-361.761) [-364.336] * (-359.451) [-358.190] (-358.902) (-359.737) -- 0:00:19
172000 -- (-361.885) (-358.612) (-360.598) [-359.764] * (-361.641) (-358.953) [-358.146] (-359.009) -- 0:00:19
172500 -- (-362.223) [-359.887] (-360.478) (-361.174) * (-361.329) (-359.163) [-358.741] (-358.022) -- 0:00:18
173000 -- (-361.685) [-360.870] (-364.916) (-364.094) * (-357.848) (-358.030) [-358.701] (-359.612) -- 0:00:20
173500 -- [-359.612] (-359.916) (-360.821) (-362.864) * (-360.095) (-360.158) (-358.810) [-360.215] -- 0:00:20
174000 -- [-358.314] (-361.168) (-359.169) (-359.604) * (-358.375) (-359.896) [-360.199] (-361.200) -- 0:00:20
174500 -- (-360.868) (-359.154) (-359.467) [-358.286] * (-358.580) [-359.271] (-362.277) (-359.464) -- 0:00:20
175000 -- (-361.521) [-359.015] (-361.180) (-361.159) * [-359.849] (-358.253) (-359.516) (-360.841) -- 0:00:20
Average standard deviation of split frequencies: 0.017198
175500 -- (-358.338) [-359.013] (-361.575) (-361.918) * [-362.549] (-359.632) (-361.698) (-359.692) -- 0:00:20
176000 -- (-364.007) (-361.887) [-358.978] (-359.123) * (-359.117) [-358.383] (-363.447) (-365.415) -- 0:00:20
176500 -- (-359.844) [-359.995] (-360.760) (-363.624) * (-358.580) (-361.706) [-358.343] (-358.834) -- 0:00:20
177000 -- [-359.524] (-361.541) (-360.792) (-362.483) * (-363.550) [-361.142] (-359.826) (-358.879) -- 0:00:20
177500 -- (-363.059) [-360.840] (-364.505) (-358.854) * (-363.327) (-359.618) (-363.121) [-362.288] -- 0:00:19
178000 -- (-358.529) [-359.779] (-359.382) (-360.417) * [-362.770] (-362.681) (-359.321) (-362.149) -- 0:00:19
178500 -- (-359.610) [-362.899] (-363.582) (-358.552) * [-359.053] (-360.007) (-360.085) (-364.609) -- 0:00:19
179000 -- (-362.501) [-362.251] (-360.474) (-361.211) * [-359.404] (-361.692) (-358.922) (-360.284) -- 0:00:19
179500 -- [-359.650] (-359.538) (-360.368) (-361.162) * (-359.259) (-359.419) [-358.755] (-362.043) -- 0:00:19
180000 -- [-358.414] (-360.347) (-358.147) (-359.152) * (-360.730) (-359.146) [-359.127] (-359.029) -- 0:00:19
Average standard deviation of split frequencies: 0.019032
180500 -- (-364.012) (-358.612) (-358.490) [-359.282] * [-360.492] (-361.989) (-361.716) (-361.398) -- 0:00:19
181000 -- [-360.161] (-360.460) (-359.017) (-358.252) * (-359.396) (-361.150) [-359.725] (-359.767) -- 0:00:19
181500 -- (-360.775) (-359.944) (-359.597) [-361.045] * (-363.373) (-366.464) [-359.394] (-360.813) -- 0:00:19
182000 -- (-364.082) (-358.108) [-358.692] (-358.272) * (-359.262) (-361.357) (-359.938) [-359.300] -- 0:00:19
182500 -- (-359.180) (-361.925) (-357.701) [-358.685] * (-361.573) (-358.542) [-358.124] (-361.984) -- 0:00:19
183000 -- (-360.696) (-363.114) [-359.030] (-361.477) * (-360.726) (-358.416) [-359.155] (-363.053) -- 0:00:19
183500 -- (-361.457) (-360.956) [-357.844] (-358.546) * (-361.541) [-359.919] (-359.388) (-359.814) -- 0:00:18
184000 -- (-360.623) (-360.003) (-358.788) [-359.713] * [-358.211] (-362.773) (-361.937) (-358.439) -- 0:00:18
184500 -- (-360.600) (-359.880) [-358.281] (-358.438) * (-360.157) (-361.725) (-358.676) [-359.365] -- 0:00:18
185000 -- (-359.544) (-365.422) [-362.810] (-359.898) * [-360.249] (-362.135) (-358.534) (-360.464) -- 0:00:18
Average standard deviation of split frequencies: 0.017207
185500 -- (-362.943) [-360.066] (-358.935) (-359.888) * (-362.306) (-358.054) (-365.872) [-360.134] -- 0:00:18
186000 -- [-360.568] (-360.529) (-359.368) (-359.952) * (-358.828) (-359.547) [-359.187] (-359.429) -- 0:00:18
186500 -- (-361.048) (-361.020) (-365.001) [-359.573] * (-360.880) [-361.677] (-360.224) (-360.544) -- 0:00:18
187000 -- (-359.735) [-360.898] (-363.319) (-359.613) * [-361.166] (-361.113) (-361.275) (-361.074) -- 0:00:18
187500 -- [-360.139] (-361.067) (-362.494) (-363.641) * [-360.559] (-362.883) (-368.657) (-358.693) -- 0:00:18
188000 -- [-360.547] (-363.482) (-362.340) (-364.543) * (-360.481) (-358.364) (-361.296) [-359.362] -- 0:00:18
188500 -- (-357.997) [-359.381] (-360.759) (-364.186) * (-358.454) [-360.078] (-363.172) (-358.638) -- 0:00:18
189000 -- (-358.113) (-360.576) (-363.519) [-361.306] * [-360.279] (-359.866) (-359.660) (-362.995) -- 0:00:18
189500 -- [-360.591] (-362.538) (-360.629) (-360.339) * [-361.910] (-361.207) (-358.214) (-361.115) -- 0:00:18
190000 -- (-359.355) (-358.135) [-358.648] (-359.943) * (-360.454) (-361.013) (-358.690) [-358.815] -- 0:00:19
Average standard deviation of split frequencies: 0.016786
190500 -- (-358.732) (-363.916) (-360.069) [-358.673] * (-360.108) (-362.562) (-362.285) [-360.815] -- 0:00:19
191000 -- [-358.866] (-368.555) (-364.324) (-362.872) * (-361.131) [-360.299] (-360.616) (-360.944) -- 0:00:19
191500 -- (-358.307) [-361.754] (-358.805) (-360.623) * (-358.489) (-363.710) (-357.608) [-362.564] -- 0:00:19
192000 -- (-358.711) [-363.154] (-363.033) (-359.893) * (-359.559) (-360.831) (-359.887) [-358.679] -- 0:00:19
192500 -- (-359.135) (-363.613) (-365.178) [-358.816] * (-358.697) (-360.422) (-360.778) [-359.277] -- 0:00:19
193000 -- (-359.745) (-360.690) (-359.866) [-359.180] * (-357.941) (-358.335) [-359.464] (-364.204) -- 0:00:19
193500 -- (-360.700) [-359.246] (-361.433) (-359.762) * (-359.899) (-358.188) (-359.987) [-367.779] -- 0:00:19
194000 -- (-360.405) (-358.494) (-360.450) [-357.754] * (-363.309) [-359.463] (-358.873) (-361.408) -- 0:00:18
194500 -- [-358.228] (-363.078) (-358.636) (-360.455) * (-358.370) (-359.964) (-359.079) [-360.859] -- 0:00:18
195000 -- (-359.955) [-357.867] (-359.862) (-360.605) * (-363.869) (-359.498) (-360.642) [-362.763] -- 0:00:18
Average standard deviation of split frequencies: 0.015570
195500 -- (-358.100) (-358.382) [-360.568] (-366.228) * (-360.394) (-360.391) [-358.851] (-360.466) -- 0:00:18
196000 -- (-359.039) (-365.525) (-362.115) [-361.947] * (-358.036) (-360.219) (-360.179) [-358.370] -- 0:00:18
196500 -- [-359.624] (-365.309) (-360.631) (-361.703) * (-362.731) (-358.037) [-363.925] (-361.681) -- 0:00:18
197000 -- [-358.427] (-359.511) (-358.042) (-358.926) * (-360.812) (-358.685) (-366.866) [-360.253] -- 0:00:18
197500 -- (-361.347) (-359.730) [-357.946] (-359.344) * (-364.038) (-359.809) [-358.425] (-360.970) -- 0:00:18
198000 -- [-359.809] (-359.761) (-359.038) (-359.773) * (-365.158) (-359.772) [-359.383] (-359.701) -- 0:00:18
198500 -- (-360.999) [-358.953] (-357.731) (-359.015) * (-361.974) [-359.493] (-359.011) (-363.719) -- 0:00:18
199000 -- (-358.995) (-359.156) [-360.194] (-361.715) * (-360.319) (-361.040) [-362.208] (-361.073) -- 0:00:18
199500 -- (-359.177) (-358.907) [-359.178] (-358.920) * (-359.329) (-362.096) (-367.215) [-359.870] -- 0:00:18
200000 -- [-360.132] (-362.856) (-359.982) (-359.050) * (-358.080) (-360.050) (-358.357) [-360.533] -- 0:00:18
Average standard deviation of split frequencies: 0.014372
200500 -- (-364.465) (-360.942) [-364.902] (-359.047) * (-365.797) (-358.948) (-357.938) [-358.923] -- 0:00:17
201000 -- (-360.226) [-361.153] (-361.525) (-358.652) * (-364.868) (-358.912) (-357.811) [-360.231] -- 0:00:17
201500 -- [-360.004] (-359.666) (-360.689) (-359.820) * (-360.537) (-361.320) [-360.802] (-361.378) -- 0:00:17
202000 -- (-359.440) (-360.094) [-359.276] (-359.293) * (-360.827) [-358.332] (-363.328) (-360.496) -- 0:00:17
202500 -- (-361.226) (-361.328) (-359.043) [-361.117] * (-360.592) (-358.367) (-359.810) [-359.491] -- 0:00:17
203000 -- (-359.616) (-364.378) [-359.678] (-358.791) * (-360.966) [-360.808] (-360.514) (-358.327) -- 0:00:17
203500 -- [-359.887] (-362.585) (-358.602) (-359.607) * (-359.426) [-358.640] (-359.602) (-360.482) -- 0:00:17
204000 -- (-361.943) (-359.387) (-358.490) [-360.207] * (-357.646) [-358.917] (-359.175) (-360.112) -- 0:00:17
204500 -- (-361.174) (-361.537) [-363.686] (-359.707) * [-359.053] (-359.794) (-358.897) (-359.587) -- 0:00:17
205000 -- (-358.845) (-358.664) (-361.857) [-360.599] * (-360.100) [-360.335] (-360.245) (-363.532) -- 0:00:17
Average standard deviation of split frequencies: 0.014760
205500 -- [-359.926] (-360.136) (-360.366) (-358.533) * (-362.999) (-358.925) [-358.353] (-358.127) -- 0:00:17
206000 -- (-359.310) (-361.158) [-359.564] (-362.993) * [-361.315] (-360.785) (-361.665) (-360.747) -- 0:00:17
206500 -- (-360.036) (-358.111) [-360.912] (-362.698) * (-359.192) [-358.527] (-360.365) (-365.370) -- 0:00:17
207000 -- [-358.734] (-359.884) (-363.625) (-358.043) * (-360.664) (-358.800) (-359.070) [-366.033] -- 0:00:18
207500 -- (-358.290) (-360.296) (-360.658) [-359.537] * (-360.777) (-364.017) (-360.694) [-359.529] -- 0:00:18
208000 -- (-360.168) (-361.176) [-358.874] (-361.300) * (-362.998) (-365.171) (-358.431) [-359.684] -- 0:00:18
208500 -- (-360.832) (-360.595) [-357.786] (-360.105) * (-365.565) (-365.975) (-359.048) [-358.975] -- 0:00:18
209000 -- (-361.402) (-359.315) [-358.828] (-359.986) * (-361.939) [-361.672] (-359.522) (-364.766) -- 0:00:18
209500 -- (-358.835) (-361.104) (-358.792) [-358.818] * [-359.292] (-362.642) (-360.278) (-358.758) -- 0:00:18
210000 -- (-359.715) [-360.055] (-360.466) (-359.493) * (-360.723) [-357.925] (-358.185) (-358.773) -- 0:00:17
Average standard deviation of split frequencies: 0.016135
210500 -- (-360.781) [-361.801] (-360.782) (-359.560) * (-361.770) [-359.827] (-363.584) (-359.002) -- 0:00:17
211000 -- [-358.485] (-363.066) (-361.731) (-366.172) * (-361.264) (-358.874) [-364.754] (-363.177) -- 0:00:17
211500 -- [-357.887] (-360.062) (-360.867) (-369.128) * (-364.534) (-359.201) [-364.686] (-359.775) -- 0:00:17
212000 -- (-358.018) (-361.932) [-361.004] (-369.010) * [-360.580] (-362.257) (-361.833) (-358.594) -- 0:00:17
212500 -- (-359.487) (-360.574) (-360.987) [-364.270] * (-360.470) [-358.715] (-363.346) (-359.022) -- 0:00:17
213000 -- (-358.775) (-361.904) (-362.230) [-360.884] * (-360.575) [-358.289] (-359.612) (-362.550) -- 0:00:17
213500 -- (-363.317) (-359.265) [-359.775] (-361.953) * (-360.256) [-362.422] (-358.978) (-359.102) -- 0:00:17
214000 -- (-361.192) (-361.504) [-359.130] (-363.400) * (-361.228) (-359.726) [-359.189] (-360.126) -- 0:00:17
214500 -- (-360.102) [-361.651] (-359.257) (-361.422) * [-358.261] (-360.526) (-357.898) (-358.890) -- 0:00:17
215000 -- (-359.009) (-360.341) [-359.559] (-363.462) * (-360.583) (-358.381) (-358.105) [-362.135] -- 0:00:17
Average standard deviation of split frequencies: 0.015277
215500 -- (-358.785) [-360.950] (-360.386) (-363.728) * (-361.050) (-360.022) [-358.111] (-358.382) -- 0:00:17
216000 -- [-361.789] (-360.180) (-360.938) (-359.458) * [-359.439] (-358.309) (-359.432) (-360.046) -- 0:00:17
216500 -- (-359.106) [-364.002] (-359.923) (-358.216) * [-360.412] (-360.406) (-360.358) (-360.082) -- 0:00:17
217000 -- (-359.581) (-359.162) [-360.911] (-360.704) * [-360.440] (-359.288) (-362.156) (-360.162) -- 0:00:16
217500 -- [-359.742] (-360.763) (-359.878) (-360.452) * [-359.360] (-360.303) (-358.285) (-365.439) -- 0:00:16
218000 -- (-361.990) [-359.830] (-358.237) (-359.525) * (-362.247) (-359.457) [-362.921] (-361.677) -- 0:00:16
218500 -- (-360.650) (-358.033) (-360.607) [-361.596] * (-358.619) (-358.309) (-361.630) [-358.574] -- 0:00:16
219000 -- [-360.801] (-359.211) (-358.327) (-360.503) * (-359.416) (-358.535) [-359.125] (-360.721) -- 0:00:16
219500 -- (-360.488) (-366.255) [-358.503] (-359.462) * (-362.601) (-360.088) (-359.886) [-358.675] -- 0:00:16
220000 -- [-360.276] (-363.385) (-358.492) (-359.423) * (-361.724) [-359.972] (-363.229) (-361.340) -- 0:00:16
Average standard deviation of split frequencies: 0.015708
220500 -- (-361.556) (-366.291) [-360.002] (-359.410) * (-362.084) (-358.849) (-362.122) [-358.216] -- 0:00:16
221000 -- (-358.074) [-361.341] (-360.085) (-358.749) * (-365.103) [-359.018] (-360.119) (-358.762) -- 0:00:16
221500 -- (-360.239) [-358.916] (-359.361) (-359.948) * (-360.684) [-359.378] (-359.077) (-362.138) -- 0:00:16
222000 -- (-358.645) (-360.556) (-359.483) [-362.472] * (-360.780) [-357.784] (-359.423) (-358.379) -- 0:00:16
222500 -- (-360.605) [-361.166] (-360.876) (-361.205) * (-360.728) (-359.406) [-359.534] (-359.416) -- 0:00:16
223000 -- (-359.549) [-364.357] (-367.873) (-359.876) * (-360.599) (-359.448) (-360.240) [-359.531] -- 0:00:16
223500 -- (-363.741) [-360.963] (-364.250) (-361.922) * (-358.734) (-358.675) [-358.132] (-358.526) -- 0:00:16
224000 -- (-360.098) (-363.796) [-362.722] (-358.431) * (-360.617) (-359.152) (-362.280) [-361.407] -- 0:00:17
224500 -- [-360.305] (-358.737) (-361.270) (-360.620) * (-363.664) (-360.220) (-361.196) [-363.114] -- 0:00:17
225000 -- [-359.473] (-359.142) (-366.339) (-362.109) * (-359.413) (-363.199) (-360.043) [-359.839] -- 0:00:17
Average standard deviation of split frequencies: 0.015992
225500 -- (-358.435) [-361.060] (-358.495) (-359.803) * [-360.614] (-360.304) (-363.239) (-359.238) -- 0:00:17
226000 -- (-358.822) (-360.530) [-358.240] (-363.541) * (-363.256) (-361.685) (-361.708) [-363.269] -- 0:00:16
226500 -- (-362.208) (-362.098) (-359.178) [-359.372] * [-361.886] (-359.171) (-359.913) (-361.468) -- 0:00:16
227000 -- (-361.452) (-359.751) (-359.561) [-362.868] * (-359.724) [-358.882] (-358.597) (-362.673) -- 0:00:16
227500 -- (-361.184) [-362.486] (-360.277) (-364.234) * (-358.630) [-357.866] (-360.229) (-360.806) -- 0:00:16
228000 -- (-360.935) (-357.893) [-365.348] (-360.453) * (-358.592) (-357.917) (-358.493) [-361.040] -- 0:00:16
