--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:51:21 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2075/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1040.36 -1044.25
2 -1039.99 -1045.26
--------------------------------------
TOTAL -1040.15 -1044.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.867378 0.085904 0.345847 1.420957 0.828449 609.95 641.02 0.999
r(A<->C){all} 0.183516 0.024453 0.000457 0.488048 0.139534 125.40 142.54 1.009
r(A<->G){all} 0.198716 0.022710 0.000199 0.489660 0.162819 60.62 83.11 1.060
r(A<->T){all} 0.175851 0.021863 0.000011 0.469769 0.139719 93.68 154.01 1.010
r(C<->G){all} 0.114629 0.012792 0.000044 0.351432 0.078106 151.19 165.47 1.021
r(C<->T){all} 0.158335 0.020696 0.000028 0.448718 0.112089 105.90 114.73 1.000
r(G<->T){all} 0.168953 0.020769 0.000049 0.457586 0.128828 151.12 154.59 1.009
pi(A){all} 0.153523 0.000179 0.128252 0.179625 0.153268 557.89 593.35 0.999
pi(C){all} 0.293191 0.000297 0.257707 0.325088 0.293636 670.75 710.87 0.999
pi(G){all} 0.331321 0.000315 0.296237 0.366428 0.330976 596.61 622.21 1.000
pi(T){all} 0.221965 0.000250 0.194202 0.255379 0.221391 512.57 604.71 1.000
alpha{1,2} 0.344045 0.154305 0.000770 1.046784 0.226117 487.68 520.46 0.999
alpha{3} 0.352938 0.190226 0.000126 1.254449 0.173888 301.46 361.43 1.000
pinvar{all} 0.993102 0.000025 0.983685 0.999342 0.994246 541.86 555.09 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1018.404368
Model 2: PositiveSelection -1014.075929
Model 0: one-ratio -1017.43375
Model 3: discrete -1017.434933
Model 7: beta -1018.410002
Model 8: beta&w>1 -1017.251345
Model 0 vs 1 1.9412359999998898
Model 2 vs 1 8.656878000000006
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
40 G 1.000** 999.000
204 V 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
1 V 0.512 4.618 +- 4.045
2 S 0.513 4.626 +- 4.046
3 A 0.512 4.618 +- 4.045
4 P 0.512 4.621 +- 4.045
5 D 0.512 4.622 +- 4.045
6 S 0.513 4.623 +- 4.046
7 P 0.512 4.620 +- 4.045
8 A 0.513 4.627 +- 4.046
9 L 0.512 4.622 +- 4.045
10 V 0.512 4.620 +- 4.045
11 G 0.512 4.619 +- 4.045
12 M 0.512 4.619 +- 4.045
13 S 0.513 4.622 +- 4.045
14 I 0.513 4.625 +- 4.046
15 G 0.512 4.619 +- 4.045
16 A 0.512 4.618 +- 4.045
17 V 0.512 4.620 +- 4.045
18 L 0.513 4.623 +- 4.046
19 D 0.512 4.622 +- 4.045
20 L 0.512 4.622 +- 4.045
21 L 0.512 4.622 +- 4.045
22 R 0.513 4.623 +- 4.046
23 S 0.513 4.622 +- 4.045
24 D 0.512 4.622 +- 4.045
25 F 0.513 4.624 +- 4.046
26 P 0.513 4.625 +- 4.046
27 D 0.512 4.622 +- 4.045
28 V 0.512 4.618 +- 4.045
29 T 0.513 4.628 +- 4.046
30 I 0.512 4.621 +- 4.045
31 S 0.513 4.622 +- 4.045
32 K 0.513 4.623 +- 4.046
33 I 0.513 4.625 +- 4.046
34 R 0.513 4.626 +- 4.046
35 F 0.512 4.621 +- 4.045
36 L 0.512 4.622 +- 4.045
37 E 0.512 4.617 +- 4.045
38 A 0.513 4.624 +- 4.046
39 E 0.512 4.617 +- 4.045
40 G 0.882 7.510 +- 3.050
41 L 0.512 4.621 +- 4.045
42 V 0.512 4.618 +- 4.045
43 T 0.513 4.622 +- 4.045
44 P 0.513 4.625 +- 4.046
45 Q 0.512 4.621 +- 4.045
46 R 0.513 4.626 +- 4.046
47 S 0.513 4.626 +- 4.046
48 A 0.513 4.627 +- 4.046
49 S 0.513 4.622 +- 4.045
50 G 0.512 4.619 +- 4.045
51 Y 0.513 4.624 +- 4.046
52 R 0.513 4.622 +- 4.045
53 R 0.513 4.622 +- 4.045
54 F 0.512 4.621 +- 4.045
55 T 0.513 4.622 +- 4.045
56 A 0.512 4.618 +- 4.045
57 Y 0.513 4.627 +- 4.046
58 D 0.512 4.622 +- 4.045
59 C 0.513 4.626 +- 4.046
60 A 0.513 4.627 +- 4.046
61 R 0.513 4.622 +- 4.045
62 L 0.512 4.622 +- 4.045
63 R 0.513 4.622 +- 4.045
64 F 0.512 4.621 +- 4.045
65 I 0.512 4.621 +- 4.045
66 L 0.513 4.628 +- 4.046
67 T 0.513 4.626 +- 4.046
68 A 0.513 4.627 +- 4.046
69 Q 0.512 4.621 +- 4.045
70 R 0.513 4.623 +- 4.045
71 D 0.512 4.622 +- 4.045
72 H 0.512 4.621 +- 4.045
73 Y 0.513 4.627 +- 4.046
74 L 0.513 4.628 +- 4.046
75 P 0.512 4.620 +- 4.045
76 L 0.512 4.622 +- 4.045
77 K 0.513 4.623 +- 4.046
78 V 0.513 4.624 +- 4.046
79 I 0.513 4.625 +- 4.046
80 R 0.513 4.623 +- 4.046
81 A 0.512 4.618 +- 4.045
82 Q 0.512 4.621 +- 4.045
83 L 0.512 4.622 +- 4.045
84 D 0.512 4.618 +- 4.045
85 A 0.512 4.620 +- 4.045
86 Q 0.512 4.621 +- 4.045
87 P 0.513 4.625 +- 4.046
88 D 0.512 4.622 +- 4.045
89 G 0.513 4.625 +- 4.046
90 E 0.512 4.617 +- 4.045
91 L 0.513 4.628 +- 4.046
92 P 0.513 4.628 +- 4.046
93 S 0.513 4.629 +- 4.046
94 F 0.512 4.621 +- 4.045
95 G 0.512 4.619 +- 4.045
96 S 0.513 4.622 +- 4.045
97 P 0.513 4.625 +- 4.046
98 Y 0.513 4.627 +- 4.046
99 V 0.512 4.620 +- 4.045
100 A 0.513 4.627 +- 4.046
101 P 0.512 4.621 +- 4.045
102 R 0.513 4.629 +- 4.046
103 L 0.513 4.623 +- 4.046
104 F 0.513 4.624 +- 4.046
105 S 0.513 4.622 +- 4.045
106 V 0.512 4.618 +- 4.045
107 T 0.512 4.621 +- 4.045
108 G 0.512 4.620 +- 4.045
109 G 0.512 4.620 +- 4.045
110 P 0.512 4.620 +- 4.045
111 G 0.513 4.625 +- 4.046
112 A 0.512 4.620 +- 4.045
113 G 0.513 4.625 +- 4.046
114 V 0.512 4.620 +- 4.045
115 G 0.513 4.628 +- 4.046
116 S 0.513 4.622 +- 4.045
117 G 0.512 4.619 +- 4.045
118 V 0.512 4.620 +- 4.045
119 G 0.513 4.628 +- 4.046
120 S 0.513 4.622 +- 4.045
121 D 0.512 4.618 +- 4.045
122 I 0.512 4.621 +- 4.045
123 P 0.512 4.620 +- 4.045
124 A 0.512 4.618 +- 4.045
125 V 0.513 4.627 +- 4.046
126 S 0.513 4.622 +- 4.045
127 P 0.512 4.621 +- 4.045
128 A 0.512 4.620 +- 4.045
129 G 0.512 4.620 +- 4.045
130 V 0.512 4.620 +- 4.045
131 R 0.513 4.622 +- 4.045
132 L 0.512 4.622 +- 4.045
133 S 0.513 4.626 +- 4.046
134 R 0.513 4.629 +- 4.046
135 E 0.513 4.625 +- 4.046
136 D 0.512 4.618 +- 4.045
137 L 0.512 4.621 +- 4.045
138 L 0.513 4.623 +- 4.046
139 D 0.512 4.618 +- 4.045
140 R 0.513 4.623 +- 4.045
141 S 0.513 4.629 +- 4.046
142 G 0.513 4.628 +- 4.046
143 V 0.512 4.618 +- 4.045
144 A 0.513 4.627 +- 4.046
145 D 0.512 4.618 +- 4.045
146 D 0.512 4.618 +- 4.045
147 L 0.513 4.623 +- 4.046
148 L 0.513 4.623 +- 4.046
149 T 0.512 4.621 +- 4.045
150 A 0.512 4.618 +- 4.045
151 L 0.512 4.622 +- 4.045
152 L 0.512 4.621 +- 4.045
153 K 0.513 4.623 +- 4.046
154 A 0.512 4.620 +- 4.045
155 G 0.513 4.625 +- 4.046
156 V 0.512 4.618 +- 4.045
157 I 0.513 4.625 +- 4.046
158 T 0.513 4.622 +- 4.045
159 T 0.513 4.622 +- 4.045
160 G 0.512 4.619 +- 4.045
161 P 0.512 4.620 +- 4.045
162 G 0.512 4.620 +- 4.045
163 G 0.513 4.628 +- 4.046
164 F 0.513 4.624 +- 4.046
165 F 0.512 4.621 +- 4.045
166 D 0.512 4.622 +- 4.045
167 E 0.512 4.617 +- 4.045
168 H 0.513 4.624 +- 4.046
169 A 0.513 4.627 +- 4.046
170 I 0.512 4.621 +- 4.045
171 V 0.512 4.618 +- 4.045
172 I 0.512 4.621 +- 4.045
173 L 0.512 4.621 +- 4.045
174 Q 0.513 4.627 +- 4.046
175 C 0.513 4.623 +- 4.046
176 A 0.512 4.618 +- 4.045
177 R 0.513 4.622 +- 4.045
178 A 0.512 4.618 +- 4.045
179 L 0.512 4.622 +- 4.045
180 S 0.513 4.622 +- 4.045
181 E 0.512 4.617 +- 4.045
182 Y 0.513 4.624 +- 4.046
183 G 0.513 4.625 +- 4.046
184 V 0.513 4.624 +- 4.046
185 E 0.512 4.617 +- 4.045
186 P 0.512 4.620 +- 4.045
187 R 0.513 4.622 +- 4.045
188 H 0.513 4.624 +- 4.046
189 L 0.512 4.622 +- 4.045
190 R 0.513 4.629 +- 4.046
191 A 0.512 4.620 +- 4.045
192 F 0.512 4.621 +- 4.045
193 R 0.513 4.622 +- 4.045
194 S 0.513 4.629 +- 4.046
195 A 0.512 4.618 +- 4.045
196 A 0.513 4.624 +- 4.046
197 D 0.512 4.618 +- 4.045
198 R 0.513 4.623 +- 4.045
199 Q 0.512 4.621 +- 4.045
200 S 0.513 4.622 +- 4.045
201 D 0.512 4.618 +- 4.045
202 L 0.512 4.622 +- 4.045
203 I 0.512 4.621 +- 4.045
204 V 0.978* 8.201 +- 2.251
205 Q 0.513 4.627 +- 4.046
206 I 0.512 4.621 +- 4.045
207 A 0.512 4.620 +- 4.045
208 G 0.512 4.619 +- 4.045
209 P 0.512 4.620 +- 4.045
210 I 0.512 4.621 +- 4.045
211 V 0.512 4.620 +- 4.045
212 K 0.513 4.628 +- 4.046
213 A 0.512 4.620 +- 4.045
214 G 0.513 4.625 +- 4.046
215 K 0.513 4.623 +- 4.046
216 A 0.512 4.620 +- 4.045
217 G 0.513 4.625 +- 4.046
218 A 0.512 4.620 +- 4.045
219 R 0.513 4.626 +- 4.046
220 D 0.512 4.618 +- 4.045
221 R 0.513 4.623 +- 4.045
222 A 0.512 4.620 +- 4.045
223 D 0.512 4.618 +- 4.045
224 D 0.512 4.618 +- 4.045
225 L 0.513 4.623 +- 4.046
226 A 0.512 4.618 +- 4.045
227 R 0.513 4.626 +- 4.046
228 E 0.512 4.617 +- 4.045
229 V 0.513 4.624 +- 4.046
230 A 0.513 4.624 +- 4.046
231 A 0.512 4.618 +- 4.045
232 L 0.512 4.621 +- 4.045
233 A 0.512 4.620 +- 4.045
234 I 0.512 4.621 +- 4.045
235 T 0.513 4.626 +- 4.046
236 L 0.513 4.623 +- 4.046
237 H 0.512 4.621 +- 4.045
238 T 0.513 4.626 +- 4.046
239 S 0.513 4.622 +- 4.045
240 L 0.513 4.623 +- 4.046
241 I 0.512 4.621 +- 4.045
242 K 0.513 4.628 +- 4.046
243 S 0.513 4.626 +- 4.046
244 A 0.512 4.618 +- 4.045
245 V 0.513 4.624 +- 4.046
246 R 0.513 4.623 +- 4.045
247 G 0.512 4.620 +- 4.045
248 V 0.513 4.624 +- 4.046
249 L 0.513 4.628 +- 4.046
250 H 0.512 4.621 +- 4.045
251 R 0.513 4.623 +- 4.045
Model 8 vs 7 2.3173139999998966
>C1
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C2
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C3
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C4
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C5
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAERLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C6
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=251
C1 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C2 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C3 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C4 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C5 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAERLVTPQRSASG
C6 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
*************************************** **********
C1 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C2 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C3 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C4 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C5 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C6 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
**************************************************
C1 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C2 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C3 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C4 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C5 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C6 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
**************************************************
C1 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C2 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C3 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C4 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C5 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C6 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
**************************************************
C1 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C2 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C3 DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C4 DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C5 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C6 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
***.**********************************************
C1 R
C2 R
C3 R
C4 R
C5 R
C6 R
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7530]--->[7530]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.489 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C2 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C3 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C4 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
C5 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAERLVTPQRSASG
C6 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
*************************************** **********
C1 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C2 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C3 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C4 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C5 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
C6 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
**************************************************
C1 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C2 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C3 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C4 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C5 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
C6 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
**************************************************
C1 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C2 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C3 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C4 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C5 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
C6 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
**************************************************
C1 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C2 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C3 DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C4 DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C5 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
C6 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
***.**********************************************
C1 R
C2 R
C3 R
C4 R
C5 R
C6 R
*
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.60 C1 C3 99.60
TOP 2 0 99.60 C3 C1 99.60
BOT 0 3 99.60 C1 C4 99.60
TOP 3 0 99.60 C4 C1 99.60
BOT 0 4 99.60 C1 C5 99.60
TOP 4 0 99.60 C5 C1 99.60
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.60 C2 C3 99.60
TOP 2 1 99.60 C3 C2 99.60
BOT 1 3 99.60 C2 C4 99.60
TOP 3 1 99.60 C4 C2 99.60
BOT 1 4 99.60 C2 C5 99.60
TOP 4 1 99.60 C5 C2 99.60
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.20 C3 C5 99.20
TOP 4 2 99.20 C5 C3 99.20
BOT 2 5 99.60 C3 C6 99.60
TOP 5 2 99.60 C6 C3 99.60
BOT 3 4 99.20 C4 C5 99.20
TOP 4 3 99.20 C5 C4 99.20
BOT 3 5 99.60 C4 C6 99.60
TOP 5 3 99.60 C6 C4 99.60
BOT 4 5 99.60 C5 C6 99.60
TOP 5 4 99.60 C6 C5 99.60
AVG 0 C1 * 99.76
AVG 1 C2 * 99.76
AVG 2 C3 * 99.60
AVG 3 C4 * 99.60
AVG 4 C5 * 99.44
AVG 5 C6 * 99.76
TOT TOT * 99.65
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
C2 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
C3 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
C4 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
C5 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
C6 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
**************************************************
C1 CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
C2 CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
C3 CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
C4 CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
C5 CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
C6 CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
**************************************************
C1 GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
C2 GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
C3 GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
C4 GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
C5 GTTTCCTGGAGGCTGAGAGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
C6 GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
*****************.********************************
C1 TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
C2 TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
C3 TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
C4 TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
C5 TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
C6 TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
**************************************************
C1 TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
C2 TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
C3 TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
C4 TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
C5 TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
C6 TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
**************************************************
C1 ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
C2 ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
C3 ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
C4 ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
C5 ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
C6 ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
**************************************************
C1 CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
C2 CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
C3 CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
C4 CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
C5 CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
C6 CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
**************************************************
C1 GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
C2 GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