228500 -- (-357.965) (-360.129) [-358.857] (-359.365) * (-358.270) (-358.168) [-360.246] (-361.915) -- 0:00:16
229000 -- [-359.040] (-359.505) (-365.585) (-361.943) * (-360.347) (-359.141) (-359.000) [-359.062] -- 0:00:16
229500 -- (-361.213) (-360.739) [-360.441] (-361.192) * (-358.749) (-358.601) (-361.076) [-358.862] -- 0:00:16
230000 -- (-367.653) (-363.857) (-360.934) [-361.735] * (-362.132) (-361.301) (-363.084) [-363.162] -- 0:00:16
Average standard deviation of split frequencies: 0.016803
230500 -- (-358.173) (-361.755) [-358.910] (-361.592) * (-363.110) (-361.093) (-361.653) [-358.928] -- 0:00:16
231000 -- [-360.874] (-361.066) (-362.987) (-360.337) * (-358.829) (-360.108) (-359.729) [-361.285] -- 0:00:16
231500 -- [-361.133] (-360.029) (-361.573) (-357.905) * (-358.649) (-361.964) [-361.518] (-359.607) -- 0:00:16
232000 -- [-361.594] (-359.664) (-360.913) (-358.897) * (-359.331) (-359.210) [-359.969] (-359.085) -- 0:00:16
232500 -- [-358.756] (-359.535) (-358.473) (-361.681) * (-360.813) [-361.898] (-363.234) (-359.022) -- 0:00:16
233000 -- [-358.100] (-358.531) (-360.547) (-358.720) * (-359.976) (-363.490) [-358.585] (-359.496) -- 0:00:16
233500 -- (-358.213) (-360.912) [-358.555] (-364.270) * [-361.358] (-360.114) (-360.770) (-360.043) -- 0:00:15
234000 -- [-359.269] (-360.487) (-360.904) (-358.984) * [-360.124] (-360.931) (-362.138) (-358.951) -- 0:00:15
234500 -- (-358.670) [-359.830] (-362.427) (-359.701) * (-361.042) [-359.363] (-361.888) (-359.387) -- 0:00:15
235000 -- (-363.827) [-359.793] (-359.497) (-361.222) * [-361.766] (-359.180) (-360.903) (-360.370) -- 0:00:15
Average standard deviation of split frequencies: 0.014759
235500 -- (-359.231) [-360.801] (-361.687) (-359.852) * (-361.069) (-358.826) [-362.339] (-361.255) -- 0:00:15
236000 -- [-359.467] (-360.896) (-359.677) (-359.039) * (-359.532) (-361.942) [-359.278] (-358.514) -- 0:00:15
236500 -- (-359.934) (-358.744) [-359.084] (-358.757) * (-362.470) (-361.566) (-360.738) [-358.893] -- 0:00:15
237000 -- (-357.934) [-362.156] (-362.420) (-359.431) * (-358.960) (-361.761) [-358.733] (-358.166) -- 0:00:15
237500 -- (-359.924) (-359.957) [-360.266] (-360.481) * (-358.309) (-361.068) [-360.443] (-359.209) -- 0:00:15
238000 -- [-361.141] (-364.208) (-360.049) (-360.210) * (-359.426) (-361.871) (-358.545) [-363.295] -- 0:00:15
238500 -- (-359.440) [-359.980] (-362.032) (-362.056) * [-358.698] (-366.043) (-360.634) (-364.765) -- 0:00:15
239000 -- (-359.610) (-363.447) (-360.163) [-358.747] * (-361.979) (-359.311) [-358.635] (-357.745) -- 0:00:15
239500 -- (-358.431) [-362.539] (-361.499) (-360.636) * (-363.452) [-364.677] (-362.211) (-357.745) -- 0:00:15
240000 -- [-358.724] (-361.466) (-362.264) (-359.933) * (-365.738) [-359.669] (-360.573) (-358.097) -- 0:00:15
Average standard deviation of split frequencies: 0.014691
240500 -- (-359.488) (-358.572) [-358.176] (-357.836) * [-361.434] (-363.103) (-359.004) (-359.063) -- 0:00:15
241000 -- (-360.193) [-360.537] (-359.887) (-360.325) * (-358.423) (-361.948) [-359.232] (-360.927) -- 0:00:16
241500 -- (-361.032) (-358.895) [-359.314] (-360.725) * (-359.801) (-359.713) (-363.416) [-358.023] -- 0:00:16
242000 -- (-359.088) (-360.294) (-358.296) [-358.286] * (-359.233) [-358.893] (-361.579) (-361.819) -- 0:00:15
242500 -- (-358.881) [-359.022] (-358.472) (-359.345) * (-359.727) (-361.119) [-362.912] (-360.150) -- 0:00:15
243000 -- (-359.856) (-359.543) (-357.913) [-358.832] * (-358.196) [-358.450] (-360.885) (-360.236) -- 0:00:15
243500 -- (-359.574) (-363.075) [-358.551] (-358.564) * (-364.710) (-360.240) [-360.473] (-361.298) -- 0:00:15
244000 -- (-361.931) (-359.081) (-358.382) [-359.865] * (-361.121) (-361.258) (-359.487) [-360.209] -- 0:00:15
244500 -- [-359.765] (-359.644) (-358.479) (-361.044) * (-362.612) (-363.481) [-359.376] (-362.846) -- 0:00:15
245000 -- [-366.131] (-358.131) (-358.606) (-364.158) * (-358.292) (-359.998) [-359.791] (-360.634) -- 0:00:15
Average standard deviation of split frequencies: 0.015224
245500 -- (-364.571) (-359.036) [-359.095] (-368.126) * (-360.320) [-361.539] (-361.533) (-359.605) -- 0:00:15
246000 -- [-362.029] (-359.560) (-359.436) (-361.132) * (-359.600) (-358.501) (-359.192) [-359.344] -- 0:00:15
246500 -- (-360.597) (-359.400) (-361.966) [-359.335] * (-358.309) [-358.283] (-360.840) (-358.405) -- 0:00:15
247000 -- (-359.914) [-359.107] (-361.716) (-361.635) * (-362.081) (-361.174) [-360.372] (-358.133) -- 0:00:15
247500 -- [-360.515] (-359.977) (-358.228) (-360.339) * (-363.721) (-358.600) [-361.652] (-359.209) -- 0:00:15
248000 -- (-360.168) (-359.537) (-358.522) [-362.015] * (-361.266) [-358.017] (-358.216) (-358.336) -- 0:00:15
248500 -- (-361.526) (-362.898) [-360.396] (-361.319) * (-359.124) [-359.693] (-359.443) (-358.316) -- 0:00:15
249000 -- (-358.934) (-360.673) [-361.150] (-362.448) * [-359.435] (-358.041) (-359.841) (-360.604) -- 0:00:15
249500 -- (-364.434) (-359.237) [-365.087] (-358.184) * (-358.829) [-358.460] (-362.975) (-360.417) -- 0:00:15
250000 -- [-359.823] (-361.964) (-358.671) (-359.129) * [-358.807] (-358.270) (-360.315) (-361.350) -- 0:00:15
Average standard deviation of split frequencies: 0.014381
250500 -- (-360.632) (-360.144) [-362.822] (-364.445) * [-359.889] (-360.998) (-359.811) (-359.450) -- 0:00:14
251000 -- (-363.672) (-358.844) [-358.185] (-359.013) * [-358.986] (-360.396) (-359.495) (-359.338) -- 0:00:14
251500 -- (-362.168) [-360.635] (-358.562) (-360.176) * [-360.090] (-360.791) (-361.212) (-360.263) -- 0:00:14
252000 -- [-361.119] (-359.443) (-358.975) (-362.527) * [-359.063] (-361.186) (-363.804) (-359.062) -- 0:00:14
252500 -- (-359.877) (-359.599) [-361.336] (-359.358) * (-360.082) [-358.478] (-360.678) (-360.398) -- 0:00:14
253000 -- (-358.548) (-359.364) [-359.014] (-360.532) * [-359.196] (-358.170) (-358.498) (-363.690) -- 0:00:14
253500 -- (-357.670) [-359.380] (-359.641) (-362.170) * (-360.301) [-358.813] (-360.535) (-365.786) -- 0:00:14
254000 -- [-361.921] (-357.860) (-359.428) (-361.300) * (-358.620) [-361.105] (-359.527) (-358.434) -- 0:00:14
254500 -- (-361.664) [-357.937] (-359.813) (-358.742) * [-358.624] (-358.992) (-358.154) (-358.904) -- 0:00:14
255000 -- (-358.432) [-357.976] (-359.812) (-358.626) * (-361.473) (-360.715) (-358.678) [-360.466] -- 0:00:14
Average standard deviation of split frequencies: 0.015273
255500 -- (-358.219) (-359.029) [-358.676] (-360.507) * (-360.115) [-358.912] (-365.577) (-360.035) -- 0:00:14
256000 -- (-358.862) (-359.468) [-360.487] (-361.967) * (-361.745) (-360.377) (-363.458) [-359.608] -- 0:00:14
256500 -- (-363.586) (-361.884) (-362.236) [-360.102] * (-360.157) [-361.655] (-359.823) (-358.255) -- 0:00:14
257000 -- (-358.935) (-359.091) [-359.918] (-360.071) * [-360.839] (-359.424) (-359.544) (-360.171) -- 0:00:14
257500 -- (-359.400) (-361.695) [-362.363] (-360.036) * (-365.860) [-362.930] (-360.599) (-364.740) -- 0:00:14
258000 -- (-359.398) (-363.787) [-360.580] (-357.691) * (-360.073) [-361.185] (-361.314) (-358.794) -- 0:00:14
258500 -- (-360.012) (-359.830) [-359.589] (-361.523) * (-359.471) (-363.016) [-359.725] (-361.953) -- 0:00:14
259000 -- (-358.297) [-360.542] (-362.470) (-359.547) * [-358.953] (-362.272) (-362.841) (-360.670) -- 0:00:14
259500 -- (-359.321) (-358.697) (-359.324) [-359.025] * (-360.087) [-359.909] (-358.316) (-359.313) -- 0:00:14
260000 -- (-361.625) (-358.033) (-359.574) [-362.541] * (-358.473) (-361.071) (-358.352) [-358.790] -- 0:00:14
Average standard deviation of split frequencies: 0.015425
260500 -- [-366.035] (-359.406) (-360.673) (-358.660) * [-361.582] (-361.082) (-359.777) (-362.781) -- 0:00:14
261000 -- (-361.084) [-359.636] (-358.657) (-360.527) * (-363.075) (-357.831) (-359.251) [-357.818] -- 0:00:14
261500 -- (-358.643) (-361.442) (-359.095) [-359.151] * (-359.826) [-359.870] (-361.477) (-359.691) -- 0:00:14
262000 -- [-360.618] (-361.728) (-358.252) (-371.929) * (-364.333) (-359.662) (-358.692) [-360.087] -- 0:00:14
262500 -- (-361.378) (-364.473) (-358.574) [-359.057] * (-358.852) (-358.948) [-358.789] (-360.538) -- 0:00:14
263000 -- (-364.381) (-362.212) [-359.737] (-360.065) * (-358.043) [-360.510] (-358.481) (-359.710) -- 0:00:14
263500 -- (-359.048) (-361.510) [-360.999] (-358.432) * (-358.324) (-360.739) [-358.186] (-360.566) -- 0:00:14
264000 -- (-360.498) (-360.548) [-358.985] (-361.560) * (-359.517) (-360.587) [-358.579] (-360.270) -- 0:00:14
264500 -- [-358.268] (-363.811) (-362.683) (-363.834) * [-360.245] (-358.167) (-360.002) (-363.271) -- 0:00:14
265000 -- (-363.739) (-359.049) (-362.652) [-358.115] * (-359.282) (-360.199) [-360.299] (-361.286) -- 0:00:14
Average standard deviation of split frequencies: 0.016054
265500 -- [-360.170] (-361.402) (-366.430) (-359.995) * (-360.912) (-365.803) [-360.309] (-359.318) -- 0:00:14
266000 -- [-357.874] (-361.042) (-366.645) (-360.074) * [-359.827] (-358.631) (-359.325) (-363.715) -- 0:00:14
266500 -- (-358.083) [-358.929] (-359.789) (-364.590) * (-360.450) (-358.405) [-360.788] (-359.980) -- 0:00:14
267000 -- (-360.803) [-362.182] (-361.086) (-368.226) * (-360.221) (-360.023) [-360.996] (-361.036) -- 0:00:13
267500 -- (-358.089) (-358.998) (-361.494) [-358.771] * (-362.859) [-359.074] (-360.670) (-357.984) -- 0:00:13
268000 -- (-358.981) (-359.190) (-362.981) [-359.517] * (-364.421) (-359.252) (-363.276) [-358.415] -- 0:00:13
268500 -- [-359.175] (-358.486) (-359.852) (-360.823) * (-358.237) (-361.310) [-358.096] (-360.277) -- 0:00:13
269000 -- [-361.410] (-358.386) (-360.991) (-361.309) * (-357.766) [-360.313] (-364.417) (-359.771) -- 0:00:13
269500 -- (-362.835) [-358.817] (-362.210) (-360.916) * (-360.057) (-361.111) [-364.030] (-360.323) -- 0:00:13
270000 -- (-360.171) (-362.617) [-358.958] (-362.114) * (-358.550) [-358.562] (-359.285) (-359.024) -- 0:00:13
Average standard deviation of split frequencies: 0.015060
270500 -- (-360.912) [-360.429] (-358.284) (-358.198) * (-360.248) (-359.691) [-359.249] (-360.051) -- 0:00:13
271000 -- (-362.300) [-358.742] (-360.163) (-361.772) * [-361.268] (-358.174) (-360.036) (-359.670) -- 0:00:13
271500 -- (-362.008) [-360.423] (-361.023) (-360.516) * (-358.389) (-358.727) [-360.012] (-360.982) -- 0:00:13
272000 -- (-361.602) [-364.083] (-360.005) (-361.384) * (-357.696) (-362.058) (-358.742) [-359.864] -- 0:00:13
272500 -- (-358.135) (-365.249) [-358.007] (-358.150) * [-358.222] (-361.762) (-360.748) (-358.918) -- 0:00:13
273000 -- (-359.368) (-364.620) [-362.974] (-360.457) * (-358.256) (-366.363) (-360.142) [-358.931] -- 0:00:13
273500 -- (-359.990) (-360.843) [-358.745] (-358.908) * (-358.897) [-358.188] (-358.462) (-358.272) -- 0:00:13
274000 -- (-360.810) (-361.136) [-361.414] (-358.945) * (-361.103) (-359.021) (-362.698) [-358.706] -- 0:00:13
274500 -- (-362.889) [-359.456] (-370.095) (-360.033) * (-359.160) [-361.622] (-359.133) (-362.104) -- 0:00:13
275000 -- (-362.588) (-359.376) (-366.112) [-361.805] * (-359.046) [-360.402] (-358.960) (-363.365) -- 0:00:13
Average standard deviation of split frequencies: 0.014669
275500 -- [-360.744] (-362.844) (-360.109) (-360.689) * (-360.601) (-362.734) [-360.869] (-361.753) -- 0:00:13
276000 -- (-360.601) (-360.153) [-359.614] (-361.879) * (-359.805) (-360.505) (-362.367) [-358.302] -- 0:00:13
276500 -- [-363.646] (-361.283) (-359.057) (-359.051) * (-359.154) (-359.334) (-361.865) [-358.066] -- 0:00:13
277000 -- (-360.029) (-358.515) [-359.080] (-361.967) * (-358.070) (-361.970) (-359.325) [-358.426] -- 0:00:13
277500 -- (-361.945) [-359.174] (-357.967) (-365.898) * (-358.639) (-359.991) [-362.219] (-360.099) -- 0:00:13
278000 -- (-362.156) [-362.025] (-360.737) (-359.227) * (-358.602) (-360.458) (-359.292) [-360.413] -- 0:00:13
278500 -- (-359.725) [-361.147] (-359.079) (-358.102) * [-359.196] (-358.679) (-358.076) (-360.640) -- 0:00:13
279000 -- (-361.969) [-358.080] (-359.667) (-358.711) * (-359.648) [-357.822] (-358.084) (-361.808) -- 0:00:13
279500 -- (-360.812) [-359.118] (-359.124) (-359.210) * [-359.153] (-361.493) (-358.447) (-360.658) -- 0:00:13
280000 -- (-362.757) (-358.910) (-362.848) [-361.361] * (-361.462) [-359.036] (-359.563) (-358.065) -- 0:00:13
Average standard deviation of split frequencies: 0.014721
280500 -- (-358.248) (-359.605) (-362.519) [-360.743] * [-361.465] (-359.958) (-360.448) (-357.864) -- 0:00:13
281000 -- [-358.775] (-360.416) (-360.500) (-359.013) * (-359.001) (-364.099) (-363.708) [-359.724] -- 0:00:13
281500 -- (-359.300) (-362.258) (-359.986) [-365.922] * [-358.825] (-365.706) (-362.505) (-359.494) -- 0:00:13
282000 -- (-360.943) [-358.430] (-358.870) (-358.496) * [-360.993] (-361.671) (-358.386) (-360.106) -- 0:00:13
282500 -- (-361.068) [-362.129] (-360.279) (-362.541) * [-361.045] (-364.841) (-361.065) (-361.480) -- 0:00:13
283000 -- (-361.972) (-361.533) [-359.648] (-360.951) * [-361.481] (-360.018) (-359.970) (-358.886) -- 0:00:13
283500 -- (-359.216) (-362.536) [-360.676] (-361.348) * (-362.123) (-362.677) (-359.439) [-358.539] -- 0:00:12
284000 -- (-359.335) [-359.427] (-359.114) (-364.349) * (-358.316) (-360.964) [-359.996] (-359.130) -- 0:00:12
284500 -- (-358.733) (-364.139) (-365.748) [-361.096] * (-360.213) (-362.549) (-362.514) [-360.409] -- 0:00:12
285000 -- (-359.834) (-359.597) (-359.600) [-361.547] * [-365.347] (-360.681) (-358.897) (-359.511) -- 0:00:12
Average standard deviation of split frequencies: 0.015707
285500 -- [-361.667] (-361.285) (-359.471) (-361.482) * [-358.366] (-365.366) (-360.363) (-357.840) -- 0:00:12
286000 -- (-364.128) [-358.946] (-361.397) (-364.860) * (-358.994) [-361.633] (-361.083) (-357.594) -- 0:00:12
286500 -- [-361.666] (-361.151) (-361.497) (-359.114) * (-359.879) [-359.192] (-359.754) (-363.491) -- 0:00:12
287000 -- [-360.796] (-358.554) (-358.258) (-358.140) * (-359.183) (-359.371) (-360.199) [-358.761] -- 0:00:12
287500 -- (-362.377) [-358.249] (-360.806) (-360.118) * [-360.018] (-358.907) (-359.639) (-357.931) -- 0:00:12
288000 -- (-360.074) [-357.869] (-359.980) (-359.066) * (-360.352) (-357.790) [-357.776] (-358.387) -- 0:00:12
288500 -- (-359.532) (-359.876) [-358.778] (-359.891) * (-359.898) (-357.745) (-361.192) [-358.538] -- 0:00:12
289000 -- (-358.832) [-359.736] (-362.096) (-359.828) * (-361.069) (-361.793) [-359.284] (-358.489) -- 0:00:12
289500 -- (-358.835) (-363.408) (-359.553) [-360.606] * (-360.098) [-360.424] (-368.645) (-361.132) -- 0:00:12
290000 -- (-359.439) (-366.559) (-358.636) [-361.392] * (-361.245) [-358.748] (-365.867) (-360.130) -- 0:00:12
Average standard deviation of split frequencies: 0.014024
290500 -- [-358.325] (-364.383) (-359.760) (-359.545) * [-364.010] (-359.396) (-361.322) (-359.000) -- 0:00:12
291000 -- [-360.351] (-359.475) (-359.804) (-360.189) * (-361.351) (-359.412) (-358.922) [-362.622] -- 0:00:12
291500 -- (-362.956) [-359.407] (-360.133) (-362.233) * (-359.037) (-359.908) [-360.725] (-358.680) -- 0:00:12
292000 -- (-359.515) [-359.317] (-360.971) (-361.453) * (-359.734) (-360.830) (-365.105) [-360.060] -- 0:00:12
292500 -- (-364.082) (-362.105) [-358.990] (-362.310) * (-359.436) (-358.559) (-362.523) [-358.927] -- 0:00:12
293000 -- [-359.699] (-360.344) (-359.949) (-361.166) * (-359.575) (-361.336) (-360.798) [-359.766] -- 0:00:12
293500 -- [-361.404] (-361.298) (-358.927) (-358.782) * (-359.734) (-359.061) [-361.388] (-364.109) -- 0:00:12
294000 -- (-357.935) (-360.087) [-358.261] (-359.578) * (-361.088) (-360.338) (-362.878) [-360.506] -- 0:00:12
294500 -- (-357.845) (-361.740) [-358.823] (-358.929) * (-360.810) [-359.079] (-362.807) (-359.859) -- 0:00:12
295000 -- (-359.178) (-358.065) [-358.165] (-360.117) * (-361.931) [-358.088] (-363.260) (-364.631) -- 0:00:12
Average standard deviation of split frequencies: 0.014831
295500 -- (-359.443) (-358.134) (-358.892) [-359.767] * (-360.777) (-361.818) [-360.715] (-359.052) -- 0:00:12
296000 -- (-360.295) (-358.837) (-361.076) [-359.378] * (-362.642) [-360.065] (-358.581) (-359.107) -- 0:00:12
296500 -- (-359.189) [-358.063] (-360.193) (-359.214) * [-361.116] (-358.897) (-362.513) (-362.298) -- 0:00:12
297000 -- (-363.189) (-360.796) [-358.943] (-358.306) * (-359.517) (-359.367) (-362.030) [-363.835] -- 0:00:12
297500 -- (-360.189) [-358.358] (-359.223) (-364.194) * [-359.095] (-358.732) (-359.570) (-366.833) -- 0:00:12
298000 -- (-361.733) [-359.157] (-357.922) (-362.942) * (-359.547) [-361.271] (-359.499) (-362.148) -- 0:00:12
298500 -- [-360.301] (-359.508) (-359.129) (-361.994) * (-359.638) (-359.160) [-358.969] (-361.725) -- 0:00:12
299000 -- (-360.148) [-358.685] (-358.485) (-360.377) * (-358.848) (-360.746) (-360.665) [-362.222] -- 0:00:12
299500 -- [-362.329] (-358.142) (-362.159) (-362.752) * (-360.234) [-358.244] (-361.456) (-358.451) -- 0:00:12
300000 -- [-359.764] (-357.940) (-359.647) (-359.636) * (-361.305) (-360.758) [-362.997] (-362.238) -- 0:00:12
Average standard deviation of split frequencies: 0.013742
300500 -- (-360.020) (-358.161) [-358.426] (-360.567) * (-360.883) [-359.697] (-362.153) (-359.714) -- 0:00:11
301000 -- [-357.825] (-359.000) (-359.169) (-358.599) * (-362.292) (-359.792) (-362.683) [-358.928] -- 0:00:11
301500 -- (-358.468) [-358.488] (-359.652) (-358.275) * (-359.240) (-359.908) [-361.368] (-363.808) -- 0:00:11
302000 -- (-359.775) (-358.045) (-357.970) [-358.478] * (-361.567) (-358.752) [-363.257] (-359.055) -- 0:00:11
302500 -- (-358.214) [-364.496] (-358.774) (-361.153) * [-357.911] (-358.456) (-365.416) (-360.495) -- 0:00:11
303000 -- [-358.613] (-359.209) (-359.781) (-361.402) * (-358.650) (-362.311) [-358.384] (-362.761) -- 0:00:11
303500 -- (-359.340) (-360.220) [-360.098] (-365.469) * (-360.762) (-358.900) (-358.589) [-361.979] -- 0:00:11
304000 -- (-360.989) (-360.468) [-359.584] (-365.819) * (-358.211) (-362.663) (-359.328) [-359.979] -- 0:00:11
304500 -- (-360.811) [-361.054] (-358.517) (-360.477) * [-357.914] (-363.112) (-358.924) (-357.794) -- 0:00:11
305000 -- (-359.506) (-360.660) (-359.476) [-359.923] * (-363.001) (-364.799) [-360.582] (-358.552) -- 0:00:11
Average standard deviation of split frequencies: 0.013412
305500 -- (-358.883) (-360.502) [-360.079] (-359.453) * (-359.505) [-358.757] (-359.071) (-358.149) -- 0:00:11
306000 -- (-360.663) (-358.734) [-359.817] (-359.190) * [-360.387] (-359.488) (-363.382) (-362.677) -- 0:00:11
306500 -- (-360.017) (-359.785) (-361.431) [-363.365] * [-359.951] (-364.571) (-360.940) (-358.913) -- 0:00:11
307000 -- (-363.860) [-360.107] (-361.117) (-366.669) * (-359.108) (-358.259) [-361.151] (-359.178) -- 0:00:11
307500 -- [-367.413] (-359.641) (-359.986) (-360.515) * (-358.551) (-364.408) [-357.864] (-359.580) -- 0:00:11
308000 -- (-360.155) (-363.633) (-359.505) [-359.374] * (-361.626) [-362.294] (-360.238) (-362.540) -- 0:00:11
308500 -- (-359.402) (-361.630) (-359.793) [-359.678] * (-361.089) [-358.501] (-359.972) (-359.357) -- 0:00:11
309000 -- (-360.594) (-363.435) (-364.186) [-358.615] * (-359.963) [-358.132] (-361.371) (-358.295) -- 0:00:11
309500 -- [-360.433] (-361.668) (-361.116) (-359.899) * (-359.693) [-362.771] (-359.285) (-361.477) -- 0:00:11
310000 -- (-361.809) [-359.874] (-361.243) (-358.458) * (-361.881) (-358.691) [-358.505] (-357.797) -- 0:00:11
Average standard deviation of split frequencies: 0.013300
310500 -- (-359.264) (-360.991) [-359.275] (-358.111) * (-360.856) (-358.007) [-363.594] (-359.064) -- 0:00:11
311000 -- (-358.349) (-365.019) [-361.389] (-359.411) * (-361.376) (-358.717) [-360.610] (-360.777) -- 0:00:11
311500 -- (-361.650) (-359.813) [-357.878] (-358.315) * (-359.176) (-359.222) (-360.921) [-359.430] -- 0:00:11
312000 -- (-359.028) (-361.995) (-359.460) [-358.440] * (-362.089) (-359.659) [-358.066] (-358.331) -- 0:00:11
312500 -- (-359.436) (-362.451) [-359.273] (-359.414) * (-359.542) (-362.325) (-359.444) [-361.677] -- 0:00:11
313000 -- (-360.131) (-358.967) [-359.135] (-359.663) * (-360.862) (-358.741) [-360.545] (-357.891) -- 0:00:11
313500 -- (-361.524) (-359.984) [-358.212] (-360.582) * (-361.430) (-358.900) [-366.220] (-360.064) -- 0:00:11
314000 -- (-359.227) (-359.433) [-359.854] (-357.704) * (-358.462) [-362.110] (-363.226) (-358.536) -- 0:00:11
314500 -- (-358.500) [-360.714] (-359.897) (-361.645) * (-367.559) (-359.059) [-362.454] (-363.597) -- 0:00:11
315000 -- (-364.094) (-359.369) (-360.560) [-362.031] * (-360.273) (-361.017) (-362.647) [-362.890] -- 0:00:11
Average standard deviation of split frequencies: 0.013338
315500 -- (-364.149) [-359.621] (-360.501) (-358.565) * (-358.399) (-361.503) [-361.258] (-359.849) -- 0:00:11
316000 -- [-359.653] (-359.382) (-363.496) (-360.127) * [-358.615] (-358.770) (-358.446) (-361.499) -- 0:00:11
316500 -- (-362.505) (-361.926) (-363.015) [-359.578] * (-361.516) (-359.169) [-359.188] (-360.373) -- 0:00:11
317000 -- [-360.941] (-359.962) (-363.055) (-359.745) * (-361.302) (-362.104) (-358.999) [-360.116] -- 0:00:10
317500 -- (-362.033) (-361.953) (-358.971) [-359.824] * [-359.820] (-361.579) (-358.923) (-360.229) -- 0:00:10
318000 -- (-361.685) (-358.274) [-361.169] (-362.327) * (-361.922) (-362.783) [-360.295] (-362.751) -- 0:00:10
318500 -- (-360.430) (-359.706) (-359.815) [-360.079] * (-362.347) [-362.736] (-359.314) (-359.920) -- 0:00:10
319000 -- [-360.090] (-362.353) (-359.042) (-359.845) * (-362.387) [-360.396] (-358.400) (-359.750) -- 0:00:10
319500 -- (-359.954) [-362.161] (-358.442) (-360.800) * (-360.106) (-360.880) [-363.202] (-361.500) -- 0:00:10
320000 -- (-360.570) [-360.826] (-361.411) (-360.956) * [-364.239] (-358.332) (-359.297) (-360.624) -- 0:00:10
Average standard deviation of split frequencies: 0.013231
320500 -- (-363.607) [-359.541] (-358.875) (-358.722) * (-362.546) (-362.174) [-365.032] (-363.517) -- 0:00:10
321000 -- (-360.257) (-358.004) [-358.985] (-357.927) * (-364.420) (-359.193) (-360.117) [-362.466] -- 0:00:10
321500 -- [-359.945] (-360.588) (-361.497) (-359.085) * (-362.504) (-362.146) (-358.277) [-360.165] -- 0:00:10
322000 -- [-358.841] (-359.044) (-362.811) (-360.776) * (-358.708) (-360.845) [-360.183] (-361.902) -- 0:00:10
322500 -- (-363.330) (-361.159) (-358.641) [-360.040] * (-361.045) (-359.450) [-361.647] (-359.956) -- 0:00:10
323000 -- (-360.123) (-359.106) [-358.998] (-358.395) * (-360.652) (-363.031) (-366.435) [-358.005] -- 0:00:10
323500 -- (-361.850) [-359.484] (-360.714) (-360.931) * (-358.760) (-360.665) [-364.000] (-359.086) -- 0:00:10
324000 -- (-361.343) (-361.020) [-358.616] (-358.126) * [-358.676] (-359.487) (-361.317) (-361.247) -- 0:00:10
324500 -- [-359.417] (-360.225) (-359.797) (-358.279) * [-357.918] (-358.513) (-360.846) (-364.540) -- 0:00:10
325000 -- (-364.761) [-358.997] (-361.277) (-359.765) * (-360.074) (-366.791) [-358.474] (-359.906) -- 0:00:10
Average standard deviation of split frequencies: 0.013014
325500 -- [-364.561] (-358.361) (-360.740) (-360.049) * (-359.210) [-363.323] (-358.893) (-359.662) -- 0:00:10
326000 -- (-361.467) (-359.355) [-359.068] (-361.682) * [-360.094] (-361.062) (-358.146) (-359.873) -- 0:00:10
326500 -- [-358.302] (-361.028) (-359.617) (-365.470) * (-358.850) (-362.836) (-359.625) [-358.877] -- 0:00:10
327000 -- [-357.811] (-358.507) (-359.783) (-361.094) * [-357.891] (-359.323) (-358.980) (-358.479) -- 0:00:10
327500 -- [-358.682] (-358.047) (-359.712) (-361.374) * [-358.223] (-362.669) (-359.414) (-360.683) -- 0:00:10
328000 -- (-359.592) (-358.455) (-358.847) [-358.204] * [-362.352] (-357.664) (-361.290) (-359.314) -- 0:00:10
328500 -- [-360.022] (-359.862) (-361.191) (-359.743) * (-359.852) [-359.227] (-361.508) (-361.884) -- 0:00:10
329000 -- (-361.815) (-360.358) (-357.757) [-357.700] * (-358.337) [-360.696] (-359.468) (-361.279) -- 0:00:10
329500 -- (-362.946) [-358.818] (-358.462) (-357.713) * [-358.266] (-360.594) (-361.907) (-359.446) -- 0:00:10
330000 -- [-358.903] (-358.532) (-360.371) (-360.887) * (-359.169) (-359.938) [-360.003] (-360.053) -- 0:00:10
Average standard deviation of split frequencies: 0.012914
330500 -- (-359.854) (-360.217) [-360.976] (-360.431) * [-361.514] (-359.895) (-363.639) (-361.513) -- 0:00:10
331000 -- (-360.193) [-359.676] (-361.277) (-361.495) * (-362.208) [-358.058] (-360.538) (-359.017) -- 0:00:10
331500 -- [-357.969] (-361.045) (-360.934) (-358.506) * (-358.711) (-362.355) (-369.320) [-360.588] -- 0:00:10
332000 -- (-360.265) [-358.134] (-358.552) (-358.358) * (-363.722) (-358.622) (-361.570) [-359.128] -- 0:00:10
332500 -- (-359.940) (-361.092) [-360.869] (-361.190) * [-360.329] (-359.987) (-361.966) (-360.929) -- 0:00:10
333000 -- (-360.931) [-360.981] (-357.953) (-363.525) * (-359.302) [-361.198] (-360.747) (-361.896) -- 0:00:10
333500 -- [-357.637] (-359.341) (-359.282) (-359.652) * [-361.385] (-359.044) (-359.490) (-359.286) -- 0:00:09
334000 -- [-358.860] (-363.297) (-366.162) (-359.478) * (-359.638) (-360.672) [-360.085] (-358.879) -- 0:00:09
334500 -- (-364.504) (-366.123) (-365.648) [-360.391] * (-362.303) (-362.473) (-364.840) [-359.412] -- 0:00:09
335000 -- (-362.828) [-358.394] (-361.203) (-358.750) * (-360.026) (-358.567) [-359.957] (-358.499) -- 0:00:09
Average standard deviation of split frequencies: 0.012783
335500 -- (-362.468) (-360.268) (-360.137) [-359.480] * (-359.909) (-361.025) [-359.479] (-361.533) -- 0:00:09
336000 -- (-363.008) [-360.475] (-359.268) (-361.691) * [-358.468] (-363.527) (-360.557) (-359.215) -- 0:00:09
336500 -- (-364.558) [-359.126] (-359.726) (-361.873) * (-361.039) [-361.470] (-360.596) (-358.258) -- 0:00:09
337000 -- (-360.251) [-359.241] (-364.137) (-361.911) * (-359.552) [-360.131] (-358.251) (-359.633) -- 0:00:09
337500 -- (-359.527) (-358.400) [-359.810] (-358.695) * (-359.866) (-359.737) [-358.201] (-358.545) -- 0:00:09
338000 -- (-359.885) [-359.342] (-358.488) (-359.849) * (-366.155) (-361.871) (-358.565) [-360.627] -- 0:00:09
338500 -- [-360.354] (-359.430) (-360.517) (-358.179) * (-359.399) (-359.977) (-359.528) [-357.682] -- 0:00:09
339000 -- (-358.926) (-359.168) [-358.772] (-357.683) * [-357.997] (-364.484) (-362.271) (-360.020) -- 0:00:09
339500 -- (-361.765) (-364.782) (-358.580) [-359.337] * [-360.169] (-363.848) (-360.405) (-358.084) -- 0:00:09
340000 -- (-360.420) (-359.980) (-360.548) [-358.182] * (-359.584) (-360.098) [-359.124] (-362.458) -- 0:00:09
Average standard deviation of split frequencies: 0.012454
340500 -- [-359.969] (-361.696) (-360.353) (-362.372) * (-359.989) (-360.314) (-361.195) [-360.350] -- 0:00:09
341000 -- (-358.549) (-358.595) [-361.389] (-362.354) * [-359.155] (-361.526) (-359.253) (-360.341) -- 0:00:09
341500 -- (-358.520) (-358.348) (-358.757) [-359.387] * [-360.581] (-361.157) (-358.946) (-358.366) -- 0:00:09
342000 -- (-363.878) (-358.701) (-365.916) [-358.244] * [-360.297] (-363.534) (-358.566) (-364.375) -- 0:00:09