C3 GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
C4 GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
C5 GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
C6 GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
**************************************************
C1 GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
C2 GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
C3 GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
C4 GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
C5 GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
C6 GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
**************************************************
C1 CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
C2 CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
C3 CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
C4 CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
C5 CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
C6 CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
**************************************************
C1 GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
C2 GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
C3 GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
C4 GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
C5 GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
C6 GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
**************************************************
C1 TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
C2 TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
C3 TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
C4 TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
C5 TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
C6 TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
**************************************************
C1 GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
C2 GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
C3 GACCTGATCTTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
C4 GACCTGATCTTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
C5 GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
C6 GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
********* ****************************************
C1 TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
C2 TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
C3 TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
C4 TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
C5 TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
C6 TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
**************************************************
C1 TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
C2 TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
C3 TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
C4 TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
C5 TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
C6 TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
**************************************************
C1 CGC
C2 CGC
C3 CGC
C4 CGC
C5 CGC
C6 CGC
***
>C1
GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
CGC
>C2
GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
CGC
>C3
GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
GACCTGATCTTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
CGC
>C4
GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
GACCTGATCTTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
CGC
>C5
GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
GTTTCCTGGAGGCTGAGAGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
CGC
>C6
GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT
CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC
GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG
TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC
TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG
ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA
CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG
GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC
GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG
CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA
GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG
TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC
GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG
TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA
TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC
CGC
>C1
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C2
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C3
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C4
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C5
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAERLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
>C6
VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
R
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 753 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855795
Setting output file names to "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 161570079
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5807435921
Seed = 436136080
Swapseed = 1579855795
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1695.323453 -- -24.965149
Chain 2 -- -1694.686607 -- -24.965149
Chain 3 -- -1695.324732 -- -24.965149
Chain 4 -- -1695.358377 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1694.685057 -- -24.965149
Chain 2 -- -1692.018593 -- -24.965149
Chain 3 -- -1695.358475 -- -24.965149
Chain 4 -- -1695.323453 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-1695.323] (-1694.687) (-1695.325) (-1695.358) * [-1694.685] (-1692.019) (-1695.358) (-1695.323)
500 -- (-1058.810) [-1042.881] (-1048.841) (-1057.892) * (-1038.666) [-1039.637] (-1039.219) (-1053.063) -- 0:16:39
1000 -- (-1054.864) [-1044.458] (-1045.297) (-1050.404) * [-1047.118] (-1043.718) (-1045.812) (-1047.405) -- 0:08:19
1500 -- (-1050.503) [-1039.177] (-1044.502) (-1053.611) * (-1043.379) (-1048.672) [-1041.441] (-1040.324) -- 0:05:32
2000 -- (-1048.315) (-1044.818) [-1043.303] (-1052.164) * (-1044.456) [-1040.703] (-1039.019) (-1036.338) -- 0:04:09
2500 -- (-1049.160) (-1042.141) (-1040.227) [-1046.547] * (-1042.338) (-1041.869) [-1036.548] (-1038.920) -- 0:03:19
3000 -- (-1037.829) (-1053.792) [-1042.595] (-1044.609) * (-1043.592) [-1040.129] (-1040.857) (-1042.456) -- 0:02:45
3500 -- [-1045.668] (-1038.799) (-1037.965) (-1043.183) * (-1046.995) (-1040.031) [-1037.336] (-1045.300) -- 0:02:21
4000 -- (-1045.379) [-1045.057] (-1039.878) (-1053.060) * (-1041.545) [-1039.036] (-1041.204) (-1038.944) -- 0:02:04
4500 -- (-1045.869) [-1044.229] (-1042.640) (-1048.815) * (-1038.728) (-1046.561) (-1042.900) [-1048.468] -- 0:01:50
5000 -- (-1047.853) (-1041.613) [-1043.152] (-1042.167) * [-1043.617] (-1042.963) (-1042.994) (-1052.290) -- 0:01:39
Average standard deviation of split frequencies: 0.099995
5500 -- (-1038.920) (-1042.959) (-1054.268) [-1038.229] * (-1042.313) (-1052.177) [-1037.084] (-1041.840) -- 0:01:29
6000 -- (-1047.172) (-1054.414) [-1043.409] (-1042.484) * (-1043.633) (-1047.628) (-1039.814) [-1037.778] -- 0:01:22
6500 -- (-1051.251) (-1052.467) [-1040.542] (-1042.056) * (-1041.690) [-1043.458] (-1054.528) (-1037.831) -- 0:01:15
7000 -- (-1042.199) [-1037.860] (-1047.452) (-1046.021) * [-1050.745] (-1039.606) (-1042.266) (-1047.243) -- 0:01:10
7500 -- (-1047.071) (-1044.080) [-1047.346] (-1040.660) * (-1041.729) (-1052.473) [-1041.439] (-1041.933) -- 0:01:05
8000 -- (-1045.622) [-1040.414] (-1044.172) (-1043.355) * (-1043.704) (-1048.354) [-1038.314] (-1043.531) -- 0:01:01
8500 -- (-1050.703) (-1041.895) (-1042.272) [-1041.041] * (-1041.092) (-1040.568) [-1043.580] (-1051.588) -- 0:00:57
9000 -- [-1048.165] (-1041.277) (-1058.633) (-1039.768) * (-1040.771) (-1044.116) [-1038.441] (-1044.544) -- 0:00:54
9500 -- (-1050.150) (-1040.133) (-1047.001) [-1044.381] * (-1041.079) (-1043.774) [-1042.586] (-1058.525) -- 0:00:51
10000 -- (-1050.022) (-1042.780) [-1038.353] (-1042.223) * (-1045.671) [-1051.054] (-1049.320) (-1040.399) -- 0:00:49
Average standard deviation of split frequencies: 0.072318
10500 -- (-1054.053) (-1044.664) (-1037.715) [-1038.940] * [-1046.582] (-1042.382) (-1043.005) (-1042.564) -- 0:00:46
11000 -- [-1039.399] (-1041.156) (-1040.864) (-1042.328) * (-1042.065) [-1040.253] (-1037.885) (-1042.162) -- 0:00:44
11500 -- (-1047.087) (-1040.701) (-1040.960) [-1043.350] * (-1042.766) (-1045.779) (-1042.651) [-1036.224] -- 0:00:42
12000 -- [-1039.826] (-1041.018) (-1038.476) (-1046.456) * (-1042.670) (-1039.416) (-1039.957) [-1043.986] -- 0:00:40
12500 -- (-1043.977) [-1041.974] (-1045.237) (-1049.238) * (-1041.918) (-1042.116) [-1041.098] (-1038.965) -- 0:00:39
13000 -- [-1040.885] (-1043.787) (-1042.484) (-1037.331) * (-1044.195) (-1048.464) [-1047.137] (-1040.924) -- 0:00:37
13500 -- [-1049.422] (-1039.921) (-1042.554) (-1042.042) * (-1042.166) [-1042.897] (-1043.950) (-1040.718) -- 0:00:36
14000 -- [-1045.366] (-1040.251) (-1045.169) (-1041.268) * (-1040.285) (-1045.370) [-1040.037] (-1039.263) -- 0:01:09
14500 -- (-1042.378) (-1040.742) [-1039.275] (-1044.417) * (-1040.370) (-1058.818) [-1044.285] (-1046.545) -- 0:01:06
15000 -- (-1048.317) (-1041.536) [-1044.117] (-1045.629) * (-1045.005) (-1045.866) [-1041.067] (-1042.582) -- 0:01:04
Average standard deviation of split frequencies: 0.029463
15500 -- [-1039.004] (-1043.333) (-1038.148) (-1042.214) * (-1049.129) (-1048.627) [-1042.635] (-1040.503) -- 0:01:02
16000 -- (-1040.191) (-1042.326) [-1043.352] (-1046.912) * (-1050.560) (-1040.167) [-1038.598] (-1039.586) -- 0:01:00
16500 -- (-1045.442) (-1042.027) (-1048.784) [-1043.325] * (-1044.921) [-1040.883] (-1044.831) (-1038.978) -- 0:00:58
17000 -- [-1037.561] (-1041.215) (-1042.386) (-1043.467) * (-1040.978) (-1042.082) [-1037.296] (-1039.313) -- 0:00:56
17500 -- (-1045.040) (-1045.236) (-1042.509) [-1040.451] * (-1039.341) (-1060.720) [-1039.053] (-1040.831) -- 0:00:55
18000 -- (-1046.545) (-1040.705) [-1045.358] (-1045.706) * (-1041.363) (-1054.445) [-1043.711] (-1042.167) -- 0:00:53
18500 -- [-1037.911] (-1047.251) (-1041.627) (-1042.372) * (-1040.236) (-1044.395) (-1040.331) [-1044.710] -- 0:00:52
19000 -- [-1044.654] (-1040.589) (-1047.661) (-1049.182) * [-1039.150] (-1045.749) (-1038.592) (-1040.980) -- 0:00:50
19500 -- (-1044.245) (-1041.603) (-1040.167) [-1041.365] * (-1045.435) (-1043.640) (-1045.841) [-1043.179] -- 0:00:49
20000 -- [-1040.032] (-1041.338) (-1049.392) (-1048.126) * (-1042.379) (-1043.584) [-1041.514] (-1040.525) -- 0:00:48
Average standard deviation of split frequencies: 0.041473
20500 -- (-1046.753) (-1041.669) [-1042.426] (-1038.492) * [-1041.811] (-1043.348) (-1046.302) (-1042.547) -- 0:00:46
21000 -- (-1042.740) (-1043.102) [-1040.629] (-1048.869) * (-1039.311) (-1041.676) (-1036.486) [-1041.936] -- 0:00:45
21500 -- (-1046.858) [-1043.663] (-1037.624) (-1040.148) * (-1041.069) (-1041.582) [-1044.000] (-1042.524) -- 0:00:44
22000 -- (-1040.890) (-1044.732) [-1038.964] (-1037.879) * (-1041.890) (-1041.424) (-1044.772) [-1041.997] -- 0:00:43
22500 -- [-1047.181] (-1040.871) (-1046.376) (-1040.654) * (-1045.628) (-1040.599) [-1044.304] (-1040.291) -- 0:00:42
23000 -- (-1044.007) (-1040.749) (-1040.188) [-1041.620] * (-1040.303) (-1045.337) (-1042.912) [-1043.100] -- 0:00:41
23500 -- [-1048.537] (-1040.671) (-1046.079) (-1045.029) * [-1041.746] (-1043.782) (-1042.963) (-1044.792) -- 0:00:40
24000 -- (-1044.075) (-1042.915) [-1039.460] (-1043.494) * (-1045.838) (-1039.406) [-1045.601] (-1043.164) -- 0:00:39
24500 -- (-1046.837) (-1042.435) [-1043.667] (-1062.537) * (-1043.342) (-1042.323) [-1041.260] (-1041.977) -- 0:00:38
25000 -- (-1040.252) [-1044.971] (-1043.213) (-1038.451) * (-1041.281) [-1042.726] (-1036.088) (-1042.448) -- 0:00:38
Average standard deviation of split frequencies: 0.060436
25500 -- (-1042.061) [-1039.906] (-1039.633) (-1040.158) * (-1042.235) (-1041.939) [-1051.541] (-1043.685) -- 0:00:37
26000 -- [-1043.460] (-1044.926) (-1040.915) (-1041.619) * (-1042.737) [-1042.259] (-1039.945) (-1039.232) -- 0:00:36
26500 -- (-1046.271) (-1042.702) [-1037.513] (-1038.792) * (-1042.281) (-1040.034) (-1043.578) [-1042.291] -- 0:00:35
27000 -- (-1048.788) (-1040.844) [-1040.685] (-1039.087) * (-1041.841) (-1042.855) [-1039.874] (-1042.961) -- 0:00:35
27500 -- (-1041.125) (-1040.582) [-1042.056] (-1041.595) * [-1040.911] (-1042.565) (-1049.897) (-1043.241) -- 0:00:34
28000 -- (-1043.727) (-1039.381) [-1035.731] (-1042.259) * (-1044.918) [-1040.603] (-1043.120) (-1043.155) -- 0:00:33
28500 -- (-1052.583) (-1042.124) [-1040.705] (-1041.888) * (-1044.798) (-1042.966) [-1043.386] (-1044.487) -- 0:00:49
29000 -- (-1043.876) (-1041.739) [-1041.129] (-1042.756) * (-1041.847) (-1041.124) [-1042.357] (-1041.651) -- 0:00:48
29500 -- (-1049.840) (-1039.958) (-1046.116) [-1042.876] * [-1041.621] (-1042.900) (-1043.993) (-1042.820) -- 0:00:47
30000 -- (-1046.666) (-1040.432) (-1041.064) [-1041.118] * (-1040.541) (-1040.039) (-1043.844) [-1041.839] -- 0:00:47
Average standard deviation of split frequencies: 0.055898
30500 -- (-1042.283) (-1043.130) [-1040.612] (-1042.624) * [-1038.957] (-1041.878) (-1040.060) (-1041.150) -- 0:00:46
31000 -- (-1042.470) [-1043.766] (-1044.816) (-1040.100) * (-1041.310) (-1039.098) [-1041.108] (-1041.452) -- 0:00:45
31500 -- (-1042.685) [-1041.085] (-1043.284) (-1043.112) * (-1040.583) (-1041.609) (-1041.143) [-1041.325] -- 0:00:44
32000 -- [-1040.922] (-1043.164) (-1040.955) (-1042.270) * (-1040.708) [-1037.827] (-1043.145) (-1044.112) -- 0:00:43
32500 -- (-1040.870) (-1042.292) (-1041.211) [-1041.032] * (-1041.472) (-1039.300) (-1040.191) [-1040.195] -- 0:00:43
33000 -- (-1040.819) [-1040.941] (-1042.923) (-1044.701) * (-1043.479) (-1041.615) (-1040.793) [-1043.123] -- 0:00:42
33500 -- (-1041.334) (-1040.075) (-1040.719) [-1038.576] * (-1041.297) (-1043.538) (-1039.208) [-1042.825] -- 0:00:41
34000 -- (-1037.947) [-1040.594] (-1043.007) (-1040.527) * [-1041.914] (-1039.331) (-1042.441) (-1042.820) -- 0:00:41
34500 -- [-1039.924] (-1039.884) (-1040.841) (-1039.258) * (-1042.669) [-1041.499] (-1040.854) (-1041.102) -- 0:00:40
35000 -- [-1039.616] (-1040.441) (-1043.584) (-1039.530) * (-1045.027) (-1041.666) (-1042.052) [-1040.906] -- 0:00:39
Average standard deviation of split frequencies: 0.051287
35500 -- (-1043.851) [-1042.042] (-1041.886) (-1040.654) * [-1039.521] (-1041.345) (-1044.918) (-1041.326) -- 0:00:39
36000 -- (-1044.770) (-1044.298) (-1041.436) [-1039.447] * [-1040.509] (-1043.484) (-1041.003) (-1039.727) -- 0:00:38
36500 -- (-1041.047) [-1043.504] (-1043.189) (-1037.486) * [-1041.918] (-1045.912) (-1045.063) (-1042.275) -- 0:00:38
37000 -- (-1042.726) [-1042.557] (-1044.855) (-1039.347) * (-1039.571) (-1038.391) [-1040.987] (-1040.278) -- 0:00:37
37500 -- (-1041.560) (-1048.450) [-1044.295] (-1039.759) * (-1044.637) (-1041.704) [-1040.054] (-1041.208) -- 0:00:37
38000 -- (-1036.861) (-1043.224) [-1041.362] (-1040.025) * [-1041.315] (-1044.206) (-1040.105) (-1042.935) -- 0:00:36
38500 -- (-1041.816) (-1041.138) [-1036.802] (-1038.119) * (-1042.721) (-1041.973) [-1040.331] (-1043.346) -- 0:00:35
39000 -- (-1042.003) [-1045.937] (-1041.025) (-1040.991) * (-1042.606) (-1043.226) [-1039.885] (-1042.975) -- 0:00:35
39500 -- [-1042.398] (-1043.276) (-1049.150) (-1040.223) * (-1042.818) (-1043.907) (-1043.932) [-1043.359] -- 0:00:34
40000 -- (-1044.735) (-1042.474) [-1044.066] (-1040.914) * (-1042.326) (-1045.491) (-1041.619) [-1041.192] -- 0:00:34
Average standard deviation of split frequencies: 0.047196
40500 -- (-1042.390) (-1042.740) [-1040.410] (-1040.990) * (-1043.005) (-1045.458) (-1043.112) [-1041.247] -- 0:00:34
41000 -- [-1044.149] (-1041.257) (-1040.720) (-1042.363) * [-1041.637] (-1040.539) (-1041.865) (-1039.488) -- 0:00:33
41500 -- [-1041.944] (-1043.569) (-1041.659) (-1040.760) * (-1042.719) [-1041.880] (-1041.513) (-1040.495) -- 0:00:33
42000 -- (-1043.438) (-1042.091) [-1041.037] (-1043.152) * (-1041.915) (-1043.320) (-1041.488) [-1042.979] -- 0:00:32
42500 -- (-1047.060) (-1042.910) [-1040.726] (-1040.837) * (-1040.766) (-1044.064) [-1041.579] (-1043.193) -- 0:00:32
43000 -- [-1039.705] (-1042.292) (-1039.353) (-1043.093) * (-1043.124) (-1044.213) [-1041.122] (-1040.843) -- 0:00:31
43500 -- (-1041.693) [-1041.500] (-1039.849) (-1038.292) * (-1042.861) [-1040.515] (-1040.368) (-1046.226) -- 0:00:41
44000 -- (-1040.687) [-1039.953] (-1043.265) (-1040.693) * [-1041.633] (-1042.454) (-1043.160) (-1043.484) -- 0:00:41
44500 -- (-1041.154) [-1040.159] (-1043.463) (-1039.870) * [-1043.845] (-1041.687) (-1041.467) (-1043.727) -- 0:00:40
45000 -- (-1042.485) [-1043.758] (-1042.489) (-1042.171) * [-1041.105] (-1040.828) (-1040.117) (-1043.842) -- 0:00:40