342500 -- [-362.403] (-359.618) (-360.064) (-359.298) * (-360.298) (-360.953) [-357.844] (-360.212) -- 0:00:09
343000 -- (-359.280) (-358.170) (-359.320) [-360.976] * [-358.874] (-361.489) (-359.389) (-361.229) -- 0:00:09
343500 -- [-361.309] (-359.226) (-359.053) (-360.448) * (-359.036) (-359.603) [-360.489] (-363.842) -- 0:00:09
344000 -- (-361.395) [-357.822] (-358.103) (-362.313) * [-360.024] (-360.804) (-360.543) (-360.044) -- 0:00:09
344500 -- (-358.941) [-359.690] (-358.066) (-360.782) * (-359.481) (-359.589) [-359.811] (-358.754) -- 0:00:09
345000 -- [-359.950] (-363.408) (-359.049) (-360.312) * (-361.229) (-360.986) (-361.145) [-359.001] -- 0:00:09
Average standard deviation of split frequencies: 0.012186
345500 -- (-362.117) (-359.043) (-358.706) [-358.429] * (-362.660) (-358.279) (-361.275) [-360.398] -- 0:00:09
346000 -- (-363.234) [-360.392] (-360.827) (-359.658) * [-363.013] (-360.568) (-366.533) (-359.852) -- 0:00:09
346500 -- (-360.136) (-359.650) [-358.018] (-360.210) * (-358.579) [-362.013] (-363.047) (-358.440) -- 0:00:09
347000 -- [-358.504] (-358.039) (-359.721) (-361.793) * (-360.668) [-357.652] (-362.179) (-361.415) -- 0:00:09
347500 -- (-361.252) (-358.709) [-362.443] (-359.280) * (-359.944) [-357.979] (-359.416) (-359.138) -- 0:00:09
348000 -- (-359.999) [-359.829] (-363.823) (-359.297) * (-362.891) [-358.871] (-358.612) (-360.222) -- 0:00:09
348500 -- (-359.054) [-359.420] (-365.824) (-358.138) * (-360.234) (-360.026) [-358.473] (-358.678) -- 0:00:09
349000 -- (-359.337) [-359.690] (-359.381) (-360.772) * (-359.401) (-362.216) (-359.885) [-357.946] -- 0:00:09
349500 -- (-358.743) (-359.070) [-359.281] (-359.027) * [-358.551] (-360.907) (-360.009) (-362.831) -- 0:00:09
350000 -- [-359.652] (-361.907) (-359.874) (-361.041) * [-364.163] (-361.543) (-359.862) (-366.663) -- 0:00:09
Average standard deviation of split frequencies: 0.011949
350500 -- (-359.625) (-358.896) [-361.838] (-361.952) * (-368.273) (-362.963) (-361.164) [-362.304] -- 0:00:08
351000 -- (-361.661) (-359.683) (-365.290) [-359.370] * (-359.969) (-358.603) [-359.518] (-363.828) -- 0:00:08
351500 -- [-361.415] (-360.814) (-360.827) (-359.729) * [-360.647] (-360.327) (-364.541) (-358.806) -- 0:00:08
352000 -- (-361.838) (-362.322) (-361.115) [-360.173] * (-359.309) (-360.966) [-363.900] (-359.701) -- 0:00:08
352500 -- (-360.422) (-359.868) (-359.555) [-362.321] * (-358.202) (-359.044) [-360.041] (-363.537) -- 0:00:08
353000 -- (-359.309) (-359.814) [-362.543] (-358.895) * (-361.545) [-359.669] (-358.418) (-361.248) -- 0:00:08
353500 -- (-358.387) [-359.274] (-362.316) (-359.515) * [-359.594] (-360.529) (-358.564) (-361.482) -- 0:00:08
354000 -- [-358.349] (-357.845) (-359.317) (-362.418) * [-359.455] (-361.984) (-359.841) (-359.223) -- 0:00:08
354500 -- (-362.973) (-358.739) [-363.650] (-361.993) * (-362.561) (-361.432) [-359.098] (-360.677) -- 0:00:08
355000 -- (-364.786) (-359.153) [-362.131] (-360.850) * (-361.889) [-359.335] (-358.203) (-364.988) -- 0:00:08
Average standard deviation of split frequencies: 0.011173
355500 -- (-359.003) (-358.598) (-361.181) [-359.114] * (-359.612) (-358.347) (-359.767) [-359.434] -- 0:00:08
356000 -- (-359.784) (-361.765) [-361.675] (-359.194) * (-360.380) (-360.223) [-361.768] (-359.693) -- 0:00:08
356500 -- [-358.217] (-358.521) (-362.463) (-363.716) * [-359.715] (-359.963) (-365.291) (-359.212) -- 0:00:08
357000 -- (-358.699) (-360.533) [-358.598] (-359.182) * [-360.312] (-361.949) (-360.469) (-361.086) -- 0:00:08
357500 -- [-362.524] (-360.973) (-362.636) (-359.738) * (-361.849) [-361.707] (-360.570) (-361.358) -- 0:00:08
358000 -- [-361.562] (-363.294) (-358.723) (-362.550) * (-359.424) (-359.879) (-360.829) [-358.313] -- 0:00:08
358500 -- (-362.529) [-358.844] (-358.773) (-361.691) * (-357.750) (-358.887) (-360.059) [-358.450] -- 0:00:08
359000 -- (-358.551) (-357.956) (-361.258) [-359.039] * [-357.998] (-358.822) (-358.800) (-358.881) -- 0:00:08
359500 -- (-360.479) [-359.011] (-361.753) (-359.727) * (-361.702) [-359.059] (-360.088) (-361.431) -- 0:00:08
360000 -- [-358.021] (-358.923) (-367.957) (-361.084) * (-359.593) (-361.400) [-360.981] (-361.686) -- 0:00:08
Average standard deviation of split frequencies: 0.010994
360500 -- (-357.888) [-359.416] (-360.224) (-358.693) * (-360.105) (-359.534) [-359.470] (-360.835) -- 0:00:08
361000 -- (-362.940) [-358.469] (-358.852) (-360.198) * (-359.673) (-359.683) [-361.487] (-359.184) -- 0:00:08
361500 -- (-364.516) (-359.069) [-359.113] (-361.345) * (-359.170) (-362.269) [-357.999] (-360.282) -- 0:00:08
362000 -- (-358.108) (-359.869) (-360.042) [-360.535] * (-358.408) [-362.448] (-359.906) (-359.225) -- 0:00:08
362500 -- (-361.495) (-362.930) [-360.923] (-359.243) * (-360.074) (-361.154) (-361.884) [-359.183] -- 0:00:08
363000 -- [-361.294] (-360.072) (-363.438) (-358.835) * (-363.668) (-359.607) (-359.049) [-361.983] -- 0:00:08
363500 -- [-357.843] (-358.869) (-361.742) (-364.436) * [-358.461] (-358.287) (-359.271) (-360.530) -- 0:00:08
364000 -- (-360.970) (-361.257) [-360.546] (-361.389) * (-358.418) (-359.892) [-365.099] (-358.543) -- 0:00:08
364500 -- (-362.328) (-360.270) [-359.637] (-361.791) * (-361.478) (-358.733) (-363.487) [-361.136] -- 0:00:08
365000 -- (-359.122) [-359.334] (-360.295) (-362.057) * (-361.079) (-360.628) [-359.392] (-358.568) -- 0:00:08
Average standard deviation of split frequencies: 0.011735
365500 -- (-358.221) [-359.459] (-359.705) (-360.999) * [-360.806] (-368.564) (-360.075) (-358.826) -- 0:00:08
366000 -- [-358.862] (-359.657) (-358.380) (-358.901) * (-360.022) [-359.930] (-359.232) (-360.068) -- 0:00:08
366500 -- (-360.615) [-359.890] (-358.817) (-363.106) * (-360.142) [-359.227] (-360.733) (-358.728) -- 0:00:08
367000 -- (-362.034) (-360.377) [-359.270] (-358.657) * (-359.591) (-364.265) (-359.278) [-358.297] -- 0:00:07
367500 -- [-359.142] (-365.073) (-365.324) (-359.903) * (-359.658) (-364.189) [-359.519] (-360.008) -- 0:00:07
368000 -- (-358.216) (-359.745) [-361.734] (-358.927) * (-361.137) (-363.447) [-358.765] (-359.445) -- 0:00:07
368500 -- (-360.251) [-362.402] (-361.122) (-358.730) * (-360.621) [-362.097] (-360.878) (-360.338) -- 0:00:07
369000 -- (-359.195) [-359.835] (-359.561) (-358.748) * (-361.190) [-357.742] (-359.268) (-360.351) -- 0:00:07
369500 -- (-360.914) (-358.443) [-361.087] (-359.905) * [-358.096] (-359.506) (-361.454) (-358.385) -- 0:00:07
370000 -- (-366.915) [-358.033] (-362.236) (-362.715) * [-362.081] (-360.382) (-361.535) (-358.797) -- 0:00:07
Average standard deviation of split frequencies: 0.012930
370500 -- (-360.870) (-358.591) [-358.513] (-362.007) * [-359.247] (-359.951) (-361.632) (-359.503) -- 0:00:07
371000 -- (-360.583) [-359.805] (-359.899) (-360.423) * (-361.442) (-358.886) (-362.406) [-360.905] -- 0:00:07
371500 -- (-360.474) (-360.527) [-363.075] (-363.749) * (-359.701) (-363.605) [-362.276] (-361.314) -- 0:00:07
372000 -- [-360.460] (-364.447) (-358.531) (-361.543) * (-358.317) (-361.425) [-360.595] (-360.844) -- 0:00:07
372500 -- (-357.732) (-367.670) (-362.536) [-360.570] * (-360.262) [-359.327] (-358.652) (-364.713) -- 0:00:07
373000 -- (-362.827) (-363.180) [-363.946] (-359.901) * [-359.106] (-359.303) (-360.677) (-359.399) -- 0:00:07
373500 -- [-360.701] (-358.999) (-363.486) (-361.320) * (-360.467) [-360.067] (-360.111) (-360.101) -- 0:00:07
374000 -- (-359.393) (-360.770) [-359.861] (-361.666) * [-359.030] (-359.792) (-358.250) (-360.589) -- 0:00:07
374500 -- (-360.380) [-358.095] (-360.908) (-360.339) * (-358.940) [-358.192] (-359.619) (-361.229) -- 0:00:07
375000 -- (-362.756) (-358.952) (-359.300) [-360.272] * (-360.030) [-359.012] (-360.569) (-359.667) -- 0:00:07
Average standard deviation of split frequencies: 0.014139
375500 -- (-358.847) (-358.268) (-359.414) [-359.332] * (-358.383) [-359.708] (-360.916) (-358.073) -- 0:00:07
376000 -- [-360.745] (-359.357) (-358.313) (-360.733) * (-358.611) [-358.155] (-359.064) (-358.602) -- 0:00:07
376500 -- (-361.720) (-358.361) (-359.377) [-358.713] * (-363.148) (-359.211) (-358.678) [-359.455] -- 0:00:07
377000 -- [-358.936] (-360.433) (-358.876) (-357.904) * (-363.450) [-362.412] (-358.629) (-360.485) -- 0:00:07
377500 -- [-358.802] (-358.951) (-358.104) (-360.019) * (-360.613) (-358.719) [-358.660] (-360.630) -- 0:00:07
378000 -- (-358.480) [-359.143] (-358.264) (-360.999) * (-359.919) (-358.686) [-359.694] (-360.845) -- 0:00:07
378500 -- [-359.383] (-359.979) (-358.212) (-362.734) * (-358.322) (-359.211) (-360.809) [-359.474] -- 0:00:07
379000 -- [-360.855] (-358.601) (-359.372) (-358.749) * (-358.535) [-358.731] (-358.580) (-358.613) -- 0:00:07
379500 -- (-360.665) (-367.315) [-358.471] (-363.536) * (-361.038) [-358.725] (-360.396) (-359.383) -- 0:00:07
380000 -- [-360.527] (-361.804) (-358.923) (-363.149) * (-360.219) [-358.903] (-357.789) (-360.453) -- 0:00:07
Average standard deviation of split frequencies: 0.012796
380500 -- (-360.590) (-359.074) (-357.832) [-360.533] * (-359.586) (-360.752) (-363.161) [-361.068] -- 0:00:07
381000 -- (-365.056) (-359.185) [-360.936] (-359.425) * [-359.147] (-360.312) (-360.090) (-358.965) -- 0:00:07
381500 -- (-359.983) (-361.060) [-361.392] (-358.896) * (-360.084) [-358.730] (-361.298) (-358.356) -- 0:00:07
382000 -- (-359.721) (-360.991) [-359.741] (-360.713) * (-359.223) (-358.390) (-362.833) [-360.444] -- 0:00:07
382500 -- (-365.323) [-359.932] (-358.305) (-360.776) * (-362.437) (-360.542) (-361.382) [-363.160] -- 0:00:07
383000 -- [-361.032] (-358.204) (-360.530) (-359.292) * (-358.245) [-358.582] (-363.040) (-360.093) -- 0:00:07
383500 -- [-360.834] (-358.469) (-359.886) (-363.173) * (-361.615) (-357.685) (-365.021) [-358.918] -- 0:00:06
384000 -- (-358.850) [-358.375] (-358.744) (-359.152) * [-358.825] (-358.327) (-367.528) (-358.833) -- 0:00:06
384500 -- (-359.306) (-361.932) (-361.507) [-362.297] * [-358.108] (-358.953) (-359.723) (-358.755) -- 0:00:06
385000 -- (-358.197) (-359.023) [-358.252] (-358.936) * [-359.111] (-359.668) (-361.883) (-360.709) -- 0:00:06
Average standard deviation of split frequencies: 0.012920
385500 -- [-361.256] (-361.827) (-358.814) (-358.914) * (-357.788) [-359.546] (-369.772) (-360.497) -- 0:00:06
386000 -- (-358.380) (-361.135) (-363.481) [-358.975] * (-357.862) (-362.854) [-358.481] (-362.682) -- 0:00:06
386500 -- (-361.087) (-365.284) [-364.680] (-360.089) * [-358.047] (-359.989) (-359.931) (-359.783) -- 0:00:06
387000 -- (-359.825) [-359.343] (-360.204) (-362.822) * (-360.554) (-358.188) (-360.539) [-359.640] -- 0:00:06
387500 -- (-359.350) (-357.981) [-363.302] (-359.240) * (-361.423) (-357.939) (-359.782) [-359.413] -- 0:00:06
388000 -- (-358.262) [-359.144] (-359.156) (-359.050) * [-361.907] (-363.985) (-362.708) (-358.034) -- 0:00:06
388500 -- (-358.641) (-359.146) (-359.870) [-361.372] * (-359.580) (-359.206) [-359.241] (-359.324) -- 0:00:06
389000 -- [-362.542] (-359.633) (-360.239) (-360.091) * (-360.682) [-361.100] (-359.811) (-359.120) -- 0:00:06
389500 -- (-360.235) (-359.394) (-358.210) [-359.248] * (-360.257) (-361.518) (-361.361) [-358.116] -- 0:00:06
390000 -- (-361.504) [-359.207] (-358.526) (-359.258) * (-360.287) [-360.045] (-359.056) (-358.130) -- 0:00:06
Average standard deviation of split frequencies: 0.013591
390500 -- (-360.580) (-362.449) (-359.120) [-360.977] * (-359.668) [-359.085] (-359.927) (-363.216) -- 0:00:06
391000 -- (-363.504) (-357.991) [-359.620] (-361.609) * (-358.958) [-360.061] (-360.161) (-359.971) -- 0:00:06
391500 -- (-360.393) (-360.700) [-360.053] (-360.304) * (-358.022) (-363.647) [-361.629] (-365.106) -- 0:00:06
392000 -- [-361.453] (-360.666) (-358.639) (-361.314) * [-361.141] (-358.637) (-358.506) (-362.482) -- 0:00:06
392500 -- (-366.271) [-358.435] (-361.889) (-360.783) * (-358.814) (-360.691) [-359.209] (-358.545) -- 0:00:06
393000 -- (-366.093) (-358.567) [-358.778] (-360.552) * (-358.641) [-359.259] (-359.276) (-359.639) -- 0:00:06
393500 -- (-358.329) [-358.709] (-360.466) (-358.272) * (-359.860) [-359.653] (-358.158) (-358.271) -- 0:00:06
394000 -- (-360.005) [-358.610] (-359.932) (-358.337) * (-363.928) (-361.674) [-360.043] (-358.497) -- 0:00:06
394500 -- (-359.300) [-361.428] (-359.142) (-362.133) * [-358.029] (-362.916) (-358.467) (-362.466) -- 0:00:06
395000 -- (-362.463) (-367.299) (-360.288) [-359.665] * [-360.755] (-359.878) (-362.454) (-359.964) -- 0:00:06
Average standard deviation of split frequencies: 0.013408
395500 -- [-360.076] (-360.327) (-360.014) (-358.534) * [-361.327] (-359.257) (-362.438) (-360.038) -- 0:00:06
396000 -- [-362.131] (-358.133) (-360.191) (-360.322) * (-360.032) [-359.918] (-359.686) (-359.527) -- 0:00:06
396500 -- (-367.009) (-361.134) (-360.399) [-358.625] * [-358.905] (-359.260) (-362.842) (-358.897) -- 0:00:06
397000 -- (-365.390) (-363.688) [-357.844] (-359.200) * (-362.582) (-359.249) (-358.422) [-358.233] -- 0:00:06
397500 -- (-364.408) (-362.953) (-364.246) [-359.579] * (-359.497) (-358.316) (-359.735) [-360.172] -- 0:00:06
398000 -- (-363.233) (-360.588) [-358.218] (-363.282) * (-358.539) [-358.750] (-358.712) (-361.155) -- 0:00:06
398500 -- (-358.926) [-359.941] (-358.198) (-359.563) * (-362.992) (-361.470) (-359.862) [-358.896] -- 0:00:06
399000 -- [-360.167] (-359.541) (-359.073) (-362.865) * (-360.470) (-362.572) [-358.872] (-360.803) -- 0:00:06
399500 -- (-361.708) [-359.512] (-359.241) (-359.448) * (-361.032) (-359.064) (-359.582) [-359.545] -- 0:00:06
400000 -- (-358.868) (-358.318) [-360.058] (-358.702) * (-363.503) [-358.243] (-362.904) (-358.830) -- 0:00:06
Average standard deviation of split frequencies: 0.013933
400500 -- (-361.860) (-358.528) (-359.039) [-361.947] * [-359.962] (-359.444) (-358.591) (-358.875) -- 0:00:05
401000 -- (-363.703) (-359.345) (-357.590) [-358.561] * (-360.997) (-359.155) [-360.067] (-362.123) -- 0:00:05
401500 -- (-359.938) [-361.034] (-358.465) (-364.683) * (-358.128) (-362.265) (-362.171) [-359.453] -- 0:00:05
402000 -- (-361.947) [-360.013] (-360.633) (-364.659) * (-358.042) (-359.334) (-360.195) [-359.705] -- 0:00:05
402500 -- (-358.333) [-358.449] (-360.457) (-359.390) * [-359.056] (-359.425) (-359.811) (-358.697) -- 0:00:05
403000 -- (-360.298) (-359.615) (-359.480) [-363.327] * (-358.939) [-360.434] (-359.381) (-359.120) -- 0:00:05
403500 -- (-359.535) (-358.209) [-360.570] (-361.508) * (-358.179) (-359.684) (-360.324) [-360.743] -- 0:00:05
404000 -- (-358.959) [-358.647] (-360.218) (-359.142) * (-359.028) (-360.342) (-358.498) [-358.392] -- 0:00:05
404500 -- [-357.734] (-359.190) (-359.739) (-358.523) * (-360.183) (-359.070) (-359.592) [-360.576] -- 0:00:05
405000 -- (-361.724) (-361.286) (-362.447) [-359.137] * (-360.449) (-358.352) [-360.187] (-358.875) -- 0:00:05
Average standard deviation of split frequencies: 0.014666
405500 -- (-360.256) (-365.483) [-358.068] (-360.045) * [-358.561] (-357.959) (-360.931) (-369.071) -- 0:00:05
406000 -- [-358.395] (-365.078) (-360.222) (-361.840) * (-358.844) [-358.343] (-362.547) (-359.831) -- 0:00:05
406500 -- (-360.641) (-359.850) (-359.293) [-359.488] * [-359.083] (-360.178) (-360.764) (-358.351) -- 0:00:05
407000 -- [-358.670] (-361.015) (-359.771) (-359.773) * (-362.442) (-359.238) (-358.824) [-360.964] -- 0:00:05
407500 -- (-366.158) (-362.540) [-360.041] (-359.859) * (-358.397) (-360.265) (-365.351) [-359.920] -- 0:00:05
408000 -- [-358.277] (-361.000) (-359.961) (-360.029) * [-358.080] (-359.857) (-361.469) (-360.197) -- 0:00:05
408500 -- (-362.480) (-359.752) (-360.060) [-360.887] * (-358.507) (-359.281) [-361.836] (-361.045) -- 0:00:05
409000 -- (-361.135) [-359.067] (-362.238) (-360.222) * [-361.198] (-359.498) (-364.348) (-358.135) -- 0:00:05
409500 -- (-359.266) (-358.624) [-358.325] (-359.777) * (-367.918) [-359.592] (-362.907) (-359.486) -- 0:00:05
410000 -- (-359.799) (-359.897) (-359.546) [-359.408] * (-363.803) (-358.414) (-362.917) [-358.321] -- 0:00:05
Average standard deviation of split frequencies: 0.014198
410500 -- [-359.806] (-360.134) (-359.429) (-360.722) * (-361.183) (-361.159) [-359.512] (-358.909) -- 0:00:05
411000 -- (-358.355) [-358.606] (-362.962) (-362.348) * (-358.518) [-359.877] (-359.813) (-361.703) -- 0:00:05
411500 -- [-358.672] (-361.473) (-358.469) (-358.850) * (-358.301) (-359.742) (-362.902) [-360.245] -- 0:00:05
412000 -- (-360.869) [-358.945] (-358.630) (-360.209) * (-359.624) (-363.099) (-362.461) [-360.292] -- 0:00:05
412500 -- [-359.676] (-360.066) (-361.719) (-360.585) * [-360.031] (-360.384) (-359.010) (-358.392) -- 0:00:05
413000 -- (-362.935) [-359.765] (-359.074) (-360.031) * [-360.609] (-360.648) (-359.699) (-360.083) -- 0:00:05
413500 -- (-359.134) [-358.893] (-359.162) (-358.967) * (-358.732) [-359.905] (-358.712) (-361.252) -- 0:00:05
414000 -- (-358.358) (-359.277) (-362.827) [-357.880] * [-361.580] (-363.676) (-357.976) (-358.434) -- 0:00:05
414500 -- (-359.117) (-362.145) [-358.339] (-358.631) * [-358.431] (-364.397) (-361.220) (-358.731) -- 0:00:05
415000 -- [-358.797] (-361.369) (-359.222) (-360.201) * (-358.724) [-363.328] (-361.284) (-359.373) -- 0:00:05
Average standard deviation of split frequencies: 0.014314
415500 -- (-362.101) (-358.116) [-358.149] (-358.804) * [-358.920] (-362.287) (-358.343) (-358.044) -- 0:00:05
416000 -- (-359.397) (-365.645) [-359.145] (-358.731) * [-359.672] (-360.906) (-359.389) (-358.594) -- 0:00:05
416500 -- (-357.822) [-360.648] (-358.633) (-358.893) * (-359.045) (-359.004) (-360.160) [-359.282] -- 0:00:05
417000 -- (-359.672) [-359.547] (-361.144) (-361.597) * [-359.041] (-362.301) (-358.712) (-361.635) -- 0:00:04
417500 -- (-360.513) (-358.723) [-359.989] (-361.088) * [-360.239] (-359.864) (-359.389) (-364.488) -- 0:00:04
418000 -- (-362.397) [-359.179] (-361.935) (-359.007) * [-357.773] (-361.382) (-359.130) (-367.594) -- 0:00:04
418500 -- (-359.487) (-358.683) [-360.284] (-363.148) * (-362.225) [-359.716] (-361.177) (-359.930) -- 0:00:04
419000 -- (-367.519) [-359.714] (-361.050) (-363.670) * [-362.129] (-363.582) (-358.384) (-363.216) -- 0:00:04
419500 -- (-360.783) (-361.510) [-358.304] (-358.320) * (-358.935) (-359.287) (-358.863) [-360.445] -- 0:00:04
420000 -- (-362.110) (-358.465) [-359.395] (-359.372) * (-358.052) (-358.009) (-362.844) [-360.007] -- 0:00:04
Average standard deviation of split frequencies: 0.014319
420500 -- (-359.157) (-363.459) (-358.941) [-358.586] * (-358.206) (-358.337) (-358.267) [-359.375] -- 0:00:04
421000 -- (-357.938) (-361.703) (-359.375) [-360.593] * [-359.040] (-357.756) (-363.220) (-362.074) -- 0:00:04
421500 -- (-359.018) (-361.610) [-358.875] (-361.397) * [-360.501] (-360.535) (-360.788) (-361.623) -- 0:00:04
422000 -- (-360.638) (-358.894) [-359.617] (-359.135) * (-361.142) (-358.648) [-360.046] (-361.065) -- 0:00:04
422500 -- (-364.780) (-358.761) [-363.425] (-358.992) * [-361.371] (-362.729) (-358.383) (-359.399) -- 0:00:04
423000 -- (-363.271) (-359.757) [-359.814] (-358.962) * (-359.306) [-358.621] (-363.059) (-358.754) -- 0:00:04
423500 -- (-365.420) [-358.096] (-359.567) (-359.119) * [-360.536] (-360.975) (-361.167) (-361.441) -- 0:00:04
424000 -- (-358.868) [-360.468] (-359.388) (-359.310) * (-361.442) (-363.079) [-359.170] (-364.100) -- 0:00:04
424500 -- (-360.713) (-361.171) (-358.365) [-361.279] * [-358.154] (-360.625) (-362.050) (-360.893) -- 0:00:04
425000 -- (-358.886) (-359.576) (-360.136) [-358.045] * [-359.935] (-359.958) (-361.703) (-363.617) -- 0:00:04
Average standard deviation of split frequencies: 0.013340
425500 -- (-359.827) [-360.151] (-359.486) (-361.200) * (-358.602) (-364.018) [-358.810] (-359.899) -- 0:00:04
426000 -- [-357.902] (-362.133) (-359.989) (-358.371) * (-360.299) (-361.020) (-359.917) [-358.454] -- 0:00:04
426500 -- (-360.311) [-358.445] (-359.143) (-362.468) * [-360.621] (-361.168) (-359.203) (-359.367) -- 0:00:04
427000 -- (-361.818) (-357.861) (-359.784) [-361.682] * (-359.459) [-360.972] (-363.658) (-359.434) -- 0:00:04
427500 -- (-360.272) [-358.891] (-360.535) (-360.457) * (-361.222) (-359.287) (-361.386) [-360.393] -- 0:00:04
428000 -- (-362.268) (-360.538) (-359.911) [-361.071] * [-358.779] (-362.714) (-359.908) (-358.552) -- 0:00:04
428500 -- (-364.434) [-359.475] (-359.131) (-362.449) * [-358.905] (-360.187) (-359.229) (-359.286) -- 0:00:04
429000 -- (-362.391) (-358.302) (-357.906) [-361.447] * (-361.251) [-359.467] (-362.085) (-358.337) -- 0:00:04
429500 -- [-362.213] (-367.410) (-358.689) (-362.799) * (-359.079) (-361.000) (-361.416) [-358.704] -- 0:00:04
430000 -- [-359.147] (-361.031) (-362.570) (-359.408) * (-360.565) [-357.980] (-360.466) (-360.150) -- 0:00:04
Average standard deviation of split frequencies: 0.013135
430500 -- [-358.573] (-361.066) (-358.828) (-360.496) * (-358.699) [-358.743] (-364.107) (-362.143) -- 0:00:04
431000 -- (-360.489) (-363.457) [-358.868] (-359.302) * [-360.902] (-359.744) (-361.853) (-358.972) -- 0:00:04
431500 -- [-358.371] (-361.335) (-361.314) (-364.577) * [-358.549] (-359.678) (-360.711) (-360.414) -- 0:00:04
432000 -- [-362.876] (-359.143) (-362.985) (-359.780) * (-358.331) (-360.465) (-358.142) [-362.049] -- 0:00:04
432500 -- (-360.570) [-360.500] (-369.627) (-359.276) * [-359.328] (-360.494) (-358.282) (-359.004) -- 0:00:04
433000 -- (-358.903) (-360.108) (-360.030) [-360.041] * (-360.948) (-359.308) (-363.293) [-359.207] -- 0:00:04
433500 -- (-363.427) (-358.624) (-358.612) [-362.441] * (-365.438) (-362.417) (-361.301) [-360.023] -- 0:00:03
434000 -- [-358.313] (-361.279) (-360.775) (-359.825) * (-360.588) [-360.173] (-360.788) (-360.982) -- 0:00:03
434500 -- (-358.293) (-363.617) (-360.492) [-361.720] * (-359.370) (-359.550) [-359.431] (-362.679) -- 0:00:03
435000 -- (-362.022) [-360.344] (-361.590) (-361.233) * (-365.763) [-360.129] (-358.846) (-361.512) -- 0:00:03
Average standard deviation of split frequencies: 0.012466
435500 -- (-360.578) (-358.596) (-361.470) [-361.181] * (-359.613) (-361.915) (-360.416) [-360.540] -- 0:00:03
436000 -- (-361.777) [-359.072] (-361.296) (-363.101) * (-359.237) (-358.340) (-359.433) [-359.431] -- 0:00:03
436500 -- (-360.921) (-360.852) [-358.869] (-364.658) * (-362.334) [-362.437] (-362.354) (-362.389) -- 0:00:03
437000 -- (-361.453) (-361.803) [-360.587] (-360.575) * (-362.473) (-364.871) [-358.214] (-357.625) -- 0:00:03
437500 -- [-358.430] (-362.979) (-359.955) (-359.291) * (-359.646) (-361.881) [-365.716] (-361.786) -- 0:00:03
438000 -- (-359.904) (-364.812) [-362.345] (-361.603) * (-362.359) [-360.089] (-360.101) (-360.363) -- 0:00:03
438500 -- [-358.650] (-361.568) (-361.465) (-361.448) * (-361.485) (-360.455) [-358.444] (-359.167) -- 0:00:03
439000 -- (-359.488) (-361.265) [-361.693] (-358.410) * (-361.409) (-360.898) [-362.272] (-358.779) -- 0:00:03
439500 -- (-361.119) (-359.073) (-360.354) [-358.715] * (-361.636) (-360.937) [-363.634] (-360.386) -- 0:00:03
440000 -- (-360.603) (-358.771) (-359.704) [-362.691] * (-359.474) [-358.823] (-361.446) (-359.640) -- 0:00:03
Average standard deviation of split frequencies: 0.011830
440500 -- (-361.815) [-358.426] (-359.737) (-358.024) * [-358.807] (-358.974) (-360.117) (-360.839) -- 0:00:03
441000 -- (-359.722) (-359.698) [-359.769] (-358.163) * (-358.179) (-358.752) [-358.562] (-359.223) -- 0:00:03
441500 -- (-358.770) (-359.157) [-358.584] (-359.376) * (-359.356) (-359.650) [-358.095] (-358.159) -- 0:00:03
442000 -- (-359.872) (-363.393) [-358.706] (-362.848) * (-358.447) (-362.854) (-359.364) [-358.388] -- 0:00:03
442500 -- [-360.541] (-358.822) (-358.983) (-359.048) * (-359.112) (-360.532) (-361.705) [-362.478] -- 0:00:03
443000 -- (-360.678) (-360.398) [-359.233] (-358.959) * (-359.648) [-360.900] (-358.436) (-360.486) -- 0:00:03
443500 -- (-359.594) (-360.791) [-359.461] (-358.891) * (-359.588) (-359.024) [-359.684] (-360.654) -- 0:00:03
444000 -- (-358.860) [-358.228] (-358.668) (-361.128) * [-364.939] (-358.397) (-360.251) (-359.620) -- 0:00:03
444500 -- [-361.074] (-358.073) (-358.344) (-359.092) * [-360.428] (-360.268) (-360.918) (-361.442) -- 0:00:03
445000 -- (-360.842) [-359.831] (-358.072) (-362.460) * [-359.400] (-363.961) (-358.246) (-363.119) -- 0:00:03
Average standard deviation of split frequencies: 0.010880
445500 -- (-360.162) [-359.961] (-359.427) (-363.190) * [-359.074] (-362.884) (-357.972) (-359.090) -- 0:00:03
446000 -- [-358.790] (-362.645) (-359.232) (-359.457) * (-359.775) [-359.933] (-358.892) (-362.756) -- 0:00:03
446500 -- (-359.304) (-360.358) (-360.181) [-358.918] * (-364.733) [-359.172] (-359.868) (-357.974) -- 0:00:03
447000 -- (-359.830) [-362.538] (-362.309) (-359.326) * (-361.146) (-359.981) [-362.678] (-359.037) -- 0:00:03
447500 -- (-360.718) [-358.995] (-360.820) (-360.729) * (-361.888) [-358.189] (-362.675) (-362.128) -- 0:00:03
448000 -- (-358.379) (-359.829) (-364.196) [-357.596] * [-361.783] (-363.563) (-359.798) (-362.983) -- 0:00:03
448500 -- (-361.530) [-361.068] (-361.387) (-359.201) * (-360.265) (-364.107) (-359.710) [-361.259] -- 0:00:03
449000 -- (-366.446) (-359.776) (-358.803) [-360.327] * (-362.193) (-362.330) [-358.392] (-363.603) -- 0:00:03
449500 -- (-360.234) [-360.543] (-360.513) (-367.558) * (-360.400) (-358.829) (-362.319) [-357.967] -- 0:00:03
450000 -- [-359.010] (-360.139) (-358.879) (-365.690) * (-359.932) [-363.587] (-362.900) (-359.897) -- 0:00:03
Average standard deviation of split frequencies: 0.010829
450500 -- [-358.903] (-363.969) (-358.543) (-361.499) * (-362.161) [-357.988] (-359.791) (-366.764) -- 0:00:02
451000 -- (-358.210) [-358.003] (-358.033) (-360.807) * [-359.462] (-358.994) (-360.106) (-360.938) -- 0:00:02
451500 -- (-359.324) (-360.535) [-358.381] (-360.595) * (-363.492) (-359.921) (-360.541) [-358.712] -- 0:00:02
452000 -- [-359.340] (-360.307) (-360.055) (-360.416) * (-365.517) (-363.902) [-359.735] (-360.083) -- 0:00:02
452500 -- (-358.420) [-357.807] (-359.193) (-359.446) * (-366.120) (-359.048) [-359.908] (-359.261) -- 0:00:02
453000 -- (-362.238) (-362.269) [-358.480] (-359.158) * [-359.697] (-358.643) (-358.863) (-360.795) -- 0:00:02
453500 -- (-360.515) (-360.880) (-358.544) [-359.428] * (-358.362) [-359.594] (-363.255) (-361.008) -- 0:00:02
454000 -- (-359.800) (-357.997) (-357.626) [-359.107] * (-359.379) (-360.666) [-359.197] (-360.808) -- 0:00:02
454500 -- (-361.100) (-360.004) (-359.092) [-364.148] * [-358.551] (-357.910) (-359.923) (-360.622) -- 0:00:02
455000 -- (-360.900) (-361.096) [-358.309] (-361.081) * (-358.474) (-360.735) (-362.976) [-358.858] -- 0:00:02
Average standard deviation of split frequencies: 0.010642
455500 -- [-360.743] (-359.275) (-361.094) (-359.785) * (-358.413) [-361.827] (-358.213) (-360.818) -- 0:00:02
456000 -- [-364.299] (-359.226) (-360.828) (-360.178) * (-361.669) [-360.094] (-359.667) (-361.115) -- 0:00:02