Average standard deviation of split frequencies: 0.041675
45500 -- (-1043.269) (-1040.441) [-1044.304] (-1041.661) * (-1042.360) (-1043.991) [-1040.358] (-1040.865) -- 0:00:39
46000 -- (-1040.284) (-1041.030) [-1040.369] (-1040.367) * (-1041.724) [-1042.291] (-1045.899) (-1042.752) -- 0:00:39
46500 -- (-1042.189) (-1041.803) [-1039.032] (-1039.974) * (-1040.615) (-1040.080) [-1041.782] (-1041.860) -- 0:00:39
47000 -- (-1041.747) (-1040.704) [-1040.664] (-1041.021) * (-1044.942) (-1041.171) [-1043.552] (-1043.360) -- 0:00:38
47500 -- (-1041.649) (-1041.290) (-1043.393) [-1038.611] * (-1041.889) [-1041.657] (-1039.523) (-1041.229) -- 0:00:38
48000 -- (-1044.592) (-1041.433) [-1041.128] (-1040.700) * (-1041.857) (-1042.299) (-1041.007) [-1046.673] -- 0:00:37
48500 -- (-1042.006) (-1041.840) [-1043.825] (-1038.736) * (-1041.548) (-1049.505) [-1039.707] (-1041.113) -- 0:00:37
49000 -- (-1041.179) (-1045.182) [-1043.393] (-1040.228) * [-1041.474] (-1042.251) (-1042.397) (-1040.584) -- 0:00:36
49500 -- (-1039.744) (-1043.156) [-1039.197] (-1041.838) * (-1040.984) (-1042.259) (-1041.119) [-1043.164] -- 0:00:36
50000 -- [-1041.820] (-1039.780) (-1039.552) (-1039.368) * (-1043.132) (-1042.036) (-1042.736) [-1038.770] -- 0:00:36
Average standard deviation of split frequencies: 0.040317
50500 -- [-1041.914] (-1041.859) (-1041.659) (-1043.084) * [-1042.758] (-1041.004) (-1039.069) (-1041.186) -- 0:00:35
51000 -- (-1043.669) (-1040.701) (-1041.512) [-1039.633] * [-1040.335] (-1041.197) (-1040.035) (-1041.612) -- 0:00:35
51500 -- (-1041.745) (-1037.882) [-1040.777] (-1040.262) * (-1043.617) (-1043.543) (-1039.616) [-1039.262] -- 0:00:34
52000 -- (-1041.159) (-1038.873) [-1041.268] (-1041.443) * (-1040.179) (-1042.332) [-1040.297] (-1040.874) -- 0:00:34
52500 -- (-1039.801) (-1042.403) [-1039.367] (-1042.537) * (-1039.482) (-1043.495) (-1038.559) [-1040.830] -- 0:00:34
53000 -- [-1041.584] (-1040.122) (-1040.696) (-1044.662) * [-1041.742] (-1043.665) (-1043.661) (-1040.566) -- 0:00:33
53500 -- [-1037.214] (-1038.978) (-1041.402) (-1044.772) * (-1044.058) (-1043.241) [-1041.404] (-1041.152) -- 0:00:33
54000 -- (-1040.913) (-1049.903) [-1039.796] (-1042.554) * [-1042.450] (-1044.283) (-1042.018) (-1042.769) -- 0:00:33
54500 -- (-1042.887) (-1039.770) (-1042.212) [-1042.199] * [-1040.874] (-1046.334) (-1042.446) (-1043.120) -- 0:00:32
55000 -- (-1041.990) (-1042.702) (-1042.705) [-1042.945] * (-1041.110) (-1045.244) (-1040.129) [-1039.164] -- 0:00:32
Average standard deviation of split frequencies: 0.037039
55500 -- (-1039.881) (-1042.010) (-1041.300) [-1040.812] * (-1039.871) (-1043.563) (-1041.522) [-1040.254] -- 0:00:32
56000 -- (-1041.239) (-1041.539) (-1045.030) [-1045.419] * (-1042.090) (-1040.278) (-1041.479) [-1039.484] -- 0:00:31
56500 -- (-1044.402) (-1046.858) (-1040.352) [-1037.792] * (-1042.279) [-1042.093] (-1041.840) (-1039.336) -- 0:00:31
57000 -- (-1045.341) (-1041.734) [-1038.445] (-1040.803) * (-1041.645) (-1045.129) (-1044.557) [-1040.279] -- 0:00:31
57500 -- (-1042.909) (-1041.692) [-1042.263] (-1040.980) * (-1040.315) (-1043.640) (-1041.829) [-1038.956] -- 0:00:30
58000 -- (-1042.294) [-1040.400] (-1042.019) (-1041.423) * [-1040.050] (-1042.350) (-1045.508) (-1046.410) -- 0:00:38
58500 -- (-1044.978) (-1041.104) [-1041.231] (-1040.124) * (-1040.326) (-1044.210) (-1045.636) [-1045.985] -- 0:00:37
59000 -- (-1044.631) (-1042.170) [-1040.514] (-1038.324) * (-1041.779) (-1041.774) (-1045.064) [-1043.097] -- 0:00:37
59500 -- (-1044.674) (-1043.691) (-1042.753) [-1039.273] * [-1040.741] (-1041.663) (-1039.910) (-1039.903) -- 0:00:37
60000 -- (-1041.692) (-1044.178) (-1040.749) [-1039.708] * (-1042.625) (-1038.198) (-1044.423) [-1043.269] -- 0:00:36
Average standard deviation of split frequencies: 0.033857
60500 -- (-1043.211) (-1043.460) (-1039.817) [-1044.867] * (-1039.621) (-1040.780) [-1044.110] (-1041.552) -- 0:00:36
61000 -- [-1041.720] (-1041.683) (-1040.206) (-1044.742) * [-1040.854] (-1042.160) (-1041.213) (-1046.651) -- 0:00:35
61500 -- (-1042.638) (-1041.397) (-1040.579) [-1047.605] * (-1039.871) (-1042.626) [-1039.925] (-1044.381) -- 0:00:35
62000 -- [-1041.618] (-1042.257) (-1039.607) (-1042.451) * (-1046.734) (-1043.269) (-1039.400) [-1042.078] -- 0:00:35
62500 -- (-1042.694) (-1041.229) [-1043.082] (-1043.112) * [-1042.327] (-1041.923) (-1042.638) (-1046.997) -- 0:00:35
63000 -- [-1043.643] (-1041.429) (-1039.567) (-1042.931) * [-1041.220] (-1045.656) (-1041.579) (-1044.306) -- 0:00:34
63500 -- [-1040.205] (-1042.946) (-1043.895) (-1043.497) * (-1040.483) (-1042.215) [-1039.408] (-1042.611) -- 0:00:34
64000 -- (-1042.164) [-1041.444] (-1042.232) (-1041.035) * [-1043.384] (-1046.411) (-1040.892) (-1041.216) -- 0:00:34
64500 -- (-1042.190) (-1044.149) (-1043.022) [-1039.093] * (-1041.624) (-1043.432) (-1038.608) [-1042.165] -- 0:00:33
65000 -- [-1042.563] (-1041.257) (-1043.313) (-1044.144) * [-1040.569] (-1044.352) (-1039.938) (-1049.604) -- 0:00:33
Average standard deviation of split frequencies: 0.031427
65500 -- (-1045.782) (-1041.793) (-1042.391) [-1039.790] * (-1046.462) (-1047.742) [-1040.870] (-1040.754) -- 0:00:33
66000 -- [-1044.475] (-1043.622) (-1045.212) (-1039.806) * (-1040.974) [-1043.874] (-1041.481) (-1040.194) -- 0:00:32
66500 -- (-1041.149) [-1040.437] (-1043.054) (-1040.731) * (-1039.827) (-1042.743) (-1044.333) [-1041.635] -- 0:00:32
67000 -- (-1040.778) (-1041.313) (-1040.344) [-1040.286] * [-1039.155] (-1041.313) (-1040.003) (-1044.353) -- 0:00:32
67500 -- (-1041.677) (-1041.030) [-1042.213] (-1044.507) * (-1040.992) (-1044.469) [-1039.281] (-1043.562) -- 0:00:32
68000 -- (-1041.558) (-1041.651) [-1041.484] (-1046.472) * (-1043.102) (-1043.038) (-1041.175) [-1042.427] -- 0:00:31
68500 -- (-1042.905) (-1041.283) [-1039.853] (-1044.773) * (-1045.142) (-1042.248) [-1041.326] (-1042.625) -- 0:00:31
69000 -- (-1047.640) (-1038.748) [-1041.079] (-1043.773) * (-1040.282) (-1042.158) [-1041.951] (-1042.855) -- 0:00:31
69500 -- [-1048.387] (-1040.310) (-1043.349) (-1045.257) * (-1041.732) (-1044.220) [-1039.104] (-1042.780) -- 0:00:30
70000 -- (-1046.182) [-1040.243] (-1041.981) (-1042.283) * (-1040.241) [-1040.577] (-1042.099) (-1040.951) -- 0:00:30
Average standard deviation of split frequencies: 0.028462
70500 -- [-1046.865] (-1042.911) (-1042.055) (-1042.720) * (-1043.017) (-1041.068) [-1038.674] (-1046.674) -- 0:00:30
71000 -- (-1044.803) (-1041.931) (-1038.977) [-1039.230] * (-1040.496) (-1041.014) [-1039.527] (-1043.008) -- 0:00:30
71500 -- (-1045.265) (-1041.402) (-1041.990) [-1040.183] * (-1038.710) (-1041.018) [-1041.101] (-1043.959) -- 0:00:29
72000 -- (-1045.244) (-1042.737) [-1040.804] (-1037.929) * [-1041.102] (-1043.031) (-1041.217) (-1040.619) -- 0:00:29
72500 -- (-1044.870) (-1041.652) (-1042.831) [-1038.812] * [-1038.161] (-1045.061) (-1040.355) (-1041.880) -- 0:00:29
73000 -- (-1043.446) (-1042.360) (-1040.951) [-1044.709] * (-1041.265) [-1040.607] (-1042.500) (-1044.676) -- 0:00:35
73500 -- (-1042.078) [-1041.608] (-1043.023) (-1039.912) * [-1039.885] (-1040.487) (-1042.141) (-1043.476) -- 0:00:34
74000 -- (-1042.842) [-1038.981] (-1045.878) (-1043.774) * (-1043.109) [-1040.706] (-1042.252) (-1042.542) -- 0:00:34
74500 -- (-1043.837) (-1042.541) [-1045.635] (-1041.617) * [-1044.071] (-1047.051) (-1041.651) (-1040.377) -- 0:00:34
75000 -- (-1044.536) (-1041.948) (-1041.467) [-1039.157] * (-1039.111) (-1041.623) [-1041.388] (-1039.883) -- 0:00:34
Average standard deviation of split frequencies: 0.025638
75500 -- (-1046.000) (-1041.618) [-1041.060] (-1037.708) * [-1038.092] (-1043.914) (-1044.468) (-1039.339) -- 0:00:33
76000 -- (-1046.236) (-1042.854) [-1039.449] (-1042.701) * [-1040.015] (-1042.395) (-1042.714) (-1041.280) -- 0:00:33
76500 -- (-1042.792) (-1041.958) (-1039.788) [-1041.737] * (-1040.982) (-1039.587) (-1043.841) [-1040.949] -- 0:00:33
77000 -- [-1042.470] (-1039.006) (-1043.217) (-1042.464) * [-1041.363] (-1040.467) (-1043.137) (-1046.337) -- 0:00:32
77500 -- (-1044.148) (-1039.186) [-1040.413] (-1042.464) * (-1043.827) (-1041.413) (-1042.366) [-1043.665] -- 0:00:32
78000 -- (-1043.737) (-1040.814) (-1039.731) [-1039.449] * [-1042.900] (-1044.215) (-1044.843) (-1043.031) -- 0:00:32
78500 -- (-1041.588) (-1040.689) [-1039.895] (-1041.563) * [-1040.304] (-1042.615) (-1041.154) (-1040.329) -- 0:00:32
79000 -- (-1043.130) (-1044.087) (-1041.287) [-1039.299] * (-1042.367) (-1038.499) [-1044.106] (-1041.910) -- 0:00:31
79500 -- (-1040.932) (-1038.918) [-1043.368] (-1043.113) * [-1042.679] (-1038.288) (-1047.347) (-1040.321) -- 0:00:31
80000 -- (-1043.781) (-1043.196) [-1042.071] (-1043.624) * (-1045.074) [-1041.232] (-1043.700) (-1038.648) -- 0:00:31
Average standard deviation of split frequencies: 0.028124
80500 -- (-1042.945) (-1042.961) (-1040.987) [-1044.472] * (-1041.091) [-1041.128] (-1044.711) (-1040.477) -- 0:00:31
81000 -- (-1040.866) (-1040.196) (-1040.922) [-1040.979] * [-1043.038] (-1043.437) (-1045.189) (-1042.163) -- 0:00:31
81500 -- (-1042.755) (-1042.319) [-1038.999] (-1037.571) * (-1042.374) (-1042.607) [-1043.914] (-1041.978) -- 0:00:30
82000 -- (-1042.002) [-1039.854] (-1045.554) (-1043.577) * (-1040.930) [-1042.186] (-1040.213) (-1047.113) -- 0:00:30
82500 -- (-1043.252) [-1041.862] (-1045.556) (-1044.336) * (-1042.072) [-1039.804] (-1043.078) (-1042.851) -- 0:00:30
83000 -- [-1040.857] (-1042.182) (-1043.715) (-1040.053) * (-1039.778) [-1042.196] (-1041.130) (-1040.259) -- 0:00:30
83500 -- (-1044.564) [-1040.755] (-1043.341) (-1040.531) * [-1041.069] (-1039.845) (-1042.195) (-1042.790) -- 0:00:29
84000 -- (-1044.203) (-1042.788) (-1042.247) [-1040.686] * (-1037.893) (-1042.057) (-1041.944) [-1041.218] -- 0:00:29
84500 -- (-1044.025) (-1043.333) (-1041.921) [-1043.131] * (-1040.514) [-1040.359] (-1045.053) (-1041.653) -- 0:00:29
85000 -- (-1042.698) (-1038.999) (-1041.963) [-1041.976] * [-1039.219] (-1044.109) (-1042.399) (-1045.806) -- 0:00:29
Average standard deviation of split frequencies: 0.026117
85500 -- [-1040.159] (-1042.591) (-1044.047) (-1039.448) * (-1043.254) (-1041.940) [-1045.049] (-1047.766) -- 0:00:29
86000 -- (-1040.554) (-1042.202) (-1042.046) [-1038.946] * [-1042.667] (-1041.326) (-1046.180) (-1049.012) -- 0:00:28
86500 -- (-1041.247) (-1043.544) [-1038.461] (-1041.696) * [-1039.994] (-1040.196) (-1041.963) (-1046.051) -- 0:00:28
87000 -- (-1039.461) (-1042.913) (-1041.705) [-1039.899] * [-1041.651] (-1042.151) (-1039.785) (-1042.282) -- 0:00:28
87500 -- (-1045.073) (-1040.246) (-1044.097) [-1040.348] * (-1038.093) (-1041.360) (-1041.100) [-1039.740] -- 0:00:33
88000 -- [-1041.340] (-1044.845) (-1043.535) (-1040.783) * (-1043.286) (-1040.810) [-1039.707] (-1040.779) -- 0:00:32
88500 -- (-1040.572) (-1042.180) (-1044.322) [-1042.243] * [-1037.444] (-1043.053) (-1041.271) (-1040.538) -- 0:00:32
89000 -- [-1041.972] (-1044.191) (-1042.116) (-1040.043) * (-1040.032) [-1041.367] (-1041.047) (-1041.840) -- 0:00:32
89500 -- [-1040.153] (-1041.589) (-1041.200) (-1042.315) * (-1038.158) (-1040.000) (-1041.013) [-1040.228] -- 0:00:32
90000 -- [-1039.454] (-1040.279) (-1040.842) (-1041.956) * [-1041.885] (-1045.403) (-1043.944) (-1044.918) -- 0:00:31
Average standard deviation of split frequencies: 0.026646
90500 -- (-1039.627) (-1040.251) [-1041.658] (-1042.779) * (-1037.143) (-1039.652) [-1040.117] (-1045.182) -- 0:00:31
91000 -- (-1043.376) [-1041.340] (-1039.194) (-1042.014) * (-1037.795) (-1042.080) [-1041.678] (-1041.643) -- 0:00:31
91500 -- (-1043.125) [-1040.854] (-1042.343) (-1040.358) * (-1041.752) (-1044.140) (-1046.118) [-1040.273] -- 0:00:31
92000 -- (-1044.020) (-1041.233) (-1041.787) [-1039.762] * (-1043.639) (-1038.272) (-1043.712) [-1043.508] -- 0:00:31
92500 -- [-1042.994] (-1041.746) (-1043.804) (-1040.825) * (-1039.323) (-1040.697) (-1043.311) [-1043.147] -- 0:00:30
93000 -- (-1038.987) (-1043.002) (-1040.695) [-1040.075] * [-1043.821] (-1042.322) (-1043.487) (-1044.036) -- 0:00:30
93500 -- (-1045.932) [-1044.037] (-1041.177) (-1041.718) * (-1044.212) (-1040.834) [-1041.049] (-1041.829) -- 0:00:30
94000 -- (-1042.799) [-1040.441] (-1040.167) (-1042.063) * [-1043.489] (-1039.649) (-1044.708) (-1040.694) -- 0:00:30
94500 -- (-1041.055) [-1042.386] (-1040.747) (-1040.919) * (-1045.722) (-1043.537) (-1042.489) [-1038.417] -- 0:00:30
95000 -- (-1044.927) (-1042.437) [-1041.132] (-1045.572) * (-1042.567) (-1041.419) [-1041.218] (-1040.706) -- 0:00:29
Average standard deviation of split frequencies: 0.024841
95500 -- (-1044.455) [-1041.808] (-1039.466) (-1040.149) * [-1042.498] (-1041.049) (-1041.781) (-1042.574) -- 0:00:29
96000 -- [-1042.132] (-1040.295) (-1041.696) (-1041.292) * [-1039.049] (-1042.008) (-1042.042) (-1043.290) -- 0:00:29
96500 -- [-1045.117] (-1041.154) (-1041.154) (-1041.561) * [-1039.973] (-1042.115) (-1042.587) (-1041.563) -- 0:00:29
97000 -- (-1041.300) (-1041.085) (-1038.939) [-1040.488] * (-1041.487) [-1041.006] (-1043.867) (-1042.802) -- 0:00:29
97500 -- (-1041.134) (-1043.199) (-1044.852) [-1045.508] * (-1043.186) (-1042.269) (-1043.099) [-1040.142] -- 0:00:28
98000 -- (-1041.396) (-1041.582) (-1040.793) [-1040.679] * (-1043.482) [-1043.036] (-1042.569) (-1048.064) -- 0:00:28
98500 -- (-1042.243) (-1042.619) (-1045.973) [-1041.160] * (-1038.473) (-1040.147) (-1045.471) [-1041.271] -- 0:00:28
99000 -- [-1040.320] (-1043.486) (-1042.634) (-1041.821) * (-1042.330) [-1041.315] (-1040.863) (-1040.533) -- 0:00:28
99500 -- [-1040.359] (-1038.354) (-1045.072) (-1041.485) * [-1043.968] (-1043.583) (-1045.018) (-1040.135) -- 0:00:28
100000 -- (-1041.354) (-1040.323) (-1041.827) [-1041.643] * (-1043.162) (-1041.786) (-1044.203) [-1041.021] -- 0:00:27
Average standard deviation of split frequencies: 0.024585
100500 -- [-1041.748] (-1042.927) (-1043.869) (-1043.636) * (-1042.194) (-1042.743) (-1041.124) [-1042.909] -- 0:00:27
101000 -- (-1041.056) (-1040.196) (-1040.511) [-1042.191] * (-1038.550) (-1043.851) [-1041.336] (-1041.441) -- 0:00:27
101500 -- (-1042.700) (-1042.312) (-1043.508) [-1039.838] * (-1040.775) (-1046.774) (-1041.227) [-1046.875] -- 0:00:27
102000 -- (-1041.621) (-1043.990) [-1043.244] (-1043.026) * (-1039.568) [-1039.469] (-1041.754) (-1041.023) -- 0:00:27
102500 -- (-1041.101) (-1041.238) (-1040.014) [-1040.978] * (-1041.566) (-1042.377) (-1041.879) [-1042.500] -- 0:00:31
103000 -- [-1044.067] (-1040.702) (-1039.925) (-1039.231) * (-1041.417) [-1039.938] (-1042.104) (-1042.162) -- 0:00:30
103500 -- (-1042.447) [-1043.680] (-1041.526) (-1045.599) * (-1041.815) [-1041.857] (-1043.332) (-1047.105) -- 0:00:30
104000 -- (-1043.687) (-1042.525) (-1041.108) [-1041.036] * (-1041.093) [-1039.571] (-1043.533) (-1046.406) -- 0:00:30
104500 -- (-1041.158) [-1042.454] (-1041.533) (-1042.416) * (-1043.638) [-1041.165] (-1041.268) (-1039.162) -- 0:00:30
105000 -- [-1043.737] (-1038.975) (-1041.419) (-1037.845) * [-1041.582] (-1045.274) (-1039.378) (-1043.922) -- 0:00:30
Average standard deviation of split frequencies: 0.022483
105500 -- (-1046.786) (-1043.551) (-1041.421) [-1039.748] * (-1039.819) (-1042.688) (-1041.654) [-1042.912] -- 0:00:29
106000 -- (-1040.536) (-1044.606) [-1045.479] (-1041.951) * [-1040.311] (-1045.484) (-1042.903) (-1046.106) -- 0:00:29
106500 -- (-1039.919) (-1043.591) (-1041.900) [-1039.161] * (-1043.458) [-1042.329] (-1043.652) (-1045.212) -- 0:00:29
107000 -- (-1041.205) (-1042.060) (-1044.453) [-1041.586] * (-1043.282) (-1042.264) (-1040.874) [-1042.609] -- 0:00:29
107500 -- (-1041.818) (-1040.668) [-1040.812] (-1040.094) * (-1042.197) (-1045.554) (-1041.740) [-1040.107] -- 0:00:29
108000 -- (-1042.492) [-1043.490] (-1044.217) (-1044.712) * [-1040.803] (-1043.614) (-1043.783) (-1040.679) -- 0:00:29
108500 -- (-1043.327) (-1043.012) [-1043.586] (-1040.622) * (-1042.291) (-1044.242) [-1043.914] (-1041.969) -- 0:00:28
109000 -- (-1048.479) (-1040.875) [-1042.887] (-1041.516) * [-1039.967] (-1039.187) (-1045.013) (-1039.622) -- 0:00:28
109500 -- [-1040.083] (-1042.766) (-1042.354) (-1041.393) * (-1039.530) [-1043.255] (-1045.623) (-1041.741) -- 0:00:28
110000 -- (-1041.292) [-1041.616] (-1044.203) (-1042.402) * (-1042.575) (-1043.593) [-1040.651] (-1044.685) -- 0:00:28
Average standard deviation of split frequencies: 0.022245
110500 -- [-1038.998] (-1041.797) (-1040.556) (-1041.634) * (-1043.622) (-1041.999) [-1041.004] (-1040.842) -- 0:00:28
111000 -- (-1039.756) (-1040.702) [-1042.738] (-1042.335) * (-1043.895) (-1040.350) [-1040.223] (-1047.026) -- 0:00:28
111500 -- [-1039.725] (-1041.722) (-1041.474) (-1044.820) * (-1047.541) (-1042.395) [-1040.905] (-1045.332) -- 0:00:27
112000 -- (-1043.456) (-1040.482) [-1038.689] (-1040.849) * (-1042.593) [-1043.648] (-1041.258) (-1044.092) -- 0:00:27
112500 -- (-1041.539) (-1039.947) [-1043.270] (-1039.660) * [-1039.708] (-1040.719) (-1043.274) (-1039.653) -- 0:00:27
113000 -- (-1041.863) [-1040.921] (-1043.355) (-1041.466) * (-1043.634) (-1040.609) (-1041.930) [-1038.425] -- 0:00:27
113500 -- [-1042.084] (-1041.578) (-1045.427) (-1040.848) * (-1043.123) [-1041.274] (-1042.105) (-1039.920) -- 0:00:27
114000 -- (-1039.892) [-1039.130] (-1042.922) (-1044.348) * (-1042.630) (-1041.539) (-1044.649) [-1040.653] -- 0:00:27
114500 -- (-1040.917) (-1041.788) [-1042.649] (-1042.390) * [-1042.471] (-1042.982) (-1043.574) (-1042.736) -- 0:00:26
115000 -- (-1041.108) [-1042.152] (-1042.669) (-1041.117) * (-1045.365) [-1044.380] (-1043.643) (-1041.899) -- 0:00:26
Average standard deviation of split frequencies: 0.019868
115500 -- (-1041.037) (-1047.574) (-1038.386) [-1046.095] * (-1040.267) (-1040.830) (-1042.432) [-1041.269] -- 0:00:26
116000 -- (-1041.567) [-1045.908] (-1037.832) (-1041.733) * [-1038.615] (-1044.436) (-1039.733) (-1038.831) -- 0:00:26
116500 -- (-1043.190) (-1043.534) (-1042.402) [-1041.614] * [-1041.956] (-1043.280) (-1041.191) (-1046.845) -- 0:00:26
117000 -- (-1041.410) (-1041.719) [-1040.800] (-1045.994) * (-1040.356) [-1041.029] (-1041.821) (-1040.091) -- 0:00:26
117500 -- (-1040.117) (-1042.052) [-1040.953] (-1044.392) * (-1038.235) [-1042.226] (-1041.217) (-1040.815) -- 0:00:29
118000 -- [-1038.056] (-1045.082) (-1040.991) (-1044.339) * (-1039.257) [-1039.980] (-1041.556) (-1041.171) -- 0:00:29
118500 -- (-1042.330) [-1040.477] (-1044.169) (-1040.762) * [-1040.677] (-1042.128) (-1044.680) (-1043.644) -- 0:00:28
119000 -- (-1044.337) [-1041.658] (-1040.767) (-1041.611) * [-1039.250] (-1041.739) (-1041.186) (-1042.836) -- 0:00:28
119500 -- (-1039.898) [-1038.332] (-1041.219) (-1040.997) * (-1038.850) (-1042.594) (-1045.656) [-1042.809] -- 0:00:28
120000 -- [-1041.767] (-1044.510) (-1039.966) (-1044.991) * (-1041.013) (-1041.913) (-1041.479) [-1041.030] -- 0:00:28
Average standard deviation of split frequencies: 0.019967
120500 -- (-1042.841) (-1039.867) (-1040.623) [-1042.550] * [-1042.970] (-1040.601) (-1040.240) (-1039.120) -- 0:00:28
121000 -- (-1041.699) [-1041.609] (-1041.722) (-1042.285) * (-1040.622) (-1044.254) (-1042.231) [-1041.466] -- 0:00:28
121500 -- (-1039.534) [-1044.628] (-1043.450) (-1040.470) * [-1041.782] (-1044.323) (-1041.876) (-1046.023) -- 0:00:28
122000 -- (-1036.720) [-1041.325] (-1039.232) (-1042.143) * (-1040.995) [-1041.257] (-1041.026) (-1044.841) -- 0:00:27
122500 -- (-1038.440) (-1042.948) [-1040.082] (-1039.882) * (-1042.615) (-1042.154) (-1043.489) [-1045.396] -- 0:00:27
123000 -- (-1040.512) (-1048.136) (-1042.710) [-1042.381] * (-1043.831) (-1041.153) [-1041.529] (-1039.857) -- 0:00:27
123500 -- (-1039.895) (-1044.006) (-1040.550) [-1043.012] * [-1042.400] (-1043.366) (-1043.636) (-1039.769) -- 0:00:27
124000 -- (-1041.273) (-1041.933) (-1040.889) [-1041.566] * (-1040.242) (-1047.907) [-1042.402] (-1040.231) -- 0:00:27
124500 -- (-1041.560) (-1041.572) (-1044.645) [-1043.260] * [-1042.783] (-1041.522) (-1045.633) (-1046.275) -- 0:00:27
125000 -- (-1042.040) [-1040.696] (-1042.691) (-1041.872) * (-1042.012) [-1039.273] (-1045.258) (-1041.373) -- 0:00:27
Average standard deviation of split frequencies: 0.018707
125500 -- (-1040.092) [-1040.978] (-1042.558) (-1041.545) * (-1048.903) [-1045.036] (-1045.374) (-1038.123) -- 0:00:26
126000 -- (-1040.990) [-1040.059] (-1040.922) (-1042.251) * (-1043.168) (-1043.374) (-1045.325) [-1039.094] -- 0:00:26
126500 -- (-1042.500) (-1040.899) [-1044.140] (-1045.761) * (-1042.464) [-1046.249] (-1040.746) (-1040.649) -- 0:00:26
127000 -- (-1040.238) [-1041.396] (-1040.061) (-1041.510) * [-1042.870] (-1042.934) (-1040.903) (-1042.666) -- 0:00:26
127500 -- (-1037.679) (-1042.898) (-1040.507) [-1041.283] * (-1042.435) (-1040.037) [-1041.612] (-1041.912) -- 0:00:26
128000 -- (-1039.513) (-1039.562) [-1040.883] (-1043.944) * (-1041.266) (-1040.414) [-1043.875] (-1044.188) -- 0:00:26
128500 -- (-1041.954) [-1041.617] (-1043.619) (-1043.795) * [-1041.486] (-1042.084) (-1044.870) (-1042.067) -- 0:00:26
129000 -- (-1041.032) (-1044.650) (-1041.322) [-1043.528] * (-1045.842) (-1040.588) (-1043.027) [-1042.921] -- 0:00:25
129500 -- (-1044.152) (-1040.922) (-1040.382) [-1040.251] * [-1040.930] (-1041.341) (-1042.688) (-1041.215) -- 0:00:25
130000 -- (-1040.363) (-1044.744) [-1039.842] (-1039.493) * (-1040.054) (-1041.205) (-1043.633) [-1044.312] -- 0:00:25
Average standard deviation of split frequencies: 0.020243
130500 -- (-1042.742) (-1041.436) (-1043.812) [-1040.868] * (-1040.362) [-1041.681] (-1040.361) (-1047.168) -- 0:00:25
131000 -- (-1046.567) (-1043.117) [-1043.431] (-1042.904) * (-1040.925) (-1041.537) [-1042.219] (-1041.879) -- 0:00:25
131500 -- (-1044.565) (-1043.064) (-1039.761) [-1039.320] * (-1044.527) [-1040.775] (-1041.818) (-1041.337) -- 0:00:28
132000 -- (-1045.244) [-1044.086] (-1043.610) (-1040.589) * (-1043.842) (-1042.308) [-1042.290] (-1044.180) -- 0:00:27
132500 -- (-1039.798) (-1045.721) (-1045.964) [-1039.664] * [-1041.992] (-1042.981) (-1042.810) (-1041.519) -- 0:00:27
133000 -- [-1037.979] (-1043.056) (-1042.154) (-1040.539) * (-1045.302) [-1041.662] (-1041.808) (-1042.633) -- 0:00:27
133500 -- (-1038.547) [-1041.677] (-1041.774) (-1044.641) * (-1041.501) [-1042.515] (-1041.384) (-1044.954) -- 0:00:27
134000 -- [-1041.473] (-1040.165) (-1042.775) (-1042.996) * (-1045.673) [-1040.351] (-1045.054) (-1042.703) -- 0:00:27
134500 -- [-1042.597] (-1042.240) (-1042.069) (-1041.293) * (-1043.983) [-1041.944] (-1042.325) (-1041.817) -- 0:00:27
135000 -- [-1041.167] (-1041.425) (-1040.484) (-1041.748) * (-1044.063) (-1043.227) [-1041.454] (-1043.048) -- 0:00:27
Average standard deviation of split frequencies: 0.016753
135500 -- (-1039.514) (-1042.770) (-1041.269) [-1041.400] * [-1047.750] (-1041.575) (-1040.939) (-1041.196) -- 0:00:26
136000 -- [-1039.594] (-1042.656) (-1039.617) (-1041.884) * (-1041.355) [-1043.691] (-1041.747) (-1043.329) -- 0:00:26
136500 -- [-1037.797] (-1041.906) (-1046.319) (-1044.181) * (-1041.141) (-1043.455) [-1040.787] (-1042.416) -- 0:00:26
137000 -- [-1043.553] (-1042.318) (-1045.883) (-1042.644) * [-1040.252] (-1041.815) (-1047.551) (-1042.257) -- 0:00:26
137500 -- (-1040.525) (-1041.471) [-1040.506] (-1043.157) * (-1043.661) (-1047.463) (-1041.800) [-1043.071] -- 0:00:26
138000 -- (-1044.047) [-1045.851] (-1042.329) (-1041.330) * (-1042.682) (-1043.457) (-1042.790) [-1045.001] -- 0:00:26
138500 -- [-1040.515] (-1041.830) (-1040.108) (-1040.722) * [-1043.542] (-1045.305) (-1043.925) (-1041.513) -- 0:00:26
139000 -- (-1042.002) (-1041.243) (-1041.561) [-1040.658] * (-1044.325) (-1045.759) [-1041.461] (-1040.604) -- 0:00:25
139500 -- (-1041.318) (-1049.147) (-1042.786) [-1043.207] * [-1041.232] (-1043.013) (-1041.981) (-1040.047) -- 0:00:25
140000 -- [-1040.248] (-1041.210) (-1040.075) (-1043.621) * (-1042.954) (-1045.905) (-1041.995) [-1041.355] -- 0:00:25
Average standard deviation of split frequencies: 0.021615
140500 -- (-1044.080) (-1041.588) (-1041.902) [-1040.527] * (-1042.753) (-1039.318) (-1042.969) [-1041.221] -- 0:00:25
141000 -- [-1042.442] (-1044.275) (-1040.183) (-1041.715) * (-1043.356) (-1040.487) [-1041.512] (-1043.034) -- 0:00:25
141500 -- (-1041.504) (-1046.634) (-1041.193) [-1040.961] * (-1040.466) [-1041.633] (-1042.754) (-1041.743) -- 0:00:25
142000 -- (-1039.535) [-1046.824] (-1040.093) (-1037.997) * [-1041.795] (-1044.565) (-1042.171) (-1042.112) -- 0:00:25
142500 -- (-1041.834) [-1042.785] (-1040.125) (-1041.826) * [-1040.241] (-1042.196) (-1041.549) (-1041.707) -- 0:00:25
143000 -- (-1045.333) (-1041.682) (-1044.091) [-1039.173] * (-1040.415) [-1040.413] (-1046.132) (-1044.835) -- 0:00:24
143500 -- (-1043.720) (-1041.137) [-1038.160] (-1040.692) * [-1043.100] (-1043.153) (-1046.480) (-1042.321) -- 0:00:24
144000 -- (-1042.067) [-1041.925] (-1040.048) (-1041.037) * (-1039.889) (-1044.102) [-1043.223] (-1047.563) -- 0:00:24
144500 -- (-1040.057) (-1040.676) (-1040.239) [-1040.804] * [-1041.902] (-1044.309) (-1041.426) (-1043.629) -- 0:00:24
145000 -- [-1041.331] (-1041.656) (-1040.098) (-1040.882) * [-1047.041] (-1044.432) (-1045.490) (-1051.094) -- 0:00:24
Average standard deviation of split frequencies: 0.021310
145500 -- (-1042.184) (-1044.737) [-1038.526] (-1042.819) * (-1040.529) (-1043.502) [-1043.772] (-1041.908) -- 0:00:24
146000 -- (-1043.479) (-1043.240) [-1042.289] (-1043.591) * [-1040.723] (-1042.674) (-1041.317) (-1041.389) -- 0:00:24
146500 -- [-1040.875] (-1044.318) (-1040.437) (-1043.289) * (-1040.326) [-1040.955] (-1040.117) (-1044.011) -- 0:00:26
147000 -- (-1041.841) (-1041.961) [-1037.257] (-1049.006) * (-1043.961) [-1043.003] (-1046.106) (-1038.932) -- 0:00:26
147500 -- [-1040.272] (-1042.873) (-1040.732) (-1040.801) * [-1041.003] (-1039.429) (-1041.536) (-1042.324) -- 0:00:26
148000 -- (-1041.697) [-1041.393] (-1041.325) (-1040.596) * (-1042.797) (-1041.107) [-1042.946] (-1042.621) -- 0:00:26
148500 -- (-1042.570) [-1043.260] (-1044.288) (-1040.764) * (-1046.393) [-1041.424] (-1042.185) (-1041.468) -- 0:00:26
149000 -- [-1042.678] (-1044.246) (-1040.920) (-1041.096) * (-1043.034) (-1041.685) (-1041.762) [-1041.990] -- 0:00:25
149500 -- [-1040.307] (-1044.428) (-1042.590) (-1040.896) * (-1045.003) (-1039.887) (-1040.348) [-1041.226] -- 0:00:25
150000 -- (-1044.563) (-1042.311) [-1045.576] (-1042.481) * (-1044.311) (-1040.716) (-1043.306) [-1041.298] -- 0:00:25
Average standard deviation of split frequencies: 0.020749
150500 -- (-1039.911) (-1043.914) (-1042.108) [-1046.219] * (-1044.241) (-1039.580) [-1044.466] (-1041.762) -- 0:00:25
151000 -- [-1041.942] (-1042.070) (-1040.211) (-1043.771) * (-1043.797) [-1042.990] (-1041.654) (-1041.570) -- 0:00:25
151500 -- (-1037.183) [-1040.681] (-1042.543) (-1042.861) * (-1045.761) (-1039.122) (-1040.683) [-1042.450] -- 0:00:25
152000 -- (-1040.196) (-1044.331) (-1040.831) [-1042.080] * [-1043.248] (-1039.730) (-1038.132) (-1040.937) -- 0:00:25
152500 -- (-1040.780) (-1040.705) (-1041.059) [-1043.326] * (-1042.407) [-1041.103] (-1039.941) (-1039.784) -- 0:00:25
153000 -- (-1038.855) [-1037.484] (-1042.351) (-1043.032) * (-1045.437) [-1041.406] (-1039.886) (-1037.976) -- 0:00:24
153500 -- [-1040.112] (-1040.019) (-1041.148) (-1043.755) * (-1041.572) (-1041.802) (-1040.997) [-1040.614] -- 0:00:24
154000 -- (-1039.344) (-1041.447) (-1041.361) [-1041.681] * [-1041.952] (-1043.212) (-1040.885) (-1041.571) -- 0:00:24
154500 -- [-1039.744] (-1043.541) (-1043.350) (-1045.035) * (-1041.450) (-1040.599) [-1040.486] (-1039.685) -- 0:00:24
155000 -- [-1040.132] (-1041.877) (-1039.744) (-1045.439) * [-1043.298] (-1046.135) (-1042.543) (-1041.263) -- 0:00:24
Average standard deviation of split frequencies: 0.022107
155500 -- [-1041.043] (-1042.407) (-1041.806) (-1043.498) * (-1042.169) [-1042.612] (-1042.220) (-1039.066) -- 0:00:24
156000 -- [-1041.410] (-1042.454) (-1040.856) (-1045.322) * [-1040.431] (-1041.366) (-1041.960) (-1043.191) -- 0:00:24
156500 -- [-1041.283] (-1039.188) (-1041.503) (-1042.144) * (-1042.448) (-1039.816) (-1042.106) [-1039.829] -- 0:00:24
157000 -- (-1042.117) [-1040.676] (-1041.412) (-1041.609) * (-1042.848) (-1042.954) (-1042.977) [-1037.618] -- 0:00:24
157500 -- (-1042.616) (-1042.640) [-1041.410] (-1045.119) * [-1042.800] (-1042.886) (-1042.721) (-1041.036) -- 0:00:23
158000 -- [-1039.368] (-1038.929) (-1043.674) (-1040.520) * (-1043.088) [-1048.609] (-1042.226) (-1042.688) -- 0:00:23
158500 -- (-1040.440) (-1047.017) [-1042.372] (-1040.726) * (-1043.644) (-1041.810) [-1042.260] (-1043.646) -- 0:00:23
159000 -- (-1039.784) [-1041.101] (-1040.633) (-1040.786) * (-1039.787) [-1041.201] (-1043.602) (-1043.450) -- 0:00:23
159500 -- (-1042.305) (-1044.329) [-1042.795] (-1042.116) * (-1041.958) [-1041.146] (-1040.984) (-1048.132) -- 0:00:23
160000 -- (-1040.995) (-1043.298) [-1041.978] (-1043.717) * (-1044.611) [-1041.661] (-1045.153) (-1039.252) -- 0:00:23
Average standard deviation of split frequencies: 0.021156
160500 -- (-1042.146) [-1041.566] (-1043.777) (-1040.862) * [-1041.426] (-1039.229) (-1043.683) (-1041.731) -- 0:00:23
161000 -- (-1040.616) [-1041.666] (-1041.708) (-1042.355) * [-1039.508] (-1039.743) (-1041.266) (-1041.027) -- 0:00:23
161500 -- [-1040.861] (-1041.082) (-1042.291) (-1040.337) * (-1045.886) (-1041.803) (-1044.110) [-1048.127] -- 0:00:25
162000 -- (-1040.674) [-1040.510] (-1046.055) (-1044.342) * [-1041.922] (-1043.113) (-1041.330) (-1043.319) -- 0:00:25
162500 -- (-1040.576) (-1042.508) [-1043.081] (-1044.583) * (-1043.154) [-1042.236] (-1046.249) (-1041.221) -- 0:00:24
163000 -- (-1040.111) (-1042.091) [-1044.604] (-1042.642) * (-1041.573) [-1043.585] (-1040.619) (-1040.735) -- 0:00:24
163500 -- (-1042.887) (-1042.521) [-1041.124] (-1041.461) * [-1041.968] (-1040.126) (-1040.097) (-1038.854) -- 0:00:24
164000 -- [-1041.177] (-1042.694) (-1042.995) (-1043.821) * (-1042.463) (-1040.528) [-1045.474] (-1045.191) -- 0:00:24
164500 -- (-1045.365) (-1039.187) (-1043.993) [-1041.127] * (-1042.700) [-1042.558] (-1044.255) (-1043.218) -- 0:00:24
165000 -- (-1042.859) (-1041.081) (-1042.163) [-1041.690] * (-1040.619) [-1043.768] (-1041.992) (-1042.784) -- 0:00:24
Average standard deviation of split frequencies: 0.021523
165500 -- [-1042.143] (-1045.617) (-1039.705) (-1041.887) * [-1038.752] (-1042.302) (-1040.434) (-1038.222) -- 0:00:24
166000 -- [-1041.814] (-1040.117) (-1041.554) (-1042.144) * (-1039.109) (-1041.233) (-1039.425) [-1039.480] -- 0:00:24
166500 -- (-1043.283) (-1037.309) [-1043.155] (-1041.179) * (-1041.220) [-1040.738] (-1041.327) (-1041.704) -- 0:00:24
167000 -- (-1042.035) (-1040.558) [-1042.342] (-1047.341) * [-1038.973] (-1045.061) (-1042.253) (-1042.020) -- 0:00:23
167500 -- [-1040.530] (-1044.214) (-1040.340) (-1042.659) * (-1040.695) (-1044.231) (-1043.870) [-1035.335] -- 0:00:23
168000 -- (-1041.438) (-1042.126) (-1041.948) [-1041.631] * (-1039.508) (-1039.394) [-1042.414] (-1040.919) -- 0:00:23
168500 -- (-1041.094) (-1043.204) (-1039.671) [-1043.577] * (-1042.770) (-1043.088) (-1042.014) [-1042.545] -- 0:00:23
169000 -- [-1040.425] (-1040.510) (-1042.477) (-1041.654) * (-1042.705) [-1040.354] (-1043.227) (-1041.772) -- 0:00:23
169500 -- (-1040.767) (-1041.738) [-1042.450] (-1040.402) * (-1042.175) [-1039.765] (-1041.640) (-1041.523) -- 0:00:23
170000 -- (-1042.323) [-1040.078] (-1041.906) (-1039.839) * [-1039.565] (-1040.633) (-1040.597) (-1041.851) -- 0:00:23
Average standard deviation of split frequencies: 0.018899
170500 -- (-1041.308) [-1039.486] (-1040.988) (-1040.816) * [-1039.619] (-1039.267) (-1040.755) (-1040.414) -- 0:00:23
171000 -- (-1039.945) (-1041.263) [-1038.213] (-1042.099) * (-1039.326) (-1038.958) (-1042.029) [-1040.320] -- 0:00:23
171500 -- (-1042.690) (-1043.286) [-1039.744] (-1043.305) * (-1039.737) (-1042.652) (-1043.769) [-1041.647] -- 0:00:22
172000 -- (-1040.294) [-1042.785] (-1040.661) (-1040.981) * [-1037.711] (-1042.177) (-1049.980) (-1043.717) -- 0:00:22
172500 -- (-1041.203) [-1044.607] (-1040.866) (-1044.402) * (-1040.874) (-1041.977) (-1045.727) [-1039.969] -- 0:00:22
173000 -- (-1042.378) (-1045.140) (-1039.366) [-1040.469] * (-1041.918) (-1041.348) (-1043.423) [-1045.646] -- 0:00:22
173500 -- (-1043.520) [-1044.494] (-1041.485) (-1041.821) * (-1039.080) [-1040.840] (-1047.235) (-1043.159) -- 0:00:22
174000 -- (-1040.413) (-1044.276) [-1041.413] (-1043.956) * (-1039.943) (-1044.238) (-1053.531) [-1041.924] -- 0:00:22
174500 -- (-1043.549) (-1045.227) (-1043.091) [-1040.871] * (-1040.382) [-1041.852] (-1052.635) (-1042.967) -- 0:00:22
175000 -- (-1042.473) (-1041.369) (-1044.114) [-1041.808] * (-1043.142) [-1039.565] (-1048.865) (-1045.119) -- 0:00:22
Average standard deviation of split frequencies: 0.018749
175500 -- (-1045.737) (-1040.154) (-1041.432) [-1049.175] * (-1044.763) [-1038.660] (-1044.074) (-1041.257) -- 0:00:22
176000 -- [-1041.273] (-1041.978) (-1041.350) (-1042.623) * [-1043.674] (-1041.676) (-1040.982) (-1040.678) -- 0:00:23
176500 -- [-1043.964] (-1039.094) (-1041.658) (-1042.263) * (-1040.413) (-1041.675) (-1041.914) [-1038.161] -- 0:00:23
177000 -- (-1048.153) (-1040.744) [-1045.040] (-1044.872) * (-1039.839) [-1039.382] (-1042.525) (-1040.178) -- 0:00:23
177500 -- (-1041.081) [-1039.174] (-1043.234) (-1042.945) * (-1042.417) [-1042.741] (-1043.985) (-1043.758) -- 0:00:23
178000 -- (-1042.774) (-1042.852) [-1042.229] (-1043.021) * (-1042.762) [-1042.757] (-1044.250) (-1041.512) -- 0:00:23
178500 -- [-1042.612] (-1040.514) (-1045.598) (-1042.607) * [-1041.532] (-1045.843) (-1041.871) (-1040.850) -- 0:00:23
179000 -- (-1042.452) (-1043.495) [-1042.080] (-1041.244) * (-1038.444) (-1042.082) (-1043.510) [-1041.548] -- 0:00:23
179500 -- [-1042.389] (-1041.566) (-1041.943) (-1045.004) * [-1041.281] (-1039.856) (-1042.532) (-1041.873) -- 0:00:23