456500 -- (-359.026) [-358.777] (-358.608) (-360.819) * (-359.717) [-360.764] (-358.929) (-359.426) -- 0:00:02
457000 -- (-357.817) (-360.487) (-359.078) [-360.157] * (-359.410) (-359.869) (-359.934) [-358.537] -- 0:00:02
457500 -- (-360.275) (-360.741) [-359.872] (-360.213) * [-364.696] (-359.056) (-359.884) (-360.593) -- 0:00:02
458000 -- (-361.934) (-358.806) (-359.717) [-360.717] * (-359.898) (-359.688) [-359.124] (-360.113) -- 0:00:02
458500 -- (-361.614) (-359.713) [-358.305] (-362.821) * (-359.728) (-358.377) (-362.942) [-361.731] -- 0:00:02
459000 -- (-362.322) (-359.517) [-359.787] (-359.339) * (-359.138) [-359.904] (-362.453) (-360.396) -- 0:00:02
459500 -- (-359.989) (-358.706) [-361.548] (-359.020) * (-365.098) (-360.393) (-361.895) [-364.668] -- 0:00:02
460000 -- (-359.744) (-362.708) (-362.163) [-361.557] * (-361.866) [-362.628] (-361.948) (-363.242) -- 0:00:02
Average standard deviation of split frequencies: 0.011497
460500 -- (-358.810) (-363.917) [-359.897] (-360.816) * (-360.216) (-359.536) [-359.721] (-359.929) -- 0:00:02
461000 -- (-358.425) [-360.847] (-361.276) (-360.439) * (-360.818) [-359.745] (-361.379) (-362.598) -- 0:00:02
461500 -- (-360.405) [-359.067] (-367.656) (-360.352) * (-359.098) (-361.734) [-358.834] (-360.475) -- 0:00:02
462000 -- (-360.369) (-361.976) (-361.384) [-358.639] * [-358.163] (-361.626) (-361.859) (-360.565) -- 0:00:02
462500 -- [-360.404] (-359.104) (-363.864) (-360.602) * [-358.223] (-358.132) (-362.319) (-357.956) -- 0:00:02
463000 -- (-366.695) (-360.553) (-361.785) [-358.352] * (-358.521) (-358.335) [-359.786] (-358.282) -- 0:00:02
463500 -- (-359.441) [-362.577] (-359.439) (-363.516) * (-358.508) [-361.619] (-359.652) (-361.663) -- 0:00:02
464000 -- [-359.214] (-358.760) (-359.220) (-364.112) * (-358.623) (-358.281) [-364.347] (-360.571) -- 0:00:02
464500 -- (-359.096) (-359.550) [-358.899] (-360.198) * (-358.349) [-359.511] (-362.151) (-359.294) -- 0:00:02
465000 -- (-359.498) (-361.714) (-361.446) [-362.009] * [-357.732] (-361.077) (-361.539) (-358.474) -- 0:00:02
Average standard deviation of split frequencies: 0.010771
465500 -- (-359.732) (-361.573) [-358.393] (-366.195) * (-358.377) [-360.292] (-359.179) (-360.250) -- 0:00:02
466000 -- (-363.444) (-363.338) [-360.114] (-358.710) * (-360.161) [-358.961] (-363.775) (-363.043) -- 0:00:02
466500 -- (-358.196) [-361.201] (-358.999) (-361.921) * (-358.897) (-361.171) [-360.319] (-361.293) -- 0:00:02
467000 -- (-360.503) (-359.345) (-364.221) [-360.898] * (-358.350) [-359.504] (-359.740) (-361.687) -- 0:00:01
467500 -- (-360.200) (-363.158) [-358.753] (-360.267) * [-358.105] (-362.012) (-361.094) (-360.351) -- 0:00:01
468000 -- (-361.286) [-364.119] (-360.875) (-361.260) * (-359.263) (-360.183) [-360.178] (-360.038) -- 0:00:01
468500 -- (-359.243) [-364.257] (-360.144) (-361.333) * (-359.581) (-360.347) (-363.588) [-362.920] -- 0:00:01
469000 -- (-360.645) (-361.907) (-359.990) [-359.906] * (-358.402) (-360.413) [-360.101] (-359.516) -- 0:00:01
469500 -- (-358.418) (-360.212) [-359.334] (-364.013) * (-359.668) (-359.887) [-359.297] (-358.955) -- 0:00:01
470000 -- (-358.296) (-360.433) [-358.190] (-362.211) * [-361.365] (-361.806) (-359.303) (-358.416) -- 0:00:01
Average standard deviation of split frequencies: 0.010958
470500 -- (-358.595) (-362.569) (-359.255) [-359.151] * (-359.274) (-360.558) [-360.825] (-361.942) -- 0:00:01
471000 -- (-358.548) [-363.946] (-359.243) (-358.336) * (-361.156) [-358.555] (-358.872) (-361.398) -- 0:00:01
471500 -- [-358.943] (-366.792) (-360.471) (-360.335) * (-361.710) (-359.370) (-358.391) [-359.404] -- 0:00:01
472000 -- (-361.134) (-359.665) (-358.213) [-364.372] * (-363.407) (-361.332) [-360.042] (-358.641) -- 0:00:01
472500 -- (-363.054) (-361.885) [-360.507] (-357.808) * (-367.517) [-362.435] (-361.204) (-360.246) -- 0:00:01
473000 -- (-363.524) (-357.867) (-358.954) [-362.186] * (-363.291) [-360.114] (-362.172) (-360.349) -- 0:00:01
473500 -- [-363.609] (-359.993) (-359.915) (-363.842) * (-359.484) (-360.059) (-360.559) [-360.654] -- 0:00:01
474000 -- (-360.414) (-359.100) [-357.972] (-362.584) * (-358.976) [-361.480] (-362.370) (-360.526) -- 0:00:01
474500 -- (-360.170) (-360.644) (-358.728) [-362.250] * [-361.854] (-360.859) (-359.525) (-361.570) -- 0:00:01
475000 -- [-362.045] (-359.189) (-361.804) (-359.693) * (-361.213) (-360.474) [-361.070] (-359.139) -- 0:00:01
Average standard deviation of split frequencies: 0.011334
475500 -- (-361.252) [-362.108] (-359.683) (-360.564) * [-362.551] (-361.079) (-358.705) (-360.378) -- 0:00:01
476000 -- (-359.839) (-358.866) (-361.116) [-360.462] * (-360.951) (-363.240) (-358.589) [-362.066] -- 0:00:01
476500 -- [-358.034] (-360.166) (-362.365) (-361.133) * (-359.423) [-363.099] (-361.309) (-358.440) -- 0:00:01
477000 -- (-358.586) (-359.214) (-362.293) [-357.917] * [-359.384] (-362.119) (-361.993) (-358.117) -- 0:00:01
477500 -- (-358.272) (-360.524) [-360.485] (-359.083) * [-358.781] (-363.370) (-361.071) (-360.113) -- 0:00:01
478000 -- (-363.664) (-359.738) [-359.395] (-358.826) * (-362.472) (-361.242) (-358.777) [-358.052] -- 0:00:01
478500 -- (-361.915) (-359.301) [-359.100] (-358.645) * (-361.279) [-361.233] (-359.234) (-360.347) -- 0:00:01
479000 -- (-360.904) (-360.411) [-358.935] (-360.864) * (-359.552) [-359.520] (-358.351) (-358.300) -- 0:00:01
479500 -- [-361.270] (-359.841) (-361.742) (-358.923) * (-359.721) (-361.115) (-357.903) [-359.118] -- 0:00:01
480000 -- (-361.512) [-360.208] (-362.413) (-362.099) * (-360.362) (-359.627) (-358.738) [-359.392] -- 0:00:01
Average standard deviation of split frequencies: 0.010384
480500 -- (-359.910) (-359.966) (-361.081) [-360.358] * (-360.678) (-358.182) (-360.039) [-359.837] -- 0:00:01
481000 -- [-358.535] (-359.429) (-358.828) (-358.165) * [-360.900] (-360.843) (-359.060) (-363.005) -- 0:00:01
481500 -- [-357.873] (-358.347) (-361.516) (-362.851) * (-360.538) [-360.654] (-360.941) (-360.257) -- 0:00:01
482000 -- (-362.427) (-362.120) [-359.619] (-360.645) * (-361.870) (-360.243) (-359.811) [-359.510] -- 0:00:01
482500 -- (-361.284) (-361.147) [-362.438] (-359.980) * (-363.651) (-360.889) [-359.018] (-359.761) -- 0:00:01
483000 -- (-363.410) [-359.768] (-365.590) (-358.965) * (-362.047) (-360.709) [-358.297] (-364.981) -- 0:00:01
483500 -- (-359.859) (-359.435) [-360.020] (-359.565) * (-358.066) [-359.766] (-359.343) (-359.855) -- 0:00:00
484000 -- (-359.010) [-359.124] (-360.557) (-364.619) * (-357.830) (-362.386) [-362.132] (-357.907) -- 0:00:00
484500 -- [-359.131] (-360.195) (-361.939) (-359.789) * (-360.579) [-357.856] (-361.582) (-358.255) -- 0:00:00
485000 -- (-360.318) (-359.509) (-362.285) [-361.899] * [-359.144] (-359.251) (-362.842) (-357.866) -- 0:00:00
Average standard deviation of split frequencies: 0.010108
485500 -- (-359.526) [-360.104] (-358.703) (-362.905) * [-359.724] (-359.027) (-359.635) (-358.094) -- 0:00:00
486000 -- (-358.844) (-360.084) [-360.150] (-359.125) * (-362.544) (-359.000) [-358.595] (-359.494) -- 0:00:00
486500 -- (-361.537) (-361.117) (-366.165) [-360.663] * (-359.673) (-358.660) (-365.548) [-361.309] -- 0:00:00
487000 -- [-358.611] (-360.763) (-372.024) (-361.857) * (-360.942) [-360.115] (-359.259) (-363.479) -- 0:00:00
487500 -- (-359.321) (-359.072) [-358.470] (-359.020) * [-359.704] (-361.078) (-357.894) (-365.941) -- 0:00:00
488000 -- (-360.631) (-359.000) (-358.296) [-359.766] * [-358.789] (-358.875) (-366.704) (-365.057) -- 0:00:00
488500 -- (-361.564) (-360.555) [-359.078] (-361.856) * [-359.599] (-358.129) (-362.930) (-366.202) -- 0:00:00
489000 -- (-359.821) [-358.865] (-361.135) (-362.929) * (-358.470) (-359.764) (-358.875) [-359.595] -- 0:00:00
489500 -- [-362.039] (-357.800) (-359.278) (-361.884) * (-360.376) (-361.217) [-361.484] (-360.435) -- 0:00:00
490000 -- (-362.069) [-358.893] (-358.207) (-358.985) * (-361.648) (-359.990) (-358.119) [-358.266] -- 0:00:00
Average standard deviation of split frequencies: 0.009155
490500 -- (-362.983) (-359.213) (-359.235) [-360.799] * (-359.535) (-361.624) [-360.355] (-358.792) -- 0:00:00
491000 -- [-357.849] (-362.710) (-360.417) (-358.582) * (-359.335) (-359.715) [-360.216] (-360.623) -- 0:00:00
491500 -- (-363.756) [-360.939] (-359.988) (-359.247) * (-359.127) (-359.893) (-363.555) [-361.146] -- 0:00:00
492000 -- (-361.670) (-359.031) (-364.480) [-359.102] * (-361.336) (-358.764) [-359.520] (-361.149) -- 0:00:00
492500 -- [-360.416] (-359.104) (-365.856) (-360.263) * [-359.980] (-359.644) (-361.885) (-358.754) -- 0:00:00
493000 -- [-359.118] (-358.379) (-364.958) (-361.380) * (-361.690) [-359.493] (-364.180) (-359.610) -- 0:00:00
493500 -- [-359.668] (-358.775) (-359.150) (-362.694) * [-361.553] (-363.457) (-359.064) (-359.845) -- 0:00:00
494000 -- (-359.766) [-359.104] (-358.700) (-363.530) * [-359.113] (-360.389) (-359.790) (-360.151) -- 0:00:00
494500 -- (-363.053) (-358.689) [-361.877] (-364.339) * (-361.164) [-360.150] (-359.579) (-361.875) -- 0:00:00
495000 -- [-360.622] (-358.943) (-360.572) (-358.472) * (-358.699) (-358.840) [-358.664] (-361.919) -- 0:00:00
Average standard deviation of split frequencies: 0.008554
495500 -- [-361.325] (-360.078) (-360.594) (-358.867) * (-359.820) (-360.080) [-359.192] (-360.486) -- 0:00:00
496000 -- (-360.196) (-358.920) (-363.070) [-361.155] * [-358.975] (-361.863) (-359.190) (-359.120) -- 0:00:00
496500 -- [-363.192] (-361.395) (-364.357) (-363.041) * (-359.886) (-359.137) (-359.439) [-359.832] -- 0:00:00
497000 -- [-359.802] (-359.168) (-359.539) (-358.879) * (-362.354) (-363.115) (-359.717) [-359.095] -- 0:00:00
497500 -- (-361.170) (-358.171) [-359.761] (-360.241) * (-367.761) (-358.555) [-359.477] (-361.009) -- 0:00:00
498000 -- (-362.830) (-361.140) (-360.856) [-359.789] * (-359.752) [-361.308] (-358.975) (-359.126) -- 0:00:00
498500 -- (-361.201) (-359.097) (-359.619) [-363.534] * (-364.976) (-358.599) [-359.550] (-358.383) -- 0:00:00
499000 -- (-361.247) [-358.545] (-359.323) (-360.346) * (-364.403) [-362.842] (-361.200) (-360.032) -- 0:00:00
499500 -- (-363.198) (-361.043) [-359.738] (-360.825) * (-358.607) [-361.212] (-359.739) (-358.281) -- 0:00:00
500000 -- (-359.364) (-359.064) (-360.582) [-359.003] * (-361.045) [-363.984] (-358.903) (-359.154) -- 0:00:00
Average standard deviation of split frequencies: 0.009311
Analysis completed in 30 seconds
Analysis used 28.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -357.55
Likelihood of best state for "cold" chain of run 2 was -357.55
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
78.2 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
48.4 % ( 44 %) Dirichlet(Pi{all})
48.6 % ( 40 %) Slider(Pi{all})
88.6 % ( 77 %) Multiplier(Alpha{1,2})
88.4 % ( 85 %) Multiplier(Alpha{3})
26.7 % ( 35 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 83 %) ParsSPR(Tau{all},V{all})
30.8 % ( 26 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
35.6 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
78.0 % ( 76 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
47.9 % ( 40 %) Dirichlet(Pi{all})
48.7 % ( 38 %) Slider(Pi{all})
88.0 % ( 81 %) Multiplier(Alpha{1,2})
87.9 % ( 79 %) Multiplier(Alpha{3})
26.5 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.6 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 87 %) ParsSPR(Tau{all},V{all})
30.6 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
35.3 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.80 0.64 0.50
2 | 83612 0.82 0.67
3 | 83411 83146 0.83
4 | 82906 83302 83623
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.51
2 | 82869 0.83 0.67
3 | 83230 83656 0.84
4 | 83346 83422 83477
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -359.18
| 1 1 1 2 11 |
| 1 2 1 1 21 1 2 2 2 |
| 2 2 2 1 2 1 2 2 1 |
|2 1 2 * 2 2 2 1 1 21 11 1 1 2 |
| 2 1 2 1 2 2 2 221 112 1 |
| 1 11 1 1 1 1 1 2 2 2 1 12 |
| 1 2 2 22 2 2 |
| 2 2 2 2 1 2 21 1 2 2|
| 1 2 1 2 2 12 1 12 2 |
| 2 1 2 1|
|1 2 1 1 2 21 |
| 1 1 1 |
| 211 1 |
| 1 |
| 22 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -361.38
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -359.25 -362.16
2 -359.23 -362.31
--------------------------------------
TOTAL -359.24 -362.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.913035 0.094792 0.328037 1.502781 0.885668 643.44 693.61 1.000
r(A<->C){all} 0.176202 0.021430 0.000654 0.464556 0.140049 58.55 60.28 1.006
r(A<->G){all} 0.202882 0.026774 0.000121 0.535247 0.160441 45.12 69.14 0.999
r(A<->T){all} 0.161634 0.021688 0.000276 0.469016 0.111189 97.42 115.31 0.999
r(C<->G){all} 0.157389 0.018910 0.000007 0.438624 0.118910 49.20 83.67 1.012
r(C<->T){all} 0.158624 0.020037 0.000010 0.438250 0.116774 39.89 43.64 1.001
r(G<->T){all} 0.143269 0.013524 0.000114 0.372520 0.116206 82.35 152.26 1.007
pi(A){all} 0.211751 0.000643 0.161923 0.263637 0.211150 576.90 647.15 1.001
pi(C){all} 0.290935 0.000785 0.239990 0.350081 0.290371 400.16 575.58 0.999
pi(G){all} 0.298183 0.000833 0.245797 0.354285 0.297871 544.10 619.35 0.999
pi(T){all} 0.199130 0.000563 0.155800 0.244781 0.198205 632.04 691.52 1.003
alpha{1,2} 0.402549 0.194935 0.000155 1.287097 0.242155 527.71 536.64 0.999
alpha{3} 0.444797 0.212011 0.000169 1.388870 0.297561 390.20 481.20 1.004
pinvar{all} 0.993818 0.000055 0.979147 0.999990 0.996152 570.53 588.65 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ..*.*.