180000 -- [-1039.067] (-1045.384) (-1041.270) (-1045.681) * (-1037.674) (-1041.357) (-1042.835) [-1041.233] -- 0:00:23
Average standard deviation of split frequencies: 0.017578
180500 -- (-1040.606) (-1044.611) (-1043.358) [-1042.604] * (-1040.935) [-1041.712] (-1046.007) (-1040.303) -- 0:00:23
181000 -- [-1041.108] (-1042.707) (-1041.522) (-1043.669) * (-1040.498) (-1038.283) [-1043.205] (-1041.079) -- 0:00:22
181500 -- (-1042.578) [-1040.342] (-1041.292) (-1044.757) * [-1039.655] (-1039.869) (-1040.423) (-1040.737) -- 0:00:22
182000 -- (-1039.008) (-1037.531) [-1041.151] (-1041.577) * (-1041.714) (-1040.151) (-1044.826) [-1042.429] -- 0:00:22
182500 -- (-1041.305) (-1044.654) (-1039.617) [-1042.213] * (-1043.072) (-1038.239) [-1042.036] (-1042.494) -- 0:00:22
183000 -- (-1043.067) [-1040.079] (-1040.720) (-1042.367) * (-1041.020) (-1039.829) (-1044.156) [-1041.607] -- 0:00:22
183500 -- (-1041.220) [-1043.051] (-1040.391) (-1045.470) * (-1040.809) (-1039.883) (-1042.247) [-1045.746] -- 0:00:22
184000 -- [-1041.273] (-1041.323) (-1041.532) (-1045.920) * (-1042.158) [-1039.594] (-1046.964) (-1037.740) -- 0:00:22
184500 -- (-1042.566) (-1038.859) [-1041.555] (-1044.287) * (-1047.523) (-1039.815) (-1043.201) [-1040.893] -- 0:00:22
185000 -- [-1041.882] (-1041.292) (-1040.785) (-1041.933) * (-1045.966) (-1042.109) (-1043.656) [-1042.923] -- 0:00:22
Average standard deviation of split frequencies: 0.017608
185500 -- (-1039.656) (-1041.544) (-1043.869) [-1041.795] * (-1045.584) (-1042.112) [-1041.637] (-1042.033) -- 0:00:22
186000 -- [-1043.307] (-1039.807) (-1041.549) (-1042.500) * (-1042.427) (-1039.359) [-1040.086] (-1042.307) -- 0:00:21
186500 -- (-1041.315) (-1041.208) (-1041.924) [-1042.171] * [-1041.610] (-1041.588) (-1042.444) (-1043.221) -- 0:00:21
187000 -- (-1039.663) (-1042.818) [-1042.656] (-1043.614) * [-1041.102] (-1041.987) (-1044.443) (-1044.729) -- 0:00:21
187500 -- (-1042.263) [-1040.458] (-1041.452) (-1041.243) * [-1042.764] (-1040.691) (-1039.592) (-1044.325) -- 0:00:21
188000 -- [-1036.845] (-1040.692) (-1042.984) (-1040.940) * (-1043.404) [-1040.651] (-1043.234) (-1044.948) -- 0:00:21
188500 -- (-1040.895) (-1042.040) [-1040.434] (-1041.831) * [-1044.001] (-1041.425) (-1045.595) (-1039.986) -- 0:00:21
189000 -- [-1042.409] (-1045.456) (-1042.666) (-1040.791) * (-1041.899) (-1040.198) [-1042.719] (-1043.196) -- 0:00:21
189500 -- (-1041.980) [-1044.029] (-1043.398) (-1042.624) * (-1040.560) (-1044.565) [-1042.115] (-1043.392) -- 0:00:21
190000 -- (-1039.354) (-1043.302) [-1042.439] (-1042.718) * (-1042.834) (-1041.705) (-1041.861) [-1040.705] -- 0:00:21
Average standard deviation of split frequencies: 0.016266
190500 -- (-1041.571) [-1045.284] (-1042.327) (-1040.756) * (-1039.115) (-1042.738) (-1042.500) [-1041.522] -- 0:00:21
191000 -- (-1043.665) [-1040.226] (-1042.955) (-1041.332) * [-1038.013] (-1041.054) (-1044.379) (-1043.661) -- 0:00:22
191500 -- (-1042.119) (-1042.130) (-1043.929) [-1041.073] * (-1038.534) (-1047.431) [-1046.769] (-1039.811) -- 0:00:22
192000 -- (-1040.608) (-1041.904) [-1044.075] (-1041.292) * [-1041.826] (-1042.725) (-1045.346) (-1041.743) -- 0:00:22
192500 -- [-1039.370] (-1043.475) (-1045.410) (-1042.717) * (-1038.893) (-1046.580) (-1043.765) [-1044.113] -- 0:00:22
193000 -- [-1041.093] (-1045.208) (-1040.928) (-1039.488) * (-1041.921) (-1044.228) [-1042.151] (-1041.743) -- 0:00:22
193500 -- (-1047.787) (-1045.092) (-1041.703) [-1043.950] * [-1038.428] (-1042.274) (-1042.433) (-1040.209) -- 0:00:22
194000 -- (-1048.044) (-1039.295) [-1042.131] (-1041.818) * [-1038.607] (-1041.019) (-1040.049) (-1042.134) -- 0:00:22
194500 -- (-1050.490) (-1040.444) (-1040.519) [-1042.270] * (-1040.820) [-1039.688] (-1041.764) (-1044.896) -- 0:00:21
195000 -- (-1044.237) [-1039.453] (-1040.784) (-1040.878) * (-1041.113) (-1042.946) (-1040.536) [-1041.202] -- 0:00:21
Average standard deviation of split frequencies: 0.017089
195500 -- (-1043.205) (-1044.923) [-1043.117] (-1044.352) * (-1041.635) [-1040.251] (-1041.053) (-1042.191) -- 0:00:21
196000 -- (-1041.976) (-1046.810) (-1041.552) [-1044.477] * (-1041.379) (-1042.051) [-1041.105] (-1042.785) -- 0:00:21
196500 -- (-1042.561) [-1043.570] (-1042.820) (-1042.620) * (-1044.117) (-1041.840) (-1042.612) [-1043.733] -- 0:00:21
197000 -- (-1042.281) [-1044.530] (-1041.189) (-1044.809) * [-1042.051] (-1044.660) (-1042.417) (-1045.103) -- 0:00:21
197500 -- (-1048.138) (-1043.544) (-1043.223) [-1041.249] * [-1039.819] (-1045.079) (-1046.660) (-1044.231) -- 0:00:21
198000 -- (-1042.645) (-1041.729) [-1038.808] (-1042.019) * [-1041.199] (-1040.230) (-1045.248) (-1040.164) -- 0:00:21
198500 -- [-1040.651] (-1042.318) (-1042.493) (-1041.031) * (-1039.365) (-1041.712) [-1043.660] (-1040.891) -- 0:00:21
199000 -- (-1039.224) [-1042.545] (-1038.821) (-1042.263) * [-1041.965] (-1042.304) (-1041.533) (-1042.953) -- 0:00:21
199500 -- (-1040.735) (-1043.236) [-1039.385] (-1042.681) * (-1040.275) [-1045.002] (-1040.726) (-1041.761) -- 0:00:21
200000 -- (-1038.974) [-1044.064] (-1045.043) (-1042.670) * (-1039.784) (-1040.929) [-1041.555] (-1042.171) -- 0:00:20
Average standard deviation of split frequencies: 0.017433
200500 -- (-1039.929) [-1042.789] (-1043.125) (-1041.877) * [-1039.780] (-1043.546) (-1040.117) (-1040.747) -- 0:00:20
201000 -- (-1038.206) (-1044.337) [-1039.002] (-1042.768) * [-1038.112] (-1042.533) (-1041.903) (-1040.798) -- 0:00:20
201500 -- (-1041.761) [-1041.167] (-1040.528) (-1042.261) * [-1038.011] (-1040.365) (-1041.779) (-1043.569) -- 0:00:20
202000 -- [-1043.827] (-1043.236) (-1041.900) (-1043.202) * (-1040.928) [-1039.756] (-1043.752) (-1042.823) -- 0:00:20
202500 -- (-1043.979) (-1044.852) [-1040.998] (-1044.059) * (-1041.482) [-1041.231] (-1042.544) (-1040.876) -- 0:00:20
203000 -- (-1040.695) (-1042.549) [-1041.108] (-1045.708) * [-1045.568] (-1042.501) (-1039.928) (-1043.758) -- 0:00:20
203500 -- [-1040.211] (-1040.418) (-1041.038) (-1046.463) * (-1044.248) [-1038.499] (-1040.068) (-1040.947) -- 0:00:20
204000 -- (-1040.302) [-1041.928] (-1040.083) (-1045.312) * (-1044.349) [-1043.064] (-1040.515) (-1043.417) -- 0:00:20
204500 -- (-1041.712) [-1043.400] (-1042.896) (-1043.015) * (-1044.111) (-1040.858) [-1039.397] (-1045.374) -- 0:00:20
205000 -- (-1041.250) [-1041.931] (-1043.706) (-1042.543) * (-1042.399) [-1042.451] (-1038.823) (-1044.437) -- 0:00:20
Average standard deviation of split frequencies: 0.016741
205500 -- (-1041.135) (-1042.393) (-1042.471) [-1041.522] * (-1043.139) (-1050.855) [-1039.871] (-1041.016) -- 0:00:20
206000 -- (-1041.469) (-1040.548) (-1042.784) [-1041.471] * [-1040.783] (-1042.913) (-1044.609) (-1043.134) -- 0:00:21
206500 -- (-1041.122) [-1040.433] (-1041.468) (-1041.535) * (-1040.041) [-1043.847] (-1041.435) (-1041.453) -- 0:00:21
207000 -- (-1040.283) [-1040.708] (-1043.751) (-1041.601) * (-1042.823) (-1042.665) [-1043.439] (-1043.575) -- 0:00:21
207500 -- (-1041.356) (-1040.998) (-1039.811) [-1041.367] * (-1039.747) (-1043.770) [-1040.937] (-1045.844) -- 0:00:21
208000 -- (-1040.074) (-1040.945) [-1039.134] (-1040.310) * (-1044.184) (-1041.717) (-1040.422) [-1040.824] -- 0:00:21
208500 -- (-1042.482) (-1040.061) [-1043.165] (-1044.183) * (-1041.136) (-1048.111) (-1043.964) [-1040.669] -- 0:00:20
209000 -- (-1043.057) [-1045.434] (-1044.239) (-1041.444) * (-1048.560) (-1043.571) [-1039.676] (-1041.200) -- 0:00:20
209500 -- (-1042.181) (-1042.167) (-1039.596) [-1038.666] * (-1040.766) (-1045.756) (-1044.284) [-1041.087] -- 0:00:20
210000 -- [-1042.281] (-1040.287) (-1039.760) (-1039.862) * (-1044.337) (-1041.217) (-1040.952) [-1040.717] -- 0:00:20
Average standard deviation of split frequencies: 0.016017
210500 -- (-1042.600) [-1041.758] (-1037.422) (-1039.045) * [-1043.353] (-1043.982) (-1038.550) (-1040.263) -- 0:00:20
211000 -- (-1044.462) (-1039.670) [-1038.245] (-1039.023) * (-1040.553) [-1043.220] (-1039.723) (-1041.067) -- 0:00:20
211500 -- (-1050.509) [-1042.150] (-1042.927) (-1040.851) * (-1040.131) (-1049.570) [-1040.640] (-1042.786) -- 0:00:20
212000 -- (-1046.354) (-1041.294) [-1039.420] (-1041.445) * [-1041.623] (-1039.422) (-1040.181) (-1040.867) -- 0:00:20
212500 -- (-1043.426) [-1042.299] (-1041.773) (-1039.776) * (-1042.679) (-1042.123) [-1039.211] (-1040.405) -- 0:00:20
213000 -- (-1040.104) [-1042.634] (-1041.786) (-1040.934) * [-1042.911] (-1040.483) (-1041.091) (-1044.773) -- 0:00:20
213500 -- (-1042.083) (-1045.806) (-1042.885) [-1040.521] * [-1040.374] (-1043.132) (-1039.803) (-1042.028) -- 0:00:20
214000 -- (-1041.551) [-1040.894] (-1038.277) (-1039.063) * (-1041.465) (-1045.461) (-1039.805) [-1041.795] -- 0:00:20
214500 -- (-1039.951) [-1039.697] (-1038.521) (-1041.462) * (-1042.030) (-1041.107) [-1040.078] (-1045.421) -- 0:00:19
215000 -- (-1042.178) (-1042.844) [-1040.315] (-1044.119) * [-1039.609] (-1040.811) (-1041.098) (-1041.340) -- 0:00:19
Average standard deviation of split frequencies: 0.017000
215500 -- (-1040.291) [-1044.237] (-1040.250) (-1042.582) * (-1043.096) (-1046.044) [-1041.060] (-1042.576) -- 0:00:19
216000 -- (-1042.146) [-1042.943] (-1042.145) (-1043.522) * [-1043.803] (-1040.458) (-1039.622) (-1042.658) -- 0:00:19
216500 -- (-1041.644) (-1041.203) [-1040.645] (-1041.234) * (-1045.510) (-1042.072) [-1042.032] (-1039.332) -- 0:00:19
217000 -- [-1042.133] (-1045.888) (-1040.116) (-1040.890) * (-1041.058) [-1042.481] (-1042.851) (-1040.414) -- 0:00:19
217500 -- (-1042.297) (-1044.165) (-1041.499) [-1042.242] * (-1038.999) [-1042.339] (-1041.060) (-1041.439) -- 0:00:19
218000 -- [-1040.430] (-1042.430) (-1041.775) (-1040.409) * (-1047.041) (-1041.761) (-1037.933) [-1041.068] -- 0:00:19
218500 -- (-1043.463) (-1045.052) (-1040.902) [-1038.802] * (-1041.400) (-1041.045) [-1042.907] (-1040.819) -- 0:00:19
219000 -- (-1041.523) (-1045.425) (-1043.522) [-1043.011] * [-1040.386] (-1040.084) (-1043.075) (-1042.924) -- 0:00:19
219500 -- (-1043.636) [-1044.016] (-1043.519) (-1040.266) * (-1038.764) (-1040.427) (-1042.147) [-1041.442] -- 0:00:19
220000 -- [-1043.325] (-1042.942) (-1039.518) (-1039.196) * [-1038.984] (-1039.077) (-1044.181) (-1043.799) -- 0:00:20
Average standard deviation of split frequencies: 0.016303
220500 -- (-1043.552) (-1041.140) (-1040.666) [-1039.725] * [-1040.770] (-1041.626) (-1041.188) (-1040.352) -- 0:00:20
221000 -- (-1042.647) [-1041.480] (-1040.005) (-1044.695) * (-1045.318) (-1042.731) (-1040.307) [-1041.588] -- 0:00:20
221500 -- (-1045.798) (-1043.328) (-1044.914) [-1043.786] * (-1040.208) (-1045.316) [-1037.000] (-1044.089) -- 0:00:20
222000 -- (-1040.329) (-1042.462) (-1048.093) [-1038.986] * [-1042.823] (-1041.476) (-1040.941) (-1042.713) -- 0:00:20
222500 -- [-1042.795] (-1043.174) (-1046.131) (-1042.257) * (-1041.425) [-1041.017] (-1041.887) (-1042.874) -- 0:00:19
223000 -- (-1038.568) [-1043.655] (-1042.268) (-1044.033) * (-1042.596) (-1038.368) [-1040.700] (-1042.930) -- 0:00:19
223500 -- (-1041.051) (-1044.386) [-1042.540] (-1048.091) * (-1042.022) (-1042.181) (-1043.481) [-1042.406] -- 0:00:19
224000 -- (-1040.676) (-1042.898) [-1042.531] (-1041.211) * (-1041.650) (-1041.317) (-1041.665) [-1041.158] -- 0:00:19
224500 -- [-1041.947] (-1046.151) (-1044.987) (-1043.755) * (-1042.344) [-1042.099] (-1041.931) (-1042.720) -- 0:00:19
225000 -- (-1042.107) [-1042.559] (-1043.566) (-1044.002) * (-1041.976) (-1041.670) (-1041.872) [-1043.798] -- 0:00:19
Average standard deviation of split frequencies: 0.015260
225500 -- (-1042.829) (-1041.708) [-1040.491] (-1043.739) * (-1040.597) (-1040.001) [-1041.602] (-1041.599) -- 0:00:19
226000 -- (-1044.335) (-1045.547) (-1043.477) [-1041.753] * [-1040.725] (-1048.905) (-1042.955) (-1043.348) -- 0:00:19
226500 -- (-1042.546) [-1041.818] (-1040.186) (-1042.157) * (-1040.279) [-1038.780] (-1042.493) (-1042.028) -- 0:00:19
227000 -- [-1044.449] (-1040.724) (-1044.442) (-1043.258) * (-1039.759) [-1039.220] (-1039.390) (-1043.956) -- 0:00:19
227500 -- (-1039.791) [-1042.919] (-1040.887) (-1042.249) * (-1043.992) (-1040.242) (-1043.009) [-1043.774] -- 0:00:19
228000 -- (-1042.135) (-1042.188) (-1044.179) [-1045.957] * (-1041.574) (-1048.144) (-1042.728) [-1043.293] -- 0:00:19
228500 -- (-1040.993) [-1043.282] (-1043.485) (-1046.637) * (-1040.303) [-1045.414] (-1042.004) (-1043.791) -- 0:00:19
229000 -- (-1047.512) [-1041.644] (-1042.210) (-1043.262) * (-1043.293) (-1042.174) [-1041.387] (-1039.846) -- 0:00:18
229500 -- (-1045.905) [-1038.659] (-1041.876) (-1042.289) * (-1039.623) (-1041.247) [-1039.330] (-1041.206) -- 0:00:18
230000 -- (-1044.075) (-1040.312) [-1041.187] (-1042.579) * (-1039.632) (-1040.149) (-1040.708) [-1042.628] -- 0:00:18
Average standard deviation of split frequencies: 0.015059
230500 -- [-1046.000] (-1041.021) (-1048.599) (-1044.475) * (-1042.534) (-1039.439) (-1036.849) [-1041.701] -- 0:00:18
231000 -- (-1041.919) (-1043.417) [-1041.814] (-1043.708) * (-1043.152) (-1041.022) [-1038.661] (-1040.788) -- 0:00:18
231500 -- (-1039.772) (-1044.284) (-1041.007) [-1041.540] * (-1045.792) [-1040.980] (-1041.709) (-1041.207) -- 0:00:18
232000 -- [-1041.327] (-1040.946) (-1043.307) (-1047.054) * [-1042.618] (-1041.832) (-1039.010) (-1043.044) -- 0:00:18
232500 -- (-1042.639) [-1038.488] (-1040.836) (-1042.113) * (-1045.431) (-1047.687) [-1040.666] (-1042.787) -- 0:00:18
233000 -- (-1042.502) (-1040.727) (-1042.330) [-1042.360] * [-1048.377] (-1046.001) (-1040.175) (-1043.313) -- 0:00:18
233500 -- (-1043.781) (-1039.796) [-1040.002] (-1041.940) * (-1045.181) (-1044.256) [-1042.037] (-1042.922) -- 0:00:19
234000 -- (-1040.862) (-1037.778) [-1040.892] (-1045.926) * (-1046.549) (-1041.031) [-1040.879] (-1043.013) -- 0:00:19
234500 -- (-1040.362) (-1039.659) (-1044.405) [-1040.691] * (-1047.601) (-1041.634) [-1039.397] (-1044.015) -- 0:00:19
235000 -- (-1040.471) [-1039.830] (-1043.291) (-1041.382) * (-1042.836) (-1043.688) [-1041.072] (-1040.701) -- 0:00:19
Average standard deviation of split frequencies: 0.015139
235500 -- (-1042.935) (-1042.568) [-1041.764] (-1040.998) * [-1041.560] (-1046.446) (-1037.964) (-1041.782) -- 0:00:19
236000 -- (-1040.932) (-1042.636) [-1040.415] (-1040.594) * (-1041.524) [-1040.754] (-1041.400) (-1042.367) -- 0:00:19
236500 -- (-1041.556) [-1040.805] (-1040.595) (-1042.561) * [-1042.902] (-1042.676) (-1045.718) (-1043.943) -- 0:00:18
237000 -- [-1040.845] (-1041.208) (-1041.827) (-1041.555) * (-1043.504) (-1042.676) [-1041.347] (-1039.577) -- 0:00:18
237500 -- (-1038.704) (-1043.506) (-1045.794) [-1041.392] * (-1041.124) (-1043.015) (-1042.752) [-1038.643] -- 0:00:18
238000 -- (-1042.977) (-1044.598) (-1041.313) [-1043.760] * (-1043.395) (-1042.665) (-1042.962) [-1038.534] -- 0:00:18
238500 -- [-1040.477] (-1040.977) (-1039.919) (-1041.298) * (-1043.734) (-1043.212) (-1041.708) [-1042.713] -- 0:00:18
239000 -- [-1040.752] (-1039.684) (-1039.615) (-1044.556) * (-1045.188) [-1043.903] (-1042.281) (-1040.775) -- 0:00:18
239500 -- (-1042.305) (-1043.919) (-1040.730) [-1046.418] * (-1050.377) (-1043.082) (-1043.936) [-1040.325] -- 0:00:18
240000 -- (-1042.678) (-1042.611) (-1042.438) [-1044.345] * (-1044.270) (-1043.866) (-1045.100) [-1041.545] -- 0:00:18
Average standard deviation of split frequencies: 0.014473
240500 -- (-1041.771) (-1042.782) (-1042.993) [-1046.274] * (-1041.563) (-1042.410) [-1041.957] (-1040.635) -- 0:00:18
241000 -- (-1041.252) (-1045.100) (-1054.163) [-1041.429] * [-1041.722] (-1041.939) (-1041.056) (-1041.009) -- 0:00:18
241500 -- (-1042.659) (-1043.078) (-1053.313) [-1042.962] * [-1041.178] (-1041.818) (-1044.673) (-1040.438) -- 0:00:18
242000 -- [-1042.826] (-1043.753) (-1038.273) (-1043.233) * [-1042.943] (-1040.957) (-1043.033) (-1039.466) -- 0:00:18
242500 -- [-1042.180] (-1042.532) (-1041.261) (-1041.911) * (-1042.343) [-1040.913] (-1042.696) (-1040.622) -- 0:00:18
243000 -- (-1040.891) (-1040.038) (-1039.740) [-1041.418] * [-1043.398] (-1042.523) (-1041.107) (-1041.850) -- 0:00:17
243500 -- (-1044.340) (-1039.891) (-1040.833) [-1039.506] * (-1040.875) [-1041.087] (-1042.620) (-1045.412) -- 0:00:17
244000 -- [-1044.504] (-1040.695) (-1042.677) (-1042.514) * (-1044.269) (-1042.585) [-1039.885] (-1042.535) -- 0:00:17
244500 -- [-1040.278] (-1042.676) (-1042.754) (-1039.189) * (-1043.868) [-1040.800] (-1042.316) (-1046.217) -- 0:00:17
245000 -- (-1040.857) (-1042.121) [-1040.445] (-1043.819) * (-1044.776) (-1042.738) (-1043.523) [-1047.286] -- 0:00:17
Average standard deviation of split frequencies: 0.011599
245500 -- (-1041.378) [-1040.625] (-1040.520) (-1042.550) * [-1040.532] (-1047.424) (-1039.578) (-1048.228) -- 0:00:17
246000 -- (-1042.921) (-1041.743) [-1041.856] (-1044.332) * [-1041.771] (-1044.103) (-1041.832) (-1042.586) -- 0:00:17
246500 -- (-1042.977) [-1039.904] (-1041.651) (-1040.495) * (-1038.675) [-1040.457] (-1042.460) (-1040.424) -- 0:00:17
247000 -- (-1042.701) [-1040.463] (-1041.790) (-1040.373) * (-1043.956) (-1039.965) (-1050.794) [-1042.349] -- 0:00:17
247500 -- (-1043.147) [-1041.232] (-1041.994) (-1042.306) * [-1040.791] (-1040.374) (-1043.703) (-1042.686) -- 0:00:17
248000 -- [-1044.228] (-1041.780) (-1040.557) (-1047.721) * (-1040.233) (-1042.235) [-1045.692] (-1041.572) -- 0:00:18
248500 -- (-1050.049) [-1039.921] (-1041.209) (-1041.981) * [-1040.974] (-1043.528) (-1039.976) (-1042.066) -- 0:00:18
249000 -- (-1042.877) (-1042.980) [-1040.647] (-1041.748) * (-1043.375) (-1039.451) [-1042.106] (-1043.427) -- 0:00:18
249500 -- (-1044.649) [-1041.339] (-1043.568) (-1043.254) * (-1041.489) [-1039.735] (-1042.194) (-1040.838) -- 0:00:18
250000 -- (-1043.959) (-1042.541) [-1043.568] (-1045.330) * (-1039.469) [-1043.192] (-1043.887) (-1041.808) -- 0:00:18
Average standard deviation of split frequencies: 0.010987
250500 -- (-1043.433) (-1043.204) (-1044.996) [-1042.318] * (-1038.890) (-1044.788) [-1041.090] (-1050.802) -- 0:00:17
251000 -- (-1041.911) (-1040.268) (-1042.317) [-1042.605] * [-1039.119] (-1043.414) (-1041.749) (-1045.425) -- 0:00:17
251500 -- (-1041.241) (-1042.490) (-1043.332) [-1041.270] * (-1041.044) [-1042.836] (-1042.660) (-1042.012) -- 0:00:17
252000 -- (-1041.652) (-1042.028) [-1041.368] (-1041.283) * (-1040.829) (-1039.660) [-1043.958] (-1044.077) -- 0:00:17
252500 -- (-1041.964) [-1041.407] (-1042.636) (-1043.863) * (-1042.250) [-1040.137] (-1041.941) (-1041.793) -- 0:00:17
253000 -- [-1042.565] (-1041.431) (-1040.624) (-1042.199) * [-1040.865] (-1041.928) (-1043.122) (-1040.981) -- 0:00:17
253500 -- (-1045.544) [-1042.825] (-1041.699) (-1042.597) * (-1038.650) [-1042.867] (-1042.511) (-1042.220) -- 0:00:17
254000 -- [-1043.952] (-1043.756) (-1041.546) (-1040.876) * (-1047.573) (-1042.446) [-1040.988] (-1044.990) -- 0:00:17
254500 -- [-1042.930] (-1042.128) (-1038.819) (-1044.830) * (-1045.757) (-1041.880) (-1040.834) [-1040.071] -- 0:00:17
255000 -- (-1042.931) [-1042.838] (-1042.831) (-1042.650) * (-1046.171) (-1040.311) (-1042.357) [-1041.225] -- 0:00:17
Average standard deviation of split frequencies: 0.011242
255500 -- [-1040.988] (-1044.621) (-1042.690) (-1043.046) * [-1042.649] (-1042.684) (-1040.835) (-1042.408) -- 0:00:17
256000 -- (-1041.422) (-1043.066) (-1042.656) [-1042.756] * (-1044.491) (-1041.323) (-1041.367) [-1044.346] -- 0:00:17
256500 -- (-1041.965) [-1042.541] (-1043.183) (-1042.631) * [-1041.021] (-1040.187) (-1044.456) (-1045.290) -- 0:00:17
257000 -- (-1042.577) [-1039.059] (-1043.537) (-1043.659) * (-1045.658) (-1042.282) (-1039.965) [-1042.029] -- 0:00:17
257500 -- (-1042.318) (-1038.572) (-1044.380) [-1044.465] * (-1044.115) (-1042.074) [-1044.022] (-1045.052) -- 0:00:16
258000 -- (-1043.533) (-1040.060) [-1044.992] (-1044.089) * (-1044.268) [-1042.173] (-1041.728) (-1040.551) -- 0:00:16
258500 -- [-1045.220] (-1043.586) (-1042.970) (-1043.177) * [-1044.595] (-1041.197) (-1038.467) (-1041.001) -- 0:00:16
259000 -- (-1043.325) (-1048.984) (-1039.940) [-1041.855] * [-1039.593] (-1042.077) (-1045.470) (-1039.807) -- 0:00:16
259500 -- [-1043.676] (-1043.052) (-1040.455) (-1043.769) * (-1040.815) [-1037.597] (-1047.284) (-1041.281) -- 0:00:16
260000 -- (-1044.637) (-1046.843) (-1040.629) [-1039.282] * (-1040.050) (-1038.525) [-1044.624] (-1041.025) -- 0:00:16
Average standard deviation of split frequencies: 0.012374
260500 -- (-1042.123) (-1047.098) (-1038.352) [-1040.924] * [-1039.861] (-1041.731) (-1041.797) (-1041.256) -- 0:00:16
261000 -- (-1043.747) (-1042.876) [-1039.619] (-1042.612) * [-1039.856] (-1040.907) (-1040.956) (-1041.359) -- 0:00:16
261500 -- [-1045.268] (-1044.241) (-1040.032) (-1042.679) * (-1042.098) [-1038.320] (-1039.117) (-1044.610) -- 0:00:17
262000 -- (-1042.607) (-1041.508) [-1040.591] (-1041.372) * (-1040.663) [-1039.843] (-1040.628) (-1042.585) -- 0:00:17
262500 -- [-1042.497] (-1042.076) (-1042.711) (-1039.625) * (-1040.844) (-1041.978) [-1039.539] (-1042.484) -- 0:00:17
263000 -- [-1041.493] (-1045.829) (-1046.097) (-1041.126) * [-1040.414] (-1038.732) (-1041.076) (-1043.963) -- 0:00:17
263500 -- (-1041.986) (-1042.848) [-1044.056] (-1040.762) * [-1040.714] (-1045.062) (-1043.927) (-1042.419) -- 0:00:17
264000 -- (-1041.614) (-1042.081) [-1046.333] (-1046.282) * [-1040.711] (-1041.720) (-1040.606) (-1043.748) -- 0:00:16
264500 -- (-1041.021) (-1042.013) [-1047.379] (-1043.508) * (-1041.185) [-1036.936] (-1040.978) (-1043.134) -- 0:00:16
265000 -- (-1042.110) (-1042.519) [-1042.443] (-1040.091) * (-1041.060) [-1041.332] (-1040.482) (-1043.361) -- 0:00:16
Average standard deviation of split frequencies: 0.010820
265500 -- (-1042.040) (-1042.071) (-1040.263) [-1038.110] * (-1043.901) [-1042.244] (-1044.120) (-1042.184) -- 0:00:16
266000 -- (-1041.676) (-1040.579) (-1038.355) [-1039.144] * (-1040.865) (-1044.673) [-1041.257] (-1042.091) -- 0:00:16
266500 -- (-1043.579) (-1040.687) (-1044.423) [-1040.255] * (-1041.308) [-1043.913] (-1044.353) (-1042.394) -- 0:00:16
267000 -- (-1040.234) (-1044.594) (-1040.854) [-1040.323] * (-1040.023) (-1041.929) [-1040.557] (-1045.084) -- 0:00:16
267500 -- (-1042.691) (-1041.330) (-1041.281) [-1041.378] * (-1042.366) [-1041.890] (-1041.681) (-1041.742) -- 0:00:16
268000 -- (-1048.821) [-1040.428] (-1041.642) (-1040.959) * (-1041.658) [-1044.221] (-1040.535) (-1041.014) -- 0:00:16
268500 -- (-1043.085) [-1042.687] (-1039.655) (-1039.998) * (-1041.303) (-1039.445) [-1040.562] (-1041.580) -- 0:00:16
269000 -- (-1042.215) (-1042.591) [-1041.127] (-1038.838) * [-1041.343] (-1041.754) (-1042.749) (-1042.181) -- 0:00:16
269500 -- [-1041.181] (-1041.481) (-1047.584) (-1047.048) * [-1039.750] (-1041.788) (-1044.232) (-1042.080) -- 0:00:16
270000 -- (-1041.360) (-1038.367) [-1041.499] (-1039.677) * [-1041.477] (-1041.033) (-1039.354) (-1041.268) -- 0:00:16
Average standard deviation of split frequencies: 0.010908
270500 -- (-1039.727) (-1040.805) (-1040.585) [-1039.138] * (-1039.995) (-1042.676) [-1041.178] (-1041.271) -- 0:00:16
271000 -- (-1042.294) (-1042.165) (-1042.000) [-1040.119] * (-1044.736) [-1041.675] (-1040.549) (-1042.017) -- 0:00:16
271500 -- (-1040.475) (-1040.734) (-1041.030) [-1040.516] * (-1047.878) (-1039.556) [-1041.002] (-1041.598) -- 0:00:15
272000 -- [-1040.797] (-1042.514) (-1040.194) (-1042.387) * (-1043.982) [-1044.423] (-1037.705) (-1044.431) -- 0:00:15
272500 -- [-1040.340] (-1041.292) (-1047.314) (-1045.923) * (-1043.152) (-1040.983) [-1038.516] (-1043.029) -- 0:00:15
273000 -- [-1040.334] (-1041.571) (-1043.409) (-1041.172) * (-1040.343) (-1043.212) (-1041.257) [-1042.086] -- 0:00:15
273500 -- (-1041.492) (-1039.947) (-1042.116) [-1044.868] * (-1043.893) [-1043.674] (-1041.522) (-1039.842) -- 0:00:15
274000 -- (-1041.943) [-1039.456] (-1043.936) (-1043.189) * [-1038.861] (-1045.683) (-1041.054) (-1043.192) -- 0:00:15
274500 -- [-1041.037] (-1042.544) (-1042.787) (-1041.450) * (-1043.241) (-1040.897) [-1042.312] (-1042.491) -- 0:00:15
275000 -- (-1039.923) [-1042.683] (-1043.520) (-1041.036) * (-1043.456) (-1041.376) [-1039.565] (-1045.882) -- 0:00:15
Average standard deviation of split frequencies: 0.011686
275500 -- (-1040.737) (-1040.405) (-1042.349) [-1044.498] * (-1043.102) (-1043.017) (-1038.885) [-1043.784] -- 0:00:16
276000 -- (-1045.414) (-1041.283) [-1043.718] (-1043.909) * (-1041.176) (-1043.390) [-1038.488] (-1043.776) -- 0:00:16
276500 -- (-1041.598) (-1041.657) [-1045.575] (-1040.539) * (-1043.943) (-1044.650) [-1039.826] (-1042.487) -- 0:00:16
277000 -- (-1042.788) (-1041.480) (-1046.690) [-1040.984] * (-1044.809) (-1042.148) (-1041.299) [-1041.785] -- 0:00:16
277500 -- (-1042.837) (-1043.650) [-1041.575] (-1045.282) * (-1041.949) [-1038.399] (-1040.290) (-1040.918) -- 0:00:16
278000 -- (-1044.019) (-1043.229) (-1039.062) [-1041.606] * [-1041.063] (-1040.578) (-1040.397) (-1043.018) -- 0:00:15
278500 -- (-1043.289) (-1041.446) (-1041.505) [-1043.397] * (-1048.348) (-1042.538) [-1040.254] (-1039.967) -- 0:00:15
279000 -- (-1042.949) (-1043.401) [-1040.541] (-1041.591) * (-1041.491) (-1043.441) (-1044.389) [-1040.518] -- 0:00:15
279500 -- (-1042.574) (-1041.610) [-1043.141] (-1042.279) * (-1042.316) (-1043.379) (-1045.222) [-1043.245] -- 0:00:15
280000 -- [-1045.522] (-1041.687) (-1043.631) (-1040.327) * (-1042.395) [-1040.208] (-1044.755) (-1038.262) -- 0:00:15
Average standard deviation of split frequencies: 0.011669
280500 -- (-1044.552) (-1041.840) (-1042.861) [-1038.613] * (-1043.339) (-1040.586) (-1040.359) [-1043.125] -- 0:00:15
281000 -- (-1041.905) [-1043.015] (-1040.990) (-1041.579) * (-1038.131) [-1040.601] (-1042.777) (-1039.410) -- 0:00:15
281500 -- [-1039.621] (-1041.970) (-1041.382) (-1043.521) * (-1041.434) (-1041.814) [-1040.640] (-1043.421) -- 0:00:15
282000 -- [-1042.993] (-1043.123) (-1040.889) (-1037.997) * [-1041.749] (-1044.034) (-1040.800) (-1043.287) -- 0:00:15
282500 -- (-1041.424) [-1041.366] (-1042.089) (-1048.873) * (-1042.250) (-1042.414) (-1044.453) [-1042.528] -- 0:00:15
283000 -- (-1043.959) (-1042.007) (-1040.434) [-1044.200] * [-1041.240] (-1041.191) (-1043.833) (-1042.139) -- 0:00:15
283500 -- (-1041.063) [-1041.538] (-1041.168) (-1041.657) * (-1042.417) (-1041.252) [-1042.884] (-1044.584) -- 0:00:15
284000 -- (-1040.885) (-1040.527) (-1043.877) [-1043.966] * [-1042.135] (-1041.815) (-1042.039) (-1043.772) -- 0:00:15
284500 -- [-1041.377] (-1042.820) (-1041.171) (-1044.137) * (-1040.158) (-1040.733) (-1041.740) [-1044.469] -- 0:00:15
285000 -- (-1042.449) (-1042.165) (-1045.930) [-1042.777] * (-1041.215) (-1042.434) (-1040.211) [-1042.331] -- 0:00:15
Average standard deviation of split frequencies: 0.012058
285500 -- (-1042.440) (-1042.474) [-1042.392] (-1043.978) * (-1042.607) (-1040.931) [-1040.099] (-1041.615) -- 0:00:15
286000 -- [-1044.765] (-1042.195) (-1041.271) (-1042.239) * (-1043.080) (-1041.486) (-1041.033) [-1040.654] -- 0:00:14
286500 -- (-1044.279) (-1041.225) (-1042.767) [-1040.932] * (-1043.142) [-1042.779] (-1042.132) (-1042.972) -- 0:00:14
287000 -- (-1045.605) (-1043.226) [-1042.008] (-1039.988) * (-1042.383) (-1039.869) [-1040.656] (-1043.643) -- 0:00:14
287500 -- (-1042.645) [-1042.133] (-1038.580) (-1043.183) * (-1041.661) (-1039.319) (-1040.768) [-1045.029] -- 0:00:14
288000 -- [-1044.514] (-1041.647) (-1040.827) (-1042.072) * (-1041.438) (-1041.394) (-1041.099) [-1041.215] -- 0:00:14
288500 -- (-1042.569) [-1042.598] (-1041.279) (-1045.448) * (-1041.704) (-1042.415) (-1039.700) [-1040.587] -- 0:00:14
289000 -- (-1040.433) (-1041.238) (-1041.150) [-1043.788] * (-1042.713) (-1041.819) [-1041.133] (-1044.458) -- 0:00:14
289500 -- (-1040.639) (-1044.603) (-1038.604) [-1041.193] * [-1041.469] (-1041.596) (-1042.193) (-1041.906) -- 0:00:14
290000 -- [-1040.067] (-1043.830) (-1041.894) (-1043.085) * (-1045.264) (-1041.564) (-1043.299) [-1038.691] -- 0:00:14
Average standard deviation of split frequencies: 0.012462
290500 -- (-1040.214) (-1044.297) [-1039.186] (-1041.837) * (-1042.440) (-1044.008) [-1043.372] (-1043.523) -- 0:00:15
291000 -- (-1039.787) (-1039.095) (-1043.604) [-1042.755] * (-1042.841) [-1044.588] (-1043.473) (-1044.451) -- 0:00:15
291500 -- (-1044.865) (-1042.855) (-1041.791) [-1039.635] * [-1044.415] (-1043.279) (-1041.677) (-1043.415) -- 0:00:15
292000 -- (-1041.385) (-1040.754) (-1041.338) [-1043.503] * (-1043.744) [-1042.603] (-1040.789) (-1041.759) -- 0:00:14
292500 -- (-1041.001) (-1040.738) [-1041.503] (-1041.185) * (-1043.586) (-1043.520) (-1040.215) [-1040.182] -- 0:00:14
293000 -- (-1040.802) (-1041.173) [-1042.604] (-1041.364) * [-1045.256] (-1044.151) (-1041.252) (-1043.217) -- 0:00:14
293500 -- (-1039.603) (-1040.902) [-1044.648] (-1039.398) * (-1042.787) (-1038.504) [-1044.438] (-1042.934) -- 0:00:14
294000 -- (-1042.355) [-1043.113] (-1048.165) (-1041.523) * [-1041.229] (-1041.198) (-1041.271) (-1045.531) -- 0:00:14
294500 -- [-1039.436] (-1042.070) (-1042.737) (-1039.296) * (-1040.848) (-1043.880) (-1042.009) [-1040.288] -- 0:00:14
295000 -- [-1040.695] (-1043.587) (-1044.404) (-1039.258) * (-1040.603) (-1042.189) (-1041.616) [-1043.683] -- 0:00:14
Average standard deviation of split frequencies: 0.012154
295500 -- (-1042.271) (-1040.883) [-1043.075] (-1048.067) * [-1042.084] (-1043.709) (-1042.425) (-1042.454) -- 0:00:14
296000 -- (-1042.476) [-1039.818] (-1046.119) (-1043.847) * [-1046.479] (-1039.795) (-1042.956) (-1041.837) -- 0:00:14
296500 -- (-1039.964) [-1042.205] (-1048.138) (-1040.072) * [-1047.767] (-1047.381) (-1041.261) (-1042.051) -- 0:00:14
297000 -- (-1045.617) (-1042.810) [-1044.539] (-1039.773) * (-1042.452) (-1043.266) (-1042.672) [-1041.043] -- 0:00:14
297500 -- (-1046.515) (-1045.011) (-1044.633) [-1039.173] * (-1042.497) (-1042.309) [-1042.438] (-1040.617) -- 0:00:14
298000 -- (-1040.888) (-1043.010) (-1044.533) [-1040.659] * [-1044.596] (-1042.829) (-1041.387) (-1041.159) -- 0:00:14
298500 -- [-1043.287] (-1044.234) (-1044.152) (-1040.071) * (-1043.894) [-1042.733] (-1042.437) (-1039.491) -- 0:00:14
299000 -- (-1040.867) (-1044.158) (-1044.096) [-1038.733] * (-1041.400) [-1041.327] (-1041.928) (-1039.040) -- 0:00:14
299500 -- (-1042.410) (-1041.098) (-1042.154) [-1042.361] * (-1040.152) (-1041.545) [-1040.799] (-1041.077) -- 0:00:14
300000 -- (-1040.400) (-1043.460) (-1040.548) [-1038.607] * [-1041.202] (-1041.066) (-1041.448) (-1040.316) -- 0:00:13
Average standard deviation of split frequencies: 0.011718
300500 -- (-1039.630) [-1045.642] (-1041.810) (-1043.091) * (-1040.944) [-1038.927] (-1042.913) (-1042.331) -- 0:00:13
301000 -- (-1051.654) [-1042.449] (-1040.982) (-1041.093) * (-1042.175) (-1041.048) [-1044.073] (-1042.987) -- 0:00:13
301500 -- (-1041.389) [-1041.628] (-1042.142) (-1041.697) * (-1042.968) (-1040.558) [-1042.730] (-1042.653) -- 0:00:13
302000 -- (-1042.316) (-1040.966) [-1040.181] (-1041.809) * [-1042.902] (-1042.964) (-1045.073) (-1039.586) -- 0:00:13
302500 -- (-1042.776) [-1043.018] (-1041.530) (-1044.944) * (-1042.470) [-1039.812] (-1044.405) (-1038.542) -- 0:00:13
303000 -- [-1041.581] (-1041.126) (-1040.323) (-1046.251) * (-1040.126) (-1040.983) (-1042.551) [-1044.549] -- 0:00:13
303500 -- [-1041.498] (-1045.039) (-1040.718) (-1047.894) * (-1040.660) (-1040.547) (-1041.941) [-1041.812] -- 0:00:13
304000 -- (-1042.912) (-1043.432) [-1042.230] (-1042.518) * (-1043.163) [-1041.226] (-1042.560) (-1041.912) -- 0:00:13
304500 -- (-1040.392) (-1042.991) [-1041.886] (-1039.660) * (-1043.845) (-1041.511) (-1041.110) [-1040.315] -- 0:00:13
305000 -- [-1040.653] (-1043.432) (-1041.931) (-1041.539) * (-1042.199) (-1038.658) [-1040.465] (-1042.977) -- 0:00:13
Average standard deviation of split frequencies: 0.011189
305500 -- [-1041.143] (-1044.464) (-1041.606) (-1045.597) * (-1039.172) (-1041.125) (-1043.760) [-1041.476] -- 0:00:14
306000 -- (-1041.622) (-1044.727) (-1042.731) [-1043.710] * (-1043.506) (-1040.421) [-1042.216] (-1041.366) -- 0:00:13
306500 -- (-1041.002) (-1043.058) [-1047.210] (-1040.070) * (-1040.898) (-1038.301) (-1040.971) [-1040.766] -- 0:00:13
307000 -- (-1038.617) (-1042.187) (-1043.806) [-1037.983] * (-1040.435) (-1041.918) (-1037.231) [-1041.002] -- 0:00:13
307500 -- (-1040.499) (-1046.930) [-1042.284] (-1039.040) * (-1046.298) (-1042.584) [-1038.898] (-1039.445) -- 0:00:13
308000 -- (-1041.531) [-1042.866] (-1043.480) (-1040.741) * (-1041.326) [-1041.036] (-1041.045) (-1041.527) -- 0:00:13
308500 -- (-1040.633) [-1041.044] (-1043.478) (-1043.034) * (-1042.037) (-1040.794) [-1039.912] (-1043.229) -- 0:00:13
309000 -- (-1039.373) [-1038.391] (-1044.276) (-1042.512) * (-1040.698) (-1048.055) [-1039.306] (-1041.512) -- 0:00:13
309500 -- [-1040.066] (-1037.858) (-1041.382) (-1039.412) * [-1040.863] (-1038.804) (-1041.234) (-1042.877) -- 0:00:13
310000 -- (-1038.494) (-1041.830) (-1043.919) [-1041.165] * (-1040.613) (-1042.996) [-1041.907] (-1042.717) -- 0:00:13
Average standard deviation of split frequencies: 0.011021
310500 -- (-1043.047) (-1041.188) (-1042.017) [-1039.956] * [-1040.311] (-1041.580) (-1039.984) (-1038.833) -- 0:00:13
311000 -- (-1042.010) [-1041.219] (-1043.078) (-1043.227) * [-1041.894] (-1040.928) (-1038.982) (-1042.610) -- 0:00:13
311500 -- [-1040.126] (-1042.386) (-1040.562) (-1044.593) * (-1038.785) [-1040.856] (-1040.750) (-1041.181) -- 0:00:13
312000 -- [-1042.632] (-1042.711) (-1044.164) (-1041.071) * [-1039.390] (-1040.963) (-1041.482) (-1042.314) -- 0:00:13
312500 -- (-1045.255) (-1042.571) [-1042.400] (-1041.879) * (-1043.157) (-1040.307) (-1040.836) [-1040.817] -- 0:00:13
313000 -- (-1039.844) [-1042.390] (-1042.338) (-1043.297) * (-1046.010) [-1040.240] (-1040.730) (-1040.815) -- 0:00:13
313500 -- (-1041.346) (-1041.291) (-1041.487) [-1043.611] * [-1042.868] (-1040.787) (-1042.379) (-1042.738) -- 0:00:13
314000 -- (-1048.181) (-1041.286) [-1042.576] (-1041.802) * (-1041.425) (-1041.795) (-1041.544) [-1042.072] -- 0:00:13