9 -- .*...*
10 -- ..**..
11 -- ..*..*
12 -- .*..*.
13 -- .***.*
14 -- ...**.
15 -- .*.***
16 -- ...*.*
17 -- ..****
18 -- .****.
19 -- .**...
20 -- ....**
21 -- .*.*..
22 -- .*..**
23 -- ..***.
24 -- .*.*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 237 0.157790 0.006591 0.153129 0.162450 2
8 236 0.157124 0.015065 0.146471 0.167776 2
9 229 0.152463 0.010357 0.145140 0.159787 2
10 220 0.146471 0.022597 0.130493 0.162450 2
11 215 0.143142 0.012240 0.134487 0.151798 2
12 212 0.141145 0.001883 0.139814 0.142477 2
13 212 0.141145 0.003766 0.138482 0.143808 2
14 211 0.140479 0.002825 0.138482 0.142477 2
15 208 0.138482 0.007532 0.133156 0.143808 2
16 207 0.137816 0.002825 0.135819 0.139814 2
17 207 0.137816 0.000942 0.137150 0.138482 2
18 207 0.137816 0.000942 0.137150 0.138482 2
19 207 0.137816 0.004708 0.134487 0.141145 2
20 204 0.135819 0.005649 0.131824 0.139814 2
21 187 0.124501 0.021656 0.109188 0.139814 2
22 146 0.097204 0.020714 0.082557 0.111851 2
23 141 0.093875 0.012240 0.085220 0.102530 2
24 136 0.090546 0.015065 0.079893 0.101198 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.103929 0.011084 0.000080 0.317800 0.070443 1.002 2
length{all}[2] 0.103037 0.010408 0.000051 0.310616 0.072335 1.002 2
length{all}[3] 0.096167 0.008947 0.000032 0.283982 0.068876 1.000 2
length{all}[4] 0.094973 0.009286 0.000081 0.283783 0.066627 1.000 2
length{all}[5] 0.102957 0.011758 0.000171 0.310800 0.071957 1.000 2
length{all}[6] 0.100709 0.010471 0.000090 0.311049 0.069628 1.003 2
length{all}[7] 0.114911 0.015071 0.001208 0.370190 0.071917 0.999 2
length{all}[8] 0.101599 0.010292 0.000398 0.269795 0.075285 0.996 2
length{all}[9] 0.110964 0.012001 0.002508 0.315328 0.070476 0.996 2
length{all}[10] 0.095194 0.011819 0.000336 0.309091 0.054613 0.996 2
length{all}[11] 0.103758 0.009977 0.000297 0.321905 0.074033 0.996 2
length{all}[12] 0.095059 0.008415 0.000750 0.262722 0.068676 1.000 2
length{all}[13] 0.101333 0.011738 0.000536 0.315553 0.070758 1.012 2
length{all}[14] 0.095434 0.009547 0.000470 0.265045 0.065664 0.996 2
length{all}[15] 0.105242 0.010229 0.000098 0.318292 0.070563 0.995 2
length{all}[16] 0.103692 0.010049 0.000339 0.312851 0.078036 0.996 2
length{all}[17] 0.112015 0.012897 0.001029 0.377783 0.076137 1.041 2
length{all}[18] 0.094260 0.008738 0.000353 0.268021 0.059841 0.996 2
length{all}[19] 0.104949 0.011051 0.000212 0.302117 0.069476 0.996 2
length{all}[20] 0.092931 0.007952 0.000649 0.264950 0.063231 0.997 2
length{all}[21] 0.107542 0.015375 0.002711 0.309213 0.070604 0.995 2
length{all}[22] 0.117102 0.014204 0.000335 0.339100 0.090340 0.993 2
length{all}[23] 0.111530 0.012259 0.000621 0.309184 0.079517 0.995 2
length{all}[24] 0.097900 0.009274 0.000165 0.310869 0.070276 0.993 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009311
Maximum standard deviation of split frequencies = 0.022597
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.041
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 261
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 87 / 87 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 87 / 87 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097650 0.021392 0.059240 0.033026 0.090037 0.066470 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -379.507223
Iterating by ming2
Initial: fx= 379.507223
x= 0.09765 0.02139 0.05924 0.03303 0.09004 0.06647 0.30000 1.30000
1 h-m-p 0.0000 0.0003 207.9566 +++ 368.666265 m 0.0003 14 | 1/8
2 h-m-p 0.0012 0.0077 39.6532 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 190.2659 ++ 363.724453 m 0.0001 45 | 2/8
4 h-m-p 0.0007 0.0098 31.5144 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 170.2509 +++ 354.757982 m 0.0003 77 | 3/8
6 h-m-p 0.0019 0.0131 23.9288 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 147.9380 ++ 352.891298 m 0.0001 109 | 4/8
8 h-m-p 0.0006 0.0191 17.0243 -----------.. | 4/8
9 h-m-p 0.0000 0.0003 120.7511 +++ 348.815572 m 0.0003 141 | 5/8
10 h-m-p 0.0022 0.0302 11.0661 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 85.6713 ++ 348.152804 m 0.0001 173 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 Y 348.152804 0 0.4000 184 | 6/8
13 h-m-p 0.6871 8.0000 0.0000 -----Y 348.152804 0 0.0002 202
Out..
lnL = -348.152804
203 lfun, 203 eigenQcodon, 1218 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016394 0.045936 0.075622 0.078717 0.097013 0.095010 0.299808 0.660111 0.505517
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.582737
np = 9
lnL0 = -382.535015
Iterating by ming2
Initial: fx= 382.535015
x= 0.01639 0.04594 0.07562 0.07872 0.09701 0.09501 0.29981 0.66011 0.50552
1 h-m-p 0.0000 0.0002 202.4863 +++ 374.442366 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0009 145.0984 ++ 361.935689 m 0.0009 27 | 2/9
3 h-m-p 0.0000 0.0002 460.5312 ++ 352.106311 m 0.0002 39 | 3/9
4 h-m-p 0.0002 0.0011 44.1671 ++ 350.955680 m 0.0011 51 | 4/9
5 h-m-p 0.0000 0.0000 5548.9289 ++ 348.262487 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 1508.4401 ++ 348.152806 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0009 --------------Y 348.152806 0 0.0000 101
Out..
lnL = -348.152806
102 lfun, 306 eigenQcodon, 1224 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.047146 0.070286 0.019614 0.057011 0.095580 0.037082 0.241698 0.905443 0.518641 0.213883 1.430296
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.494546
np = 11
lnL0 = -374.724585
Iterating by ming2
Initial: fx= 374.724585
x= 0.04715 0.07029 0.01961 0.05701 0.09558 0.03708 0.24170 0.90544 0.51864 0.21388 1.43030
1 h-m-p 0.0000 0.0003 189.2355 +++ 365.531441 m 0.0003 17 | 1/11
2 h-m-p 0.0004 0.0019 68.8822 ++ 358.157351 m 0.0019 31 | 2/11
3 h-m-p 0.0000 0.0000 1049.7613 ++ 354.967939 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 302.2228 ++ 353.420116 m 0.0002 59 | 4/11
5 h-m-p 0.0014 0.0072 11.0978 -----------.. | 4/11
6 h-m-p 0.0000 0.0000 142.6677 ++ 352.481931 m 0.0000 96 | 5/11
7 h-m-p 0.0011 0.0780 4.7782 -----------.. | 5/11
8 h-m-p 0.0000 0.0002 117.0685 ++ 350.289665 m 0.0002 133 | 6/11
9 h-m-p 0.0038 0.0969 3.4019 ------------.. | 6/11
10 h-m-p 0.0000 0.0003 84.0079 +++ 348.152804 m 0.0003 172 | 7/11
11 h-m-p 1.0105 8.0000 0.0000 ++ 348.152804 m 8.0000 186 | 7/11
12 h-m-p 0.0160 8.0000 0.0077 +++++ 348.152803 m 8.0000 207 | 7/11
13 h-m-p 0.0275 8.0000 2.2473 ----------C 348.152803 0 0.0000 235 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 348.152803 m 8.0000 252 | 7/11
15 h-m-p 0.0057 2.8463 0.1796 +++++ 348.152800 m 2.8463 273 | 8/11
16 h-m-p 0.1985 1.5653 2.4100 +Y 348.152798 0 1.1617 292 | 8/11
17 h-m-p 1.6000 8.0000 0.5658 Y 348.152798 0 0.2088 306 | 8/11
18 h-m-p 1.6000 8.0000 0.0002 ++ 348.152798 m 8.0000 323 | 8/11
19 h-m-p 0.0235 8.0000 0.0522 +++C 348.152798 0 1.3587 343 | 8/11
20 h-m-p 1.6000 8.0000 0.0006 ++ 348.152798 m 8.0000 360 | 8/11
21 h-m-p 0.0160 8.0000 0.4270 +++C 348.152798 0 1.4762 380 | 8/11
22 h-m-p 1.6000 8.0000 0.0524 ++ 348.152798 m 8.0000 397 | 8/11
23 h-m-p 0.4079 8.0000 1.0269 +Y 348.152797 0 4.0071 415 | 8/11
24 h-m-p 1.6000 8.0000 0.3337 -------C 348.152797 0 0.0000 436 | 8/11
25 h-m-p 0.0160 8.0000 0.6115 +++++ 348.152797 m 8.0000 456 | 8/11
26 h-m-p 0.8517 8.0000 5.7441 +Y 348.152797 0 2.3424 474 | 8/11
27 h-m-p 1.6000 8.0000 0.9439 -----------Y 348.152797 0 0.0000 499 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 -------Y 348.152797 0 0.0000 523
Out..
lnL = -348.152797
524 lfun, 2096 eigenQcodon, 9432 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -348.153687 S = -348.151067 -0.001000
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:04
did 20 / 45 patterns 0:04
did 30 / 45 patterns 0:04
did 40 / 45 patterns 0:04
did 45 / 45 patterns 0:04
Time used: 0:04
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017043 0.036795 0.021153 0.022006 0.033543 0.016116 0.000100 0.492982 0.747939 0.650011 1.446646 2.082606
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 7.213759
np = 12
lnL0 = -360.534053
Iterating by ming2
Initial: fx= 360.534053
x= 0.01704 0.03680 0.02115 0.02201 0.03354 0.01612 0.00011 0.49298 0.74794 0.65001 1.44665 2.08261
1 h-m-p 0.0000 0.0000 204.2822 ++ 359.455314 m 0.0000 17 | 1/12
2 h-m-p 0.0002 0.0332 22.1040 ++++ 359.166141 m 0.0332 34 | 2/12
3 h-m-p 0.2790 2.3511 1.2179 ---------------.. | 2/12
4 h-m-p 0.0000 0.0002 192.1843 +++ 350.080758 m 0.0002 78 | 3/12
5 h-m-p 0.0069 1.1821 6.0558 -------------.. | 3/12
6 h-m-p 0.0000 0.0000 188.5493 ++ 349.904758 m 0.0000 119 | 4/12
7 h-m-p 0.0084 4.2229 1.7780 -------------.. | 4/12
8 h-m-p 0.0000 0.0000 168.8127 ++ 349.270832 m 0.0000 160 | 5/12
9 h-m-p 0.0115 5.7522 1.4284 -------------.. | 5/12
10 h-m-p 0.0000 0.0000 146.8687 ++ 349.170143 m 0.0000 201 | 6/12
11 h-m-p 0.0160 8.0000 1.1360 -------------.. | 6/12
12 h-m-p 0.0000 0.0001 119.9354 ++ 348.279137 m 0.0001 242 | 7/12
13 h-m-p 0.0160 8.0000 0.8069 -------------.. | 7/12
14 h-m-p 0.0000 0.0000 85.4481 ++ 348.152798 m 0.0000 288 | 8/12
15 h-m-p 0.0160 8.0000 0.0000 Y 348.152798 0 0.0160 303 | 8/12
16 h-m-p 0.0160 8.0000 0.0000 N 348.152798 0 0.0160 322 | 8/12
17 h-m-p 0.0160 8.0000 0.0001 +++++ 348.152798 m 8.0000 344 | 8/12
18 h-m-p 0.0160 8.0000 1.5160 +++Y 348.152798 0 1.0240 366 | 8/12
19 h-m-p 1.6000 8.0000 0.0487 ------C 348.152798 0 0.0001 387 | 8/12
20 h-m-p 1.6000 8.0000 0.0000 ++ 348.152798 m 8.0000 406 | 8/12
21 h-m-p 0.0160 8.0000 0.0045 ------C 348.152798 0 0.0000 431 | 8/12
22 h-m-p 0.0160 8.0000 0.0000 +++++ 348.152798 m 8.0000 453 | 8/12
23 h-m-p 0.0160 8.0000 0.2940 -------Y 348.152798 0 0.0000 479 | 8/12
24 h-m-p 0.0160 8.0000 0.0000 -------C 348.152798 0 0.0000 505 | 8/12
25 h-m-p 0.0160 8.0000 0.0000 -----C 348.152798 0 0.0000 529
Out..
lnL = -348.152798
530 lfun, 2120 eigenQcodon, 9540 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017569 0.067924 0.046616 0.031312 0.088992 0.018207 0.000100 0.731200 1.483891
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.411191
np = 9
lnL0 = -370.470330
Iterating by ming2
Initial: fx= 370.470330
x= 0.01757 0.06792 0.04662 0.03131 0.08899 0.01821 0.00011 0.73120 1.48389
1 h-m-p 0.0000 0.0000 195.2440 ++ 370.209832 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0458 15.9169 ---------.. | 1/9
3 h-m-p 0.0000 0.0002 195.4107 +++ 362.022054 m 0.0002 46 | 2/9
4 h-m-p 0.0029 0.0564 12.9468 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 182.9607 ++ 361.761930 m 0.0000 80 | 3/9
6 h-m-p 0.0001 0.0746 9.8058 ----------.. | 3/9
7 h-m-p 0.0000 0.0002 163.3869 ++ 357.458848 m 0.0002 112 | 4/9
8 h-m-p 0.0028 0.0912 8.0505 ------------.. | 4/9
9 h-m-p 0.0000 0.0002 143.2955 +++ 353.621042 m 0.0002 147 | 5/9
10 h-m-p 0.0043 0.1485 5.0613 ------------.. | 5/9
11 h-m-p 0.0000 0.0003 118.3632 +++ 349.986451 m 0.0003 182 | 6/9
12 h-m-p 0.0086 0.3417 2.4885 -------------.. | 6/9
13 h-m-p 0.0000 0.0003 84.7822 +++ 348.152803 m 0.0003 218 | 7/9
14 h-m-p 0.2240 8.0000 0.0000 +++ 348.152803 m 8.0000 231 | 7/9
15 h-m-p 0.0290 8.0000 0.0010 +++++ 348.152803 m 8.0000 248 | 7/9
16 h-m-p 0.0031 0.6048 2.6283 ++++ 348.152798 m 0.6048 264 | 7/9
17 h-m-p 1.6000 8.0000 0.0504 ------N 348.152798 0 0.0000 282
QuantileBeta(0.85, 1.33559, 0.00495) = 1.000000e+00 2000 rounds
| 7/9
18 h-m-p 1.6000 8.0000 0.0000 N 348.152798 0 1.6000 296
QuantileBeta(0.85, 1.33559, 0.00495) = 1.000000e+00 2000 rounds
| 7/9
19 h-m-p 0.0086 0.0458 0.0000 ----Y 348.152798 0 0.0000 314
Out..
lnL = -348.152798
315 lfun, 3465 eigenQcodon, 18900 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.097948 0.079801 0.076206 0.070158 0.090819 0.024554 0.000100 0.900000 1.171944 1.219618 1.300021
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.676894
np = 11
lnL0 = -383.801148
Iterating by ming2
Initial: fx= 383.801148
x= 0.09795 0.07980 0.07621 0.07016 0.09082 0.02455 0.00011 0.90000 1.17194 1.21962 1.30002
1 h-m-p 0.0000 0.0000 188.7095 ++ 383.657909 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0032 69.2418 +++++ 371.236684 m 0.0032 33 | 2/11
3 h-m-p 0.0003 0.0015 114.8591 ++ 353.186116 m 0.0015 47 | 3/11
4 h-m-p 0.0014 0.0072 28.8807 ++ 351.095299 m 0.0072 61 | 4/11
5 h-m-p 0.0000 0.0000 16200.2833 ++ 350.201890 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 13045.5440 ++ 348.570154 m 0.0000 89 | 6/11
7 h-m-p 0.0000 0.0000 13644.5460 ++ 348.152799 m 0.0000 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0002 ++ 348.152799 m 8.0000 117 | 7/11
9 h-m-p 0.0370 8.0000 0.0502 --------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 348.152799 m 8.0000 168 | 7/11
11 h-m-p 0.0031 1.5580 0.4041 +++++ 348.152796 m 1.5580 189 | 8/11
12 h-m-p 1.5952 8.0000 0.0841 ++ 348.152796 m 8.0000 207 | 8/11
13 h-m-p 0.4702 8.0000 1.4305 +++ 348.152795 m 8.0000 225 | 8/11
14 h-m-p 0.2684 1.3421 3.3884 +
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
+ 348.152795 m 1.3421 239
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
15 h-m-p 0.0000 0.0000 5.9759
h-m-p: 1.41429402e-18 7.07147011e-18 5.97586246e+00 348.152795
..