314500 -- [-1041.102] (-1042.079) (-1041.664) (-1040.886) * (-1040.887) [-1042.513] (-1046.790) (-1045.446) -- 0:00:12
315000 -- (-1042.682) (-1046.749) (-1042.764) [-1044.065] * (-1039.608) (-1042.845) [-1040.814] (-1044.924) -- 0:00:12
Average standard deviation of split frequencies: 0.012091
315500 -- (-1038.596) (-1042.709) [-1039.310] (-1041.275) * (-1042.120) [-1041.915] (-1042.617) (-1045.652) -- 0:00:12
316000 -- (-1041.176) (-1041.799) (-1043.350) [-1040.613] * (-1041.147) (-1039.589) [-1040.514] (-1044.364) -- 0:00:12
316500 -- (-1042.665) (-1042.130) (-1042.887) [-1043.819] * (-1041.651) (-1042.280) [-1038.916] (-1042.775) -- 0:00:12
317000 -- (-1040.170) (-1045.146) (-1043.115) [-1039.671] * (-1041.709) [-1040.758] (-1038.874) (-1038.548) -- 0:00:12
317500 -- (-1042.709) (-1041.754) (-1040.930) [-1040.146] * (-1038.034) (-1042.240) (-1041.490) [-1042.236] -- 0:00:12
318000 -- (-1041.821) (-1040.722) (-1041.581) [-1044.828] * (-1044.390) [-1046.239] (-1041.469) (-1042.739) -- 0:00:12
318500 -- (-1042.706) (-1044.514) [-1040.573] (-1040.368) * (-1041.722) (-1043.482) (-1043.027) [-1042.505] -- 0:00:12
319000 -- (-1042.879) [-1043.457] (-1041.594) (-1041.085) * (-1040.381) (-1041.711) [-1045.346] (-1041.473) -- 0:00:12
319500 -- (-1044.187) (-1039.210) (-1044.093) [-1040.084] * (-1044.370) [-1040.775] (-1040.758) (-1043.738) -- 0:00:12
320000 -- [-1043.519] (-1041.496) (-1040.927) (-1044.773) * [-1040.782] (-1043.754) (-1043.259) (-1044.096) -- 0:00:12
Average standard deviation of split frequencies: 0.012689
320500 -- [-1042.004] (-1040.886) (-1040.391) (-1040.147) * (-1042.325) [-1043.075] (-1046.437) (-1043.939) -- 0:00:12
321000 -- (-1039.760) (-1040.715) (-1042.550) [-1042.237] * (-1042.167) [-1042.691] (-1041.882) (-1046.095) -- 0:00:12
321500 -- (-1041.534) [-1042.028] (-1039.987) (-1041.360) * (-1040.996) (-1040.211) (-1040.528) [-1042.181] -- 0:00:12
322000 -- [-1040.760] (-1042.077) (-1040.930) (-1040.770) * (-1043.075) (-1041.870) [-1045.774] (-1038.393) -- 0:00:12
322500 -- (-1040.704) [-1040.623] (-1044.137) (-1043.643) * (-1043.550) (-1041.581) [-1044.800] (-1039.094) -- 0:00:12
323000 -- (-1040.848) (-1042.469) (-1040.864) [-1042.197] * (-1042.533) [-1041.591] (-1043.403) (-1041.221) -- 0:00:12
323500 -- (-1040.028) (-1042.461) [-1043.888] (-1043.707) * (-1040.807) [-1040.357] (-1044.387) (-1043.671) -- 0:00:12
324000 -- (-1041.536) (-1043.027) [-1042.050] (-1041.786) * [-1041.138] (-1041.269) (-1039.661) (-1040.615) -- 0:00:12
324500 -- (-1041.967) (-1042.445) (-1043.097) [-1040.911] * (-1041.175) (-1043.309) (-1041.090) [-1044.614] -- 0:00:12
325000 -- (-1044.035) (-1044.688) [-1042.094] (-1042.274) * (-1038.273) (-1043.596) [-1041.484] (-1045.632) -- 0:00:12
Average standard deviation of split frequencies: 0.011644
325500 -- (-1042.839) [-1038.545] (-1042.021) (-1038.891) * (-1040.444) (-1045.175) (-1042.770) [-1041.043] -- 0:00:12
326000 -- [-1041.687] (-1039.735) (-1039.536) (-1043.707) * [-1043.566] (-1042.229) (-1041.634) (-1043.168) -- 0:00:12
326500 -- (-1041.390) (-1041.080) (-1039.356) [-1042.776] * [-1039.935] (-1042.078) (-1042.691) (-1043.104) -- 0:00:12
327000 -- (-1042.406) (-1041.379) [-1043.207] (-1044.561) * (-1045.012) (-1042.902) [-1042.842] (-1044.237) -- 0:00:12
327500 -- (-1043.363) [-1041.711] (-1043.099) (-1045.700) * [-1040.684] (-1039.296) (-1042.873) (-1039.381) -- 0:00:12
328000 -- (-1040.119) [-1046.122] (-1044.454) (-1041.298) * (-1040.931) (-1043.726) (-1042.869) [-1040.964] -- 0:00:12
328500 -- [-1041.030] (-1039.565) (-1043.133) (-1041.222) * (-1041.801) (-1041.541) (-1043.297) [-1041.510] -- 0:00:12
329000 -- (-1042.218) (-1042.323) [-1040.928] (-1040.280) * (-1040.987) (-1039.988) (-1043.589) [-1040.416] -- 0:00:11
329500 -- [-1039.482] (-1045.655) (-1041.143) (-1040.934) * (-1043.008) (-1039.758) [-1039.291] (-1044.909) -- 0:00:11
330000 -- (-1039.784) (-1044.480) [-1040.335] (-1039.869) * (-1042.267) (-1040.647) (-1041.070) [-1040.894] -- 0:00:11
Average standard deviation of split frequencies: 0.010354
330500 -- (-1045.544) (-1041.867) (-1043.551) [-1042.044] * (-1044.387) [-1040.345] (-1041.905) (-1040.521) -- 0:00:11
331000 -- [-1041.770] (-1040.827) (-1040.242) (-1041.898) * (-1044.471) [-1043.546] (-1041.203) (-1043.308) -- 0:00:11
331500 -- (-1042.179) (-1046.207) [-1041.519] (-1043.395) * (-1042.617) (-1041.413) [-1039.688] (-1040.390) -- 0:00:11
332000 -- (-1042.160) (-1041.401) (-1042.558) [-1040.344] * [-1040.438] (-1040.737) (-1039.658) (-1038.982) -- 0:00:11
332500 -- (-1043.236) [-1046.005] (-1040.738) (-1042.722) * [-1039.078] (-1042.984) (-1043.002) (-1045.000) -- 0:00:11
333000 -- (-1039.635) [-1041.152] (-1042.062) (-1042.437) * [-1043.235] (-1045.453) (-1040.012) (-1041.963) -- 0:00:11
333500 -- (-1044.948) [-1045.082] (-1041.272) (-1042.647) * (-1040.959) [-1041.536] (-1041.572) (-1041.260) -- 0:00:11
334000 -- (-1043.567) [-1041.645] (-1043.003) (-1043.226) * (-1042.228) [-1043.088] (-1041.691) (-1039.214) -- 0:00:11
334500 -- (-1044.770) [-1042.158] (-1042.123) (-1041.090) * (-1042.930) [-1039.665] (-1041.237) (-1042.499) -- 0:00:11
335000 -- (-1042.866) (-1043.470) (-1041.051) [-1041.597] * (-1045.566) [-1040.920] (-1041.008) (-1041.034) -- 0:00:11
Average standard deviation of split frequencies: 0.010633
335500 -- [-1044.018] (-1041.451) (-1041.479) (-1042.030) * (-1045.033) (-1040.970) [-1041.550] (-1045.518) -- 0:00:11
336000 -- (-1040.299) (-1046.784) [-1041.153] (-1043.674) * [-1042.941] (-1039.327) (-1043.284) (-1042.344) -- 0:00:11
336500 -- (-1040.475) (-1041.641) [-1038.132] (-1041.410) * (-1044.737) [-1040.477] (-1047.069) (-1039.192) -- 0:00:11
337000 -- (-1040.075) (-1040.153) [-1040.333] (-1042.657) * (-1041.406) (-1040.437) (-1040.361) [-1038.751] -- 0:00:11
337500 -- (-1041.830) (-1045.733) [-1038.719] (-1041.538) * (-1041.508) (-1039.157) [-1039.656] (-1041.766) -- 0:00:11
338000 -- (-1043.046) (-1041.546) [-1042.834] (-1043.833) * [-1041.244] (-1042.786) (-1039.954) (-1040.854) -- 0:00:11
338500 -- (-1040.569) (-1041.447) [-1043.466] (-1042.977) * (-1042.241) (-1041.166) (-1041.631) [-1040.488] -- 0:00:11
339000 -- (-1041.380) [-1041.043] (-1041.384) (-1040.769) * (-1040.014) [-1040.080] (-1040.661) (-1041.090) -- 0:00:11
339500 -- (-1041.253) (-1041.088) [-1041.744] (-1040.814) * [-1041.120] (-1039.372) (-1041.291) (-1043.896) -- 0:00:11
340000 -- (-1041.544) (-1044.997) (-1038.853) [-1041.196] * (-1039.777) (-1041.767) (-1040.445) [-1039.629] -- 0:00:11
Average standard deviation of split frequencies: 0.009541
340500 -- (-1042.281) (-1042.030) [-1043.110] (-1039.108) * (-1042.121) (-1045.980) [-1040.213] (-1040.049) -- 0:00:11
341000 -- (-1043.024) (-1042.460) [-1041.364] (-1040.374) * (-1047.454) (-1040.826) [-1042.697] (-1041.093) -- 0:00:11
341500 -- (-1040.096) (-1046.916) [-1040.938] (-1040.737) * (-1045.219) [-1042.242] (-1040.129) (-1043.446) -- 0:00:11
342000 -- (-1040.538) [-1040.528] (-1042.143) (-1042.651) * (-1040.914) [-1040.363] (-1041.207) (-1043.916) -- 0:00:11
342500 -- (-1042.408) (-1044.237) [-1039.154] (-1041.490) * (-1041.956) (-1042.004) (-1042.021) [-1040.312] -- 0:00:11
343000 -- (-1042.005) (-1041.748) (-1044.527) [-1043.769] * (-1038.718) [-1041.934] (-1042.202) (-1040.484) -- 0:00:10
343500 -- [-1045.042] (-1041.001) (-1042.132) (-1048.301) * [-1039.121] (-1042.849) (-1042.423) (-1042.017) -- 0:00:10
344000 -- [-1045.021] (-1043.005) (-1040.874) (-1047.418) * (-1038.925) (-1042.673) [-1043.750] (-1041.519) -- 0:00:10
344500 -- (-1042.091) [-1042.734] (-1043.259) (-1040.606) * [-1037.611] (-1041.926) (-1045.994) (-1041.018) -- 0:00:10
345000 -- (-1040.626) (-1040.423) (-1040.088) [-1044.078] * (-1037.124) [-1040.300] (-1043.136) (-1042.035) -- 0:00:10
Average standard deviation of split frequencies: 0.010326
345500 -- (-1039.419) (-1041.224) [-1037.945] (-1047.450) * (-1039.632) [-1040.973] (-1047.769) (-1042.277) -- 0:00:10
346000 -- (-1043.481) (-1041.616) (-1038.390) [-1039.665] * [-1039.547] (-1039.218) (-1043.806) (-1038.969) -- 0:00:10
346500 -- (-1043.788) [-1041.306] (-1045.674) (-1039.205) * [-1043.437] (-1041.923) (-1045.161) (-1040.400) -- 0:00:10
347000 -- [-1041.343] (-1042.722) (-1042.982) (-1040.526) * (-1045.610) (-1045.391) (-1048.610) [-1037.592] -- 0:00:10
347500 -- (-1043.320) [-1041.331] (-1043.434) (-1038.741) * [-1040.462] (-1046.369) (-1041.439) (-1039.287) -- 0:00:10
348000 -- [-1043.496] (-1039.898) (-1040.057) (-1040.969) * (-1044.275) (-1050.225) (-1046.668) [-1039.595] -- 0:00:10
348500 -- (-1042.743) (-1042.211) [-1041.593] (-1038.691) * (-1040.036) (-1044.750) (-1042.282) [-1041.022] -- 0:00:10
349000 -- [-1039.372] (-1041.338) (-1041.231) (-1039.176) * (-1043.534) [-1044.461] (-1043.001) (-1043.269) -- 0:00:10
349500 -- (-1041.427) [-1041.142] (-1039.501) (-1039.385) * [-1044.020] (-1043.950) (-1040.392) (-1039.443) -- 0:00:10
350000 -- (-1041.204) [-1042.398] (-1043.418) (-1040.519) * (-1040.293) [-1041.032] (-1044.126) (-1039.836) -- 0:00:10
Average standard deviation of split frequencies: 0.010684
350500 -- (-1041.693) (-1040.651) [-1040.829] (-1041.169) * (-1042.451) [-1040.663] (-1044.037) (-1039.344) -- 0:00:10
351000 -- (-1040.537) (-1042.244) (-1041.319) [-1040.552] * (-1042.501) (-1040.446) (-1040.488) [-1038.034] -- 0:00:10
351500 -- (-1040.912) (-1042.549) (-1043.537) [-1040.825] * [-1041.894] (-1042.228) (-1041.566) (-1041.367) -- 0:00:10
352000 -- (-1040.260) (-1039.837) [-1039.946] (-1040.000) * (-1039.637) (-1039.975) (-1040.856) [-1039.546] -- 0:00:10
352500 -- (-1043.027) (-1042.651) [-1038.250] (-1042.664) * (-1040.423) [-1038.757] (-1041.650) (-1041.229) -- 0:00:10
353000 -- (-1043.476) (-1041.049) (-1039.661) [-1039.506] * [-1038.588] (-1041.123) (-1043.569) (-1041.911) -- 0:00:10
353500 -- (-1045.532) [-1042.332] (-1040.081) (-1046.285) * (-1041.944) (-1042.977) (-1041.369) [-1040.218] -- 0:00:10
354000 -- (-1043.255) (-1042.286) (-1041.110) [-1039.893] * [-1042.062] (-1042.775) (-1045.155) (-1041.884) -- 0:00:10
354500 -- [-1041.602] (-1038.275) (-1038.739) (-1041.384) * (-1039.948) [-1040.046] (-1040.568) (-1040.307) -- 0:00:10
355000 -- [-1042.907] (-1043.342) (-1041.645) (-1042.827) * [-1041.094] (-1042.226) (-1043.747) (-1045.767) -- 0:00:10
Average standard deviation of split frequencies: 0.010802
355500 -- [-1044.298] (-1043.695) (-1040.200) (-1042.887) * [-1043.102] (-1040.611) (-1039.233) (-1043.621) -- 0:00:10
356000 -- (-1045.951) (-1041.760) (-1039.980) [-1039.792] * [-1041.761] (-1042.516) (-1042.389) (-1043.824) -- 0:00:10
356500 -- (-1041.298) [-1040.594] (-1040.475) (-1042.358) * (-1043.841) (-1040.810) [-1040.773] (-1041.788) -- 0:00:10
357000 -- (-1040.185) [-1041.556] (-1041.443) (-1040.575) * (-1042.322) (-1042.137) (-1043.840) [-1040.289] -- 0:00:10
357500 -- (-1041.220) (-1042.750) (-1042.098) [-1040.474] * (-1043.685) (-1039.321) [-1043.091] (-1043.818) -- 0:00:09
358000 -- (-1041.969) (-1038.849) [-1039.101] (-1041.353) * (-1041.444) [-1041.143] (-1042.655) (-1041.876) -- 0:00:09
358500 -- (-1046.114) (-1052.430) [-1039.928] (-1040.602) * (-1040.013) (-1044.385) (-1041.936) [-1041.233] -- 0:00:09
359000 -- (-1042.853) [-1046.591] (-1046.406) (-1042.227) * (-1040.973) (-1044.171) [-1043.943] (-1040.963) -- 0:00:09
359500 -- [-1041.856] (-1041.313) (-1043.859) (-1041.594) * (-1045.681) [-1041.810] (-1043.197) (-1040.472) -- 0:00:09
360000 -- (-1041.901) (-1038.691) (-1041.715) [-1041.528] * [-1041.468] (-1043.708) (-1041.486) (-1041.689) -- 0:00:09
Average standard deviation of split frequencies: 0.010731
360500 -- (-1041.899) [-1040.024] (-1040.596) (-1040.750) * (-1041.915) (-1041.733) (-1042.525) [-1039.828] -- 0:00:09
361000 -- (-1039.834) (-1038.184) [-1040.334] (-1040.327) * (-1041.240) (-1043.581) (-1042.602) [-1041.589] -- 0:00:09
361500 -- [-1041.586] (-1040.168) (-1041.737) (-1045.600) * (-1043.459) [-1040.635] (-1041.989) (-1040.864) -- 0:00:09
362000 -- [-1043.646] (-1040.049) (-1041.670) (-1041.930) * (-1044.499) [-1042.190] (-1041.652) (-1044.487) -- 0:00:09
362500 -- (-1043.051) (-1039.649) (-1042.536) [-1041.945] * (-1043.904) [-1043.435] (-1041.364) (-1044.350) -- 0:00:09
363000 -- [-1041.225] (-1041.830) (-1043.628) (-1042.567) * (-1042.858) (-1045.312) [-1041.217] (-1043.021) -- 0:00:09
363500 -- (-1042.458) (-1044.280) (-1040.954) [-1039.052] * (-1045.574) [-1037.696] (-1041.850) (-1044.530) -- 0:00:09
364000 -- (-1041.813) (-1039.990) [-1041.148] (-1041.138) * (-1041.142) [-1039.762] (-1043.337) (-1041.904) -- 0:00:09
364500 -- (-1040.738) (-1039.347) [-1039.799] (-1039.400) * (-1042.622) (-1042.689) (-1043.530) [-1041.537] -- 0:00:09
365000 -- (-1041.887) (-1044.887) (-1041.859) [-1040.621] * (-1044.558) [-1041.484] (-1042.570) (-1042.203) -- 0:00:09
Average standard deviation of split frequencies: 0.010575
365500 -- [-1041.692] (-1041.857) (-1039.808) (-1044.186) * (-1044.959) (-1040.291) [-1041.888] (-1039.907) -- 0:00:09
366000 -- (-1043.739) (-1042.044) (-1038.436) [-1043.954] * [-1038.723] (-1042.777) (-1043.527) (-1038.423) -- 0:00:09
366500 -- (-1041.591) (-1042.423) [-1040.261] (-1042.990) * (-1040.619) [-1041.418] (-1042.921) (-1040.519) -- 0:00:09
367000 -- (-1040.863) (-1042.894) (-1040.322) [-1042.924] * (-1041.485) (-1041.462) (-1043.264) [-1041.796] -- 0:00:09
367500 -- (-1044.002) [-1042.282] (-1040.038) (-1039.981) * (-1042.053) [-1043.579] (-1040.066) (-1038.281) -- 0:00:09
368000 -- (-1041.959) [-1041.638] (-1040.194) (-1042.466) * (-1046.178) [-1042.992] (-1042.428) (-1040.914) -- 0:00:09
368500 -- (-1042.068) (-1043.238) (-1038.509) [-1044.816] * (-1042.129) (-1045.328) (-1040.241) [-1038.717] -- 0:00:09
369000 -- (-1040.210) (-1042.166) [-1042.780] (-1042.065) * [-1041.701] (-1047.717) (-1045.213) (-1040.657) -- 0:00:09
369500 -- [-1040.898] (-1038.466) (-1041.773) (-1046.271) * (-1042.814) (-1042.031) (-1040.064) [-1043.287] -- 0:00:09
370000 -- (-1043.851) (-1038.841) (-1042.264) [-1046.545] * [-1041.989] (-1040.232) (-1041.376) (-1043.133) -- 0:00:09
Average standard deviation of split frequencies: 0.010977
370500 -- (-1041.393) [-1039.554] (-1044.569) (-1046.919) * (-1041.760) [-1041.392] (-1044.592) (-1042.689) -- 0:00:09
371000 -- (-1042.742) (-1041.434) (-1039.285) [-1043.285] * (-1040.691) [-1042.202] (-1044.310) (-1044.043) -- 0:00:09
371500 -- (-1047.079) (-1044.428) (-1040.752) [-1041.814] * (-1044.751) (-1041.849) (-1041.370) [-1041.953] -- 0:00:08
372000 -- [-1044.192] (-1038.152) (-1042.104) (-1043.341) * (-1043.956) (-1042.669) (-1040.682) [-1042.495] -- 0:00:08
372500 -- (-1040.825) [-1043.204] (-1042.694) (-1046.101) * (-1041.975) (-1040.254) (-1041.525) [-1042.402] -- 0:00:08
373000 -- (-1044.283) (-1040.215) [-1041.276] (-1044.099) * (-1047.010) (-1041.674) (-1043.540) [-1043.812] -- 0:00:08
373500 -- (-1044.582) [-1040.831] (-1041.886) (-1043.425) * (-1042.581) [-1040.120] (-1044.907) (-1044.367) -- 0:00:08
374000 -- (-1042.219) [-1040.874] (-1041.146) (-1045.411) * (-1043.052) (-1040.528) [-1042.444] (-1042.866) -- 0:00:08
374500 -- (-1042.373) (-1043.837) [-1040.767] (-1042.710) * (-1043.781) (-1043.798) (-1047.247) [-1042.598] -- 0:00:08
375000 -- (-1041.594) (-1039.193) [-1040.231] (-1043.259) * [-1041.301] (-1041.137) (-1044.553) (-1041.547) -- 0:00:08
Average standard deviation of split frequencies: 0.010492
375500 -- (-1042.519) (-1040.635) [-1042.273] (-1043.689) * (-1041.349) [-1044.567] (-1039.877) (-1047.930) -- 0:00:08
376000 -- [-1040.159] (-1042.465) (-1042.174) (-1040.635) * [-1041.271] (-1041.459) (-1038.730) (-1043.277) -- 0:00:08
376500 -- (-1042.647) (-1040.793) [-1042.604] (-1046.653) * (-1040.815) [-1036.425] (-1041.611) (-1045.456) -- 0:00:08
377000 -- (-1041.169) (-1041.009) (-1045.170) [-1041.003] * (-1044.124) (-1040.582) [-1041.562] (-1041.729) -- 0:00:08
377500 -- (-1043.072) [-1038.503] (-1045.889) (-1040.887) * [-1041.623] (-1041.000) (-1044.253) (-1041.535) -- 0:00:08
378000 -- [-1043.560] (-1044.355) (-1047.117) (-1040.122) * (-1039.500) (-1038.998) [-1041.606] (-1040.378) -- 0:00:08
378500 -- (-1044.040) (-1043.916) (-1041.489) [-1041.569] * (-1040.638) [-1041.042] (-1041.018) (-1041.399) -- 0:00:08
379000 -- (-1042.531) [-1039.532] (-1041.604) (-1044.798) * [-1039.824] (-1041.399) (-1042.515) (-1041.328) -- 0:00:08
379500 -- (-1043.615) (-1045.201) [-1040.013] (-1041.637) * (-1037.655) (-1042.033) [-1043.527] (-1041.902) -- 0:00:08
380000 -- (-1041.709) (-1045.928) (-1041.863) [-1040.005] * (-1044.861) (-1044.591) [-1044.073] (-1040.617) -- 0:00:08
Average standard deviation of split frequencies: 0.010689
380500 -- (-1041.124) (-1041.309) (-1040.798) [-1039.567] * (-1040.301) [-1037.166] (-1047.016) (-1042.016) -- 0:00:08