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
C 348.152795 0 0.0160 264
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40757, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40703, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
17 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
Y 348.152795 0 0.0000 290
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -348.152795
291 lfun, 3492 eigenQcodon, 19206 P(t)
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -348.151178 S = -348.150782 -0.000173
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:16
did 20 / 45 patterns 0:17
did 30 / 45 patterns 0:17
did 40 / 45 patterns 0:17
did 45 / 45 patterns 0:17
QuantileBeta(0.85, 9.40730, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87
NC_011896_1_WP_010908682_1_2168_MLBR_RS10295 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
NC_002677_1_NP_302362_1_1234_ML2035 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI
**************************************************
NC_011896_1_WP_010908682_1_2168_MLBR_RS10295 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
NC_002677_1_NP_302362_1_1234_ML2035 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440 RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
*************************************
>NC_011896_1_WP_010908682_1_2168_MLBR_RS10295 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA ACGAGCCACAC >NC_002677_1_NP_302362_1_1234_ML2035 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA ACGAGCCACAC >NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA ACGAGCCACAC >NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA ACGAGCCACAC >NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA ACGAGCCACAC >NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440 GTGCGTGATGTGATCCTCGAGGGCGGCTTGTACGTCACCGAGATGCGCTG TACGCATGCACTGGTAGACGGCCCGCGGCCATCGCTGCCTAAGTCAATCG ACGAGGGTCGCTGGGACCGCACAGATCGGCATGTGCACCTGGAAGTCATT CGGCAGGAGCCCAATAACGGCCTAGTTGATCCTGCAGCAGCTTCTTCCAA GCCGGATTGGAACCCATGTTCTCTATATGTGCCAGGGCGTCAGTACCGAA ACGAGCCACAC
>NC_011896_1_WP_010908682_1_2168_MLBR_RS10295 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH >NC_002677_1_NP_302362_1_1234_ML2035 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH >NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH >NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH >NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH >NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440 VRDVILEGGLYVTEMRCTHALVDGPRPSLPKSIDEGRWDRTDRHVHLEVI RQEPNNGLVDPAAASSKPDWNPCSLYVPGRQYRNEPH
#NEXUS
[ID: 5348094258]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908682_1_2168_MLBR_RS10295
NC_002677_1_NP_302362_1_1234_ML2035
NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955
NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345
NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135
NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908682_1_2168_MLBR_RS10295,
2 NC_002677_1_NP_302362_1_1234_ML2035,
3 NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955,
4 NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345,
5 NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135,
6 NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07044333,2:0.07233477,3:0.06887615,4:0.06662699,5:0.0719569,6:0.0696283);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07044333,2:0.07233477,3:0.06887615,4:0.06662699,5:0.0719569,6:0.0696283);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -359.25 -362.16
2 -359.23 -362.31
--------------------------------------
TOTAL -359.24 -362.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2035/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.913035 0.094792 0.328037 1.502781 0.885668 643.44 693.61 1.000
r(A<->C){all} 0.176202 0.021430 0.000654 0.464556 0.140049 58.55 60.28 1.006
r(A<->G){all} 0.202882 0.026774 0.000121 0.535247 0.160441 45.12 69.14 0.999
r(A<->T){all} 0.161634 0.021688 0.000276 0.469016 0.111189 97.42 115.31 0.999
r(C<->G){all} 0.157389 0.018910 0.000007 0.438624 0.118910 49.20 83.67 1.012
r(C<->T){all} 0.158624 0.020037 0.000010 0.438250 0.116774 39.89 43.64 1.001
r(G<->T){all} 0.143269 0.013524 0.000114 0.372520 0.116206 82.35 152.26 1.007
pi(A){all} 0.211751 0.000643 0.161923 0.263637 0.211150 576.90 647.15 1.001
pi(C){all} 0.290935 0.000785 0.239990 0.350081 0.290371 400.16 575.58 0.999
pi(G){all} 0.298183 0.000833 0.245797 0.354285 0.297871 544.10 619.35 0.999
pi(T){all} 0.199130 0.000563 0.155800 0.244781 0.198205 632.04 691.52 1.003
alpha{1,2} 0.402549 0.194935 0.000155 1.287097 0.242155 527.71 536.64 0.999
alpha{3} 0.444797 0.212011 0.000169 1.388870 0.297561 390.20 481.20 1.004
pinvar{all} 0.993818 0.000055 0.979147 0.999990 0.996152 570.53 588.65 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2035/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 87
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 2 2 2 2 2 2
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 4 4 4 4 4 4 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 1 1 1 1 1 1 | AAC 3 3 3 3 3 3 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 0 0 0 0 0 0 | GAC 3 3 3 3 3 3 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 4 4 4 4 4 4 | GCG 0 0 0 0 0 0 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908682_1_2168_MLBR_RS10295
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
#2: NC_002677_1_NP_302362_1_1234_ML2035
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
#3: NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
#4: NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
#5: NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
#6: NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 12
TTC 0 | TCC 6 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 6 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 12
CTC 6 | CCC 6 | CAC 12 | CGC 18
CTA 12 | CCA 24 | Gln Q CAA 0 | CGA 6
CTG 18 | CCG 12 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 6 | AAC 18 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 24 | Gly G GGT 6
GTC 12 | GCC 0 | GAC 18 | GGC 24
GTA 6 | GCA 18 | Glu E GAA 6 | GGA 0
GTG 24 | GCG 0 | GAG 30 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14943 C:0.34483 A:0.14943 G:0.35632
position 2: T:0.21839 C:0.24138 A:0.32184 G:0.21839
position 3: T:0.22989 C:0.28736 A:0.16092 G:0.32184
Average T:0.19923 C:0.29119 A:0.21073 G:0.29885
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -348.152804 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299808 1.300021
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908682_1_2168_MLBR_RS10295: 0.000004, NC_002677_1_NP_302362_1_1234_ML2035: 0.000004, NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955: 0.000004, NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345: 0.000004, NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135: 0.000004, NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29981
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 203.6 57.4 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 203.6 57.4 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 203.6 57.4 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 203.6 57.4 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 203.6 57.4 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 203.6 57.4 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -348.152806 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.241698 0.660013 0.081524
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908682_1_2168_MLBR_RS10295: 0.000004, NC_002677_1_NP_302362_1_1234_ML2035: 0.000004, NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955: 0.000004, NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345: 0.000004, NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135: 0.000004, NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24170
MLEs of dN/dS (w) for site classes (K=2)
p: 0.66001 0.33999
w: 0.08152 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 204.5 56.5 0.3938 0.0000 0.0000 0.0 0.0
7..2 0.000 204.5 56.5 0.3938 0.0000 0.0000 0.0 0.0
7..3 0.000 204.5 56.5 0.3938 0.0000 0.0000 0.0 0.0
7..4 0.000 204.5 56.5 0.3938 0.0000 0.0000 0.0 0.0
7..5 0.000 204.5 56.5 0.3938 0.0000 0.0000 0.0 0.0
7..6 0.000 204.5 56.5 0.3938 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -348.152797 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.901688 0.000001 7.784605
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908682_1_2168_MLBR_RS10295: 0.000004, NC_002677_1_NP_302362_1_1234_ML2035: 0.000004, NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955: 0.000004, NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345: 0.000004, NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135: 0.000004, NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.90169 0.09831
w: 0.00000 1.00000 7.78460
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.9 52.1 1.6670 0.0000 0.0000 0.0 0.0
7..2 0.000 208.9 52.1 1.6670 0.0000 0.0000 0.0 0.0
7..3 0.000 208.9 52.1 1.6670 0.0000 0.0000 0.0 0.0
7..4 0.000 208.9 52.1 1.6670 0.0000 0.0000 0.0 0.0
7..5 0.000 208.9 52.1 1.6670 0.0000 0.0000 0.0 0.0
7..6 0.000 208.9 52.1 1.6670 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908682_1_2168_MLBR_RS10295)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908682_1_2168_MLBR_RS10295)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -348.152798 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.090639 0.732583 0.000001 1.307412 2.192307
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908682_1_2168_MLBR_RS10295: 0.000004, NC_002677_1_NP_302362_1_1234_ML2035: 0.000004, NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955: 0.000004, NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345: 0.000004, NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135: 0.000004, NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.09064 0.73258 0.17678
w: 0.00000 1.30741 2.19231
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.9 52.1 1.3453 0.0000 0.0000 0.0 0.0
7..2 0.000 208.9 52.1 1.3453 0.0000 0.0000 0.0 0.0
7..3 0.000 208.9 52.1 1.3453 0.0000 0.0000 0.0 0.0
7..4 0.000 208.9 52.1 1.3453 0.0000 0.0000 0.0 0.0
7..5 0.000 208.9 52.1 1.3453 0.0000 0.0000 0.0 0.0
7..6 0.000 208.9 52.1 1.3453 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908682_1_2168_MLBR_RS10295)
Pr(w>1) post mean +- SE for w
1 V 0.909 1.345
2 R 0.909 1.345
3 D 0.909 1.345
4 V 0.909 1.345
5 I 0.909 1.345
6 L 0.909 1.345
7 E 0.909 1.345
8 G 0.909 1.345
9 G 0.909 1.345
10 L 0.909 1.345
11 Y 0.909 1.345
12 V 0.909 1.345
13 T 0.909 1.345
14 E 0.909 1.345
15 M 0.909 1.345
16 R 0.909 1.345
17 C 0.909 1.345
18 T 0.909 1.345
19 H 0.909 1.345
20 A 0.909 1.345
21 L 0.909 1.345
22 V 0.909 1.345
23 D 0.909 1.345
24 G 0.909 1.345
25 P 0.909 1.345
26 R 0.909 1.345
27 P 0.909 1.345
28 S 0.909 1.345
29 L 0.909 1.345
30 P 0.909 1.345
31 K 0.909 1.345
32 S 0.909 1.345
33 I 0.909 1.345
34 D 0.909 1.345
35 E 0.909 1.345
36 G 0.909 1.345
37 R 0.909 1.345
38 W 0.909 1.345
39 D 0.909 1.345
40 R 0.909 1.345
41 T 0.909 1.345
42 D 0.909 1.345
43 R 0.909 1.345
44 H 0.909 1.345
45 V 0.909 1.345
46 H 0.909 1.345
47 L 0.909 1.345
48 E 0.909 1.345
49 V 0.909 1.345
50 I 0.909 1.345
51 R 0.909 1.345
52 Q 0.909 1.345
53 E 0.909 1.345
54 P 0.909 1.345
55 N 0.909 1.345
56 N 0.909 1.345
57 G 0.909 1.345
58 L 0.909 1.345
59 V 0.909 1.345
60 D 0.909 1.345
61 P 0.909 1.345
62 A 0.909 1.345
63 A 0.909 1.345
64 A 0.909 1.345
65 S 0.909 1.345
66 S 0.909 1.345
67 K 0.909 1.345
68 P 0.909 1.345
69 D 0.909 1.345
70 W 0.909 1.345
71 N 0.909 1.345
72 P 0.909 1.345
73 C 0.909 1.345
74 S 0.909 1.345
75 L 0.909 1.345
76 Y 0.909 1.345
77 V 0.909 1.345
78 P 0.909 1.345
79 G 0.909 1.345
80 R 0.909 1.345
81 Q 0.909 1.345
82 Y 0.909 1.345
83 R 0.909 1.345
84 N 0.909 1.345
85 E 0.909 1.345
86 P 0.909 1.345
87 H 0.909 1.345
Note: more than one w>1. Check rst for details
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -348.152798 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.335593 0.005002
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908682_1_2168_MLBR_RS10295: 0.000004, NC_002677_1_NP_302362_1_1234_ML2035: 0.000004, NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955: 0.000004, NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345: 0.000004, NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135: 0.000004, NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 1.33559 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99998 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.9 52.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 208.9 52.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 208.9 52.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 208.9 52.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 208.9 52.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 208.9 52.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -348.152795 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 9.407299 0.005000 16.324125
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908682_1_2168_MLBR_RS10295: 0.000004, NC_002677_1_NP_302362_1_1234_ML2035: 0.000004, NZ_LVXE01000003_1_WP_010908682_1_1246_A3216_RS01955: 0.000004, NZ_LYPH01000033_1_WP_010908682_1_1326_A8144_RS06345: 0.000004, NZ_CP029543_1_WP_010908682_1_2188_DIJ64_RS11135: 0.000004, NZ_AP014567_1_WP_010908682_1_2249_JK2ML_RS11440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 9.40730 q = 0.00500
(p1 = 0.99999) w = 16.32413
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 16.32413
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 208.9 52.1 16.3240 0.0000 0.0000 0.0 0.0
7..2 0.000 208.9 52.1 16.3240 0.0000 0.0000 0.0 0.0
7..3 0.000 208.9 52.1 16.3240 0.0000 0.0000 0.0 0.0
7..4 0.000 208.9 52.1 16.3240 0.0000 0.0000 0.0 0.0
7..5 0.000 208.9 52.1 16.3240 0.0000 0.0000 0.0 0.0
7..6 0.000 208.9 52.1 16.3240 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908682_1_2168_MLBR_RS10295)
Pr(w>1) post mean +- SE for w
1 V 1.000** 16.324
2 R 1.000** 16.324
3 D 1.000** 16.324
4 V 1.000** 16.324
5 I 1.000** 16.324
6 L 1.000** 16.324
7 E 1.000** 16.324
8 G 1.000** 16.324
9 G 1.000** 16.324
10 L 1.000** 16.324
11 Y 1.000** 16.324
12 V 1.000** 16.324
13 T 1.000** 16.324
14 E 1.000** 16.324
15 M 1.000** 16.324
16 R 1.000** 16.324
17 C 1.000** 16.324
18 T 1.000** 16.324
19 H 1.000** 16.324
20 A 1.000** 16.324
21 L 1.000** 16.324
22 V 1.000** 16.324
23 D 1.000** 16.324
24 G 1.000** 16.324
25 P 1.000** 16.324
26 R 1.000** 16.324
27 P 1.000** 16.324
28 S 1.000** 16.324
29 L 1.000** 16.324
30 P 1.000** 16.324
31 K 1.000** 16.324
32 S 1.000** 16.324
33 I 1.000** 16.324
34 D 1.000** 16.324
35 E 1.000** 16.324
36 G 1.000** 16.324
37 R 1.000** 16.324
38 W 1.000** 16.324
39 D 1.000** 16.324
40 R 1.000** 16.324
41 T 1.000** 16.324
42 D 1.000** 16.324
43 R 1.000** 16.324
44 H 1.000** 16.324
45 V 1.000** 16.324
46 H 1.000** 16.324
47 L 1.000** 16.324
48 E 1.000** 16.324
49 V 1.000** 16.324
50 I 1.000** 16.324
51 R 1.000** 16.324
52 Q 1.000** 16.324
53 E 1.000** 16.324
54 P 1.000** 16.324
55 N 1.000** 16.324
56 N 1.000** 16.324
57 G 1.000** 16.324
58 L 1.000** 16.324
59 V 1.000** 16.324
60 D 1.000** 16.324
61 P 1.000** 16.324
62 A 1.000** 16.324
63 A 1.000** 16.324
64 A 1.000** 16.324
65 S 1.000** 16.324
66 S 1.000** 16.324
67 K 1.000** 16.324
68 P 1.000** 16.324
69 D 1.000** 16.324
70 W 1.000** 16.324
71 N 1.000** 16.324
72 P 1.000** 16.324
73 C 1.000** 16.324
74 S 1.000** 16.324
75 L 1.000** 16.324
76 Y 1.000** 16.324
77 V 1.000** 16.324
78 P 1.000** 16.324
79 G 1.000** 16.324
80 R 1.000** 16.324
81 Q 1.000** 16.324
82 Y 1.000** 16.324
83 R 1.000** 16.324
84 N 1.000** 16.324
85 E 1.000** 16.324
86 P 1.000** 16.324
87 H 1.000** 16.324
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908682_1_2168_MLBR_RS10295)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -348.152806 Model 2: PositiveSelection -348.152797 Model 0: one-ratio -348.152804 Model 3: discrete -348.152798 Model 7: beta -348.152798 Model 8: beta&w>1 -348.152795 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 1.799999995455437E-5 Model 8 vs 7 5.999999984851456E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