381000 -- [-1037.398] (-1042.143) (-1045.325) (-1038.592) * (-1039.621) (-1041.194) [-1044.476] (-1041.829) -- 0:00:08
381500 -- (-1041.118) [-1042.252] (-1043.599) (-1040.181) * (-1039.729) (-1039.451) (-1044.085) [-1041.597] -- 0:00:08
382000 -- (-1041.974) (-1039.356) (-1039.998) [-1040.713] * (-1041.168) (-1042.538) [-1050.454] (-1041.588) -- 0:00:08
382500 -- (-1047.593) (-1041.251) [-1044.034] (-1040.518) * (-1040.106) [-1041.500] (-1041.961) (-1043.350) -- 0:00:08
383000 -- (-1041.472) [-1041.301] (-1041.375) (-1043.646) * (-1042.818) [-1040.565] (-1042.532) (-1041.033) -- 0:00:08
383500 -- (-1040.951) [-1038.685] (-1046.716) (-1040.564) * [-1042.975] (-1043.984) (-1042.165) (-1040.881) -- 0:00:08
384000 -- [-1041.703] (-1040.838) (-1047.813) (-1041.091) * (-1040.941) (-1041.776) (-1046.162) [-1041.582] -- 0:00:08
384500 -- (-1045.977) [-1042.615] (-1043.368) (-1040.420) * (-1044.757) (-1042.143) [-1043.674] (-1042.462) -- 0:00:08
385000 -- (-1042.438) (-1040.243) [-1039.773] (-1040.540) * (-1041.472) (-1041.448) (-1038.994) [-1040.999] -- 0:00:08
Average standard deviation of split frequencies: 0.010477
385500 -- (-1041.325) (-1043.699) [-1041.059] (-1039.498) * (-1044.392) (-1042.439) [-1040.662] (-1042.852) -- 0:00:08
386000 -- [-1046.467] (-1042.428) (-1040.508) (-1037.380) * (-1042.472) [-1040.107] (-1038.986) (-1042.000) -- 0:00:07
386500 -- (-1043.681) (-1042.186) (-1042.364) [-1041.953] * [-1042.023] (-1041.491) (-1041.877) (-1042.562) -- 0:00:07
387000 -- (-1044.352) (-1041.621) [-1040.967] (-1041.554) * (-1041.318) [-1041.090] (-1043.645) (-1044.917) -- 0:00:07
387500 -- [-1039.056] (-1042.086) (-1042.999) (-1039.130) * [-1042.427] (-1041.194) (-1043.625) (-1039.982) -- 0:00:07
388000 -- [-1040.154] (-1041.862) (-1043.957) (-1043.127) * (-1041.961) (-1039.167) [-1040.485] (-1040.262) -- 0:00:07
388500 -- [-1043.457] (-1043.462) (-1042.240) (-1040.716) * [-1040.590] (-1040.973) (-1039.571) (-1040.002) -- 0:00:07
389000 -- (-1043.036) [-1043.621] (-1041.656) (-1039.768) * (-1039.937) (-1040.295) (-1041.908) [-1040.796] -- 0:00:07
389500 -- [-1042.120] (-1042.105) (-1041.916) (-1042.573) * (-1041.524) (-1040.479) [-1045.739] (-1041.616) -- 0:00:07
390000 -- [-1040.847] (-1043.152) (-1040.992) (-1043.610) * (-1044.975) [-1041.388] (-1042.140) (-1042.246) -- 0:00:07
Average standard deviation of split frequencies: 0.009082
390500 -- [-1044.429] (-1040.362) (-1040.618) (-1043.110) * (-1041.459) (-1041.438) [-1040.567] (-1042.729) -- 0:00:07
391000 -- (-1041.276) (-1041.780) (-1044.008) [-1041.250] * (-1040.830) (-1041.733) [-1041.410] (-1042.439) -- 0:00:07
391500 -- (-1041.222) [-1041.027] (-1042.323) (-1037.645) * (-1042.599) (-1043.565) [-1039.808] (-1039.848) -- 0:00:07
392000 -- (-1043.196) (-1042.647) [-1043.034] (-1040.117) * (-1040.685) (-1041.587) (-1045.832) [-1043.254] -- 0:00:07
392500 -- (-1041.443) [-1040.893] (-1044.184) (-1040.940) * (-1047.295) (-1041.528) [-1041.219] (-1046.526) -- 0:00:07
393000 -- (-1041.432) [-1039.864] (-1046.703) (-1042.429) * (-1041.294) (-1041.927) (-1042.884) [-1038.422] -- 0:00:07
393500 -- (-1042.705) [-1041.323] (-1047.146) (-1042.706) * (-1042.780) (-1041.853) [-1041.247] (-1043.407) -- 0:00:07
394000 -- (-1045.196) [-1042.565] (-1045.135) (-1048.198) * (-1041.932) (-1041.799) (-1042.054) [-1039.660] -- 0:00:07
394500 -- (-1045.538) (-1047.352) (-1043.247) [-1044.076] * (-1041.548) [-1039.297] (-1042.788) (-1043.107) -- 0:00:07
395000 -- (-1043.975) (-1042.072) [-1040.259] (-1047.333) * (-1039.557) [-1046.012] (-1041.421) (-1041.915) -- 0:00:07
Average standard deviation of split frequencies: 0.008646
395500 -- (-1041.133) (-1044.737) (-1042.435) [-1039.970] * (-1041.306) (-1042.188) (-1040.739) [-1041.634] -- 0:00:07
396000 -- (-1041.759) [-1041.860] (-1041.520) (-1040.957) * (-1047.528) [-1045.079] (-1040.622) (-1040.035) -- 0:00:07
396500 -- (-1045.888) [-1042.567] (-1041.030) (-1040.659) * (-1037.864) [-1040.178] (-1042.590) (-1036.713) -- 0:00:07
397000 -- (-1043.226) (-1045.284) (-1039.511) [-1042.018] * (-1042.105) [-1040.261] (-1042.935) (-1043.147) -- 0:00:07
397500 -- (-1043.023) (-1041.721) [-1039.985] (-1040.049) * (-1041.728) (-1042.423) (-1041.795) [-1040.604] -- 0:00:07
398000 -- (-1040.096) (-1043.898) [-1042.790] (-1042.057) * [-1039.022] (-1042.551) (-1041.094) (-1042.132) -- 0:00:07
398500 -- [-1042.371] (-1042.802) (-1044.646) (-1040.334) * (-1040.841) (-1042.192) (-1041.308) [-1043.385] -- 0:00:07
399000 -- (-1040.786) [-1042.145] (-1041.070) (-1041.209) * (-1042.542) (-1039.383) (-1039.185) [-1042.143] -- 0:00:07
399500 -- (-1042.752) (-1040.728) (-1040.266) [-1040.947] * (-1043.261) [-1041.513] (-1041.526) (-1046.002) -- 0:00:07
400000 -- [-1042.813] (-1042.740) (-1043.194) (-1043.415) * (-1041.464) (-1043.264) (-1043.958) [-1039.997] -- 0:00:06
Average standard deviation of split frequencies: 0.008422
400500 -- [-1041.468] (-1046.026) (-1040.413) (-1041.169) * (-1048.768) [-1043.141] (-1041.237) (-1039.803) -- 0:00:06
401000 -- (-1041.465) (-1044.351) (-1041.150) [-1045.029] * [-1051.125] (-1041.125) (-1042.807) (-1043.437) -- 0:00:06
401500 -- (-1040.019) (-1045.225) (-1042.712) [-1041.996] * (-1041.091) [-1042.933] (-1043.069) (-1041.774) -- 0:00:06
402000 -- (-1039.354) [-1042.398] (-1040.477) (-1042.258) * (-1042.354) [-1042.922] (-1041.577) (-1042.584) -- 0:00:06
402500 -- (-1040.810) (-1043.091) (-1041.977) [-1042.639] * [-1039.931] (-1046.741) (-1040.946) (-1043.826) -- 0:00:06
403000 -- (-1041.633) (-1042.254) (-1042.163) [-1039.648] * (-1041.644) (-1040.469) [-1040.515] (-1041.183) -- 0:00:06
403500 -- (-1042.322) (-1043.165) [-1042.778] (-1044.673) * (-1041.043) [-1042.353] (-1039.220) (-1043.292) -- 0:00:06
404000 -- (-1039.746) (-1044.645) (-1046.678) [-1041.688] * (-1041.532) (-1042.188) [-1042.465] (-1038.837) -- 0:00:06
404500 -- (-1042.901) [-1043.519] (-1041.563) (-1040.401) * [-1044.100] (-1043.572) (-1042.406) (-1040.848) -- 0:00:06
405000 -- (-1045.143) (-1045.035) (-1040.922) [-1041.912] * (-1042.680) (-1040.354) (-1040.587) [-1047.506] -- 0:00:06
Average standard deviation of split frequencies: 0.008189
405500 -- (-1043.387) (-1042.940) [-1042.381] (-1041.249) * (-1046.259) [-1038.858] (-1038.605) (-1039.011) -- 0:00:06
406000 -- (-1042.844) (-1042.719) [-1044.443] (-1042.875) * (-1044.260) (-1045.345) (-1042.151) [-1043.811] -- 0:00:06
406500 -- [-1043.052] (-1042.453) (-1045.599) (-1041.577) * (-1043.447) [-1043.828] (-1040.509) (-1042.158) -- 0:00:06
407000 -- [-1041.888] (-1044.550) (-1041.531) (-1041.531) * [-1041.888] (-1041.670) (-1042.873) (-1040.167) -- 0:00:06
407500 -- [-1042.923] (-1042.630) (-1044.568) (-1041.177) * (-1042.794) (-1039.111) (-1046.010) [-1043.235] -- 0:00:06
408000 -- [-1043.835] (-1044.849) (-1044.461) (-1043.862) * (-1041.969) (-1045.169) [-1043.082] (-1041.697) -- 0:00:06
408500 -- (-1046.395) [-1042.309] (-1043.293) (-1042.099) * (-1042.564) (-1042.309) (-1037.791) [-1041.496] -- 0:00:06
409000 -- (-1043.413) (-1040.621) (-1040.773) [-1041.395] * (-1042.787) [-1040.532] (-1040.594) (-1039.827) -- 0:00:06
409500 -- [-1042.279] (-1045.544) (-1040.634) (-1040.909) * [-1042.270] (-1037.437) (-1038.784) (-1041.334) -- 0:00:06
410000 -- (-1042.895) (-1041.679) (-1041.715) [-1042.101] * (-1042.725) (-1041.269) (-1042.980) [-1044.308] -- 0:00:06
Average standard deviation of split frequencies: 0.007733
410500 -- (-1041.839) (-1042.108) (-1041.221) [-1041.563] * (-1042.374) [-1039.460] (-1040.072) (-1044.090) -- 0:00:06
411000 -- (-1039.225) (-1041.894) (-1040.038) [-1041.109] * (-1041.800) [-1039.250] (-1042.911) (-1044.329) -- 0:00:06
411500 -- (-1040.930) (-1042.400) [-1039.672] (-1038.813) * (-1041.203) (-1043.603) [-1043.940] (-1039.085) -- 0:00:06
412000 -- (-1041.055) (-1041.463) (-1039.291) [-1041.952] * (-1042.507) (-1039.418) [-1043.096] (-1037.847) -- 0:00:06
412500 -- (-1043.484) (-1042.700) [-1038.599] (-1040.824) * [-1041.085] (-1042.352) (-1044.290) (-1039.137) -- 0:00:06
413000 -- (-1041.184) (-1041.012) (-1041.959) [-1040.756] * [-1044.568] (-1041.639) (-1048.075) (-1041.820) -- 0:00:06
413500 -- (-1043.416) [-1043.129] (-1045.829) (-1044.147) * (-1044.078) (-1041.994) (-1040.210) [-1042.496] -- 0:00:06
414000 -- (-1041.173) [-1041.486] (-1045.489) (-1042.211) * (-1042.135) [-1039.307] (-1043.218) (-1042.420) -- 0:00:06
414500 -- (-1041.248) [-1043.640] (-1040.880) (-1040.815) * (-1041.256) [-1039.435] (-1042.186) (-1046.546) -- 0:00:05
415000 -- (-1044.409) (-1042.227) (-1042.100) [-1040.344] * (-1045.982) [-1042.969] (-1041.461) (-1045.337) -- 0:00:05
Average standard deviation of split frequencies: 0.007813
415500 -- (-1049.923) (-1042.067) (-1041.520) [-1044.411] * (-1042.805) (-1044.317) (-1044.074) [-1041.373] -- 0:00:05
416000 -- (-1039.294) (-1045.664) [-1039.490] (-1041.156) * (-1045.764) (-1040.832) [-1041.655] (-1044.259) -- 0:00:05
416500 -- [-1042.359] (-1043.674) (-1046.585) (-1042.901) * (-1043.097) (-1040.403) (-1041.278) [-1039.754] -- 0:00:05
417000 -- (-1040.697) (-1041.941) [-1040.487] (-1044.020) * (-1044.514) [-1042.485] (-1040.965) (-1044.624) -- 0:00:05
417500 -- [-1038.966] (-1044.050) (-1041.929) (-1043.178) * (-1042.285) (-1040.932) (-1041.298) [-1041.512] -- 0:00:05
418000 -- [-1039.249] (-1045.722) (-1041.428) (-1043.861) * (-1040.651) [-1046.256] (-1039.240) (-1044.068) -- 0:00:05
418500 -- (-1042.106) (-1044.479) (-1041.041) [-1039.184] * [-1041.063] (-1045.485) (-1040.077) (-1039.158) -- 0:00:05
419000 -- (-1042.824) (-1044.113) (-1040.888) [-1046.939] * (-1042.921) (-1042.588) [-1039.212] (-1043.106) -- 0:00:05
419500 -- (-1043.173) (-1045.836) (-1040.801) [-1041.208] * [-1041.364] (-1037.938) (-1044.030) (-1043.773) -- 0:00:05
420000 -- (-1046.142) (-1044.690) (-1040.783) [-1039.252] * (-1044.010) (-1041.514) [-1038.557] (-1039.859) -- 0:00:05
Average standard deviation of split frequencies: 0.009142
420500 -- (-1042.424) (-1045.323) [-1039.887] (-1040.711) * [-1044.538] (-1039.201) (-1041.393) (-1039.107) -- 0:00:05
421000 -- (-1043.220) [-1046.021] (-1041.057) (-1039.891) * (-1039.397) (-1040.940) (-1041.924) [-1046.544] -- 0:00:05
421500 -- (-1043.357) [-1043.596] (-1040.079) (-1039.581) * [-1039.633] (-1039.279) (-1040.970) (-1042.463) -- 0:00:05
422000 -- [-1045.762] (-1046.222) (-1037.556) (-1041.178) * (-1042.794) (-1038.546) [-1040.972] (-1041.150) -- 0:00:05
422500 -- (-1042.475) (-1042.694) (-1041.876) [-1040.849] * (-1042.788) [-1041.812] (-1042.708) (-1047.754) -- 0:00:05
423000 -- (-1043.728) [-1041.916] (-1042.967) (-1040.398) * [-1042.568] (-1043.489) (-1042.062) (-1041.804) -- 0:00:05
423500 -- (-1041.211) (-1042.587) (-1041.566) [-1039.355] * (-1044.413) (-1046.152) (-1044.534) [-1043.060] -- 0:00:05
424000 -- (-1042.509) (-1042.096) (-1046.503) [-1042.498] * (-1042.757) [-1042.760] (-1045.458) (-1043.796) -- 0:00:05
424500 -- (-1040.106) [-1045.634] (-1046.975) (-1045.431) * [-1041.435] (-1040.584) (-1043.315) (-1045.950) -- 0:00:05
425000 -- (-1045.090) (-1041.806) (-1040.157) [-1041.992] * (-1041.327) (-1041.388) (-1043.143) [-1043.862] -- 0:00:05
Average standard deviation of split frequencies: 0.008270
425500 -- (-1046.698) [-1045.292] (-1039.815) (-1041.522) * (-1043.955) (-1041.397) (-1044.592) [-1043.190] -- 0:00:05
426000 -- (-1045.363) [-1042.055] (-1038.341) (-1041.100) * (-1042.760) [-1043.418] (-1045.004) (-1044.609) -- 0:00:05
426500 -- (-1042.297) [-1041.266] (-1043.934) (-1042.541) * (-1042.660) [-1040.994] (-1045.321) (-1039.825) -- 0:00:05
427000 -- (-1042.921) (-1043.430) (-1044.893) [-1041.627] * [-1044.857] (-1040.221) (-1042.542) (-1041.452) -- 0:00:05
427500 -- (-1043.733) (-1044.812) [-1041.220] (-1040.335) * (-1042.461) [-1041.280] (-1041.823) (-1041.250) -- 0:00:05
428000 -- (-1043.320) [-1041.751] (-1047.683) (-1043.537) * (-1040.324) [-1038.975] (-1041.476) (-1043.416) -- 0:00:05
428500 -- (-1040.126) (-1043.652) [-1046.630] (-1045.240) * [-1040.841] (-1041.033) (-1041.755) (-1043.015) -- 0:00:05
429000 -- (-1044.976) (-1046.160) (-1052.473) [-1040.800] * (-1041.708) (-1041.964) (-1041.157) [-1042.790] -- 0:00:04
429500 -- (-1045.094) [-1041.712] (-1047.107) (-1045.203) * [-1041.412] (-1042.327) (-1044.424) (-1047.711) -- 0:00:04
430000 -- (-1043.448) (-1043.160) (-1038.863) [-1040.639] * [-1042.196] (-1042.063) (-1039.802) (-1049.221) -- 0:00:04
Average standard deviation of split frequencies: 0.008987
430500 -- (-1041.992) (-1042.098) (-1042.712) [-1040.357] * (-1045.927) (-1042.783) [-1043.092] (-1046.988) -- 0:00:04
431000 -- (-1045.837) [-1046.980] (-1042.257) (-1037.236) * [-1042.859] (-1041.112) (-1043.279) (-1045.466) -- 0:00:04
431500 -- (-1041.177) (-1041.309) [-1040.765] (-1044.183) * [-1039.756] (-1040.115) (-1041.610) (-1046.548) -- 0:00:04
432000 -- (-1043.744) (-1042.649) (-1038.541) [-1042.007] * [-1039.135] (-1039.817) (-1044.166) (-1038.287) -- 0:00:04
432500 -- (-1040.843) (-1041.396) (-1043.575) [-1041.057] * (-1041.870) (-1043.069) [-1042.647] (-1041.846) -- 0:00:04
433000 -- [-1041.787] (-1043.035) (-1043.221) (-1041.570) * (-1044.049) (-1041.018) (-1045.761) [-1037.893] -- 0:00:04
433500 -- (-1042.442) [-1044.198] (-1038.752) (-1041.137) * (-1040.438) (-1040.596) [-1043.493] (-1039.347) -- 0:00:04
434000 -- (-1042.056) (-1043.649) [-1040.718] (-1041.001) * (-1039.769) (-1044.081) (-1043.033) [-1036.795] -- 0:00:04
434500 -- (-1045.813) (-1041.125) [-1042.335] (-1041.731) * (-1043.411) (-1041.961) [-1041.811] (-1042.453) -- 0:00:04
435000 -- (-1045.974) (-1039.908) (-1037.784) [-1041.455] * [-1046.989] (-1039.654) (-1042.424) (-1041.892) -- 0:00:04
Average standard deviation of split frequencies: 0.010015
435500 -- (-1044.407) (-1043.522) [-1044.222] (-1045.279) * (-1041.924) (-1042.031) (-1040.720) [-1040.815] -- 0:00:04
436000 -- (-1043.100) (-1041.353) [-1040.608] (-1039.611) * (-1043.315) (-1041.549) (-1042.348) [-1041.574] -- 0:00:04
436500 -- [-1041.760] (-1042.964) (-1039.539) (-1040.643) * (-1047.147) [-1040.579] (-1039.573) (-1044.380) -- 0:00:04
437000 -- (-1043.102) (-1043.015) (-1040.595) [-1038.101] * [-1042.463] (-1041.065) (-1041.949) (-1040.389) -- 0:00:04
437500 -- (-1042.732) [-1043.021] (-1040.919) (-1039.810) * [-1039.542] (-1037.850) (-1040.999) (-1039.761) -- 0:00:04
438000 -- (-1041.617) [-1042.763] (-1046.016) (-1037.822) * (-1036.953) (-1040.523) (-1045.704) [-1039.827] -- 0:00:04
438500 -- (-1044.293) [-1041.204] (-1042.449) (-1039.349) * (-1042.260) (-1043.375) [-1039.178] (-1042.113) -- 0:00:04
439000 -- [-1039.612] (-1043.402) (-1040.673) (-1046.174) * (-1047.002) (-1042.793) (-1042.303) [-1041.602] -- 0:00:04
439500 -- (-1045.956) (-1042.673) (-1040.816) [-1049.170] * (-1045.986) [-1040.271] (-1043.951) (-1040.742) -- 0:00:04
440000 -- (-1047.258) (-1043.235) [-1041.500] (-1039.201) * (-1044.099) (-1044.421) [-1040.271] (-1044.413) -- 0:00:04
Average standard deviation of split frequencies: 0.010022
440500 -- [-1042.586] (-1041.375) (-1046.462) (-1040.827) * [-1040.589] (-1042.904) (-1042.115) (-1045.759) -- 0:00:04
441000 -- [-1041.655] (-1041.097) (-1042.313) (-1041.970) * (-1041.679) (-1041.942) (-1042.913) [-1041.057] -- 0:00:04
441500 -- (-1042.241) [-1043.659] (-1042.300) (-1040.418) * (-1040.717) (-1041.363) [-1041.182] (-1041.670) -- 0:00:04
442000 -- (-1041.664) [-1041.485] (-1042.936) (-1043.204) * (-1045.102) (-1043.058) [-1041.559] (-1044.562) -- 0:00:04
442500 -- (-1040.857) (-1044.742) [-1041.659] (-1040.049) * [-1041.491] (-1042.094) (-1040.714) (-1039.686) -- 0:00:04
443000 -- (-1043.023) (-1044.298) [-1047.893] (-1039.310) * [-1040.400] (-1041.810) (-1044.555) (-1044.809) -- 0:00:03
443500 -- (-1042.442) (-1040.513) (-1041.588) [-1041.519] * (-1041.297) (-1040.305) (-1042.409) [-1041.301] -- 0:00:03
444000 -- (-1043.335) (-1039.295) (-1045.488) [-1045.100] * (-1040.632) [-1045.073] (-1045.086) (-1044.267) -- 0:00:03
444500 -- (-1042.470) (-1039.972) (-1043.577) [-1043.042] * (-1042.136) (-1041.262) [-1043.056] (-1042.420) -- 0:00:03
445000 -- (-1045.097) [-1040.327] (-1040.758) (-1044.786) * (-1048.778) [-1041.930] (-1042.595) (-1041.114) -- 0:00:03
Average standard deviation of split frequencies: 0.010069
445500 -- (-1040.850) (-1039.513) [-1045.462] (-1041.757) * (-1043.400) (-1041.943) (-1042.217) [-1044.699] -- 0:00:03
446000 -- (-1043.385) (-1047.059) [-1041.867] (-1042.373) * (-1042.375) [-1042.014] (-1046.390) (-1046.102) -- 0:00:03
446500 -- (-1040.911) (-1042.965) (-1041.210) [-1040.735] * [-1040.580] (-1042.300) (-1045.411) (-1043.202) -- 0:00:03
447000 -- (-1040.278) [-1041.682] (-1041.811) (-1042.310) * (-1047.986) (-1042.740) [-1045.633] (-1042.729) -- 0:00:03
447500 -- [-1040.820] (-1041.937) (-1040.132) (-1042.576) * (-1043.943) (-1039.685) (-1043.682) [-1043.098] -- 0:00:03
448000 -- (-1040.861) [-1043.322] (-1044.051) (-1041.659) * (-1042.958) [-1041.264] (-1039.540) (-1042.566) -- 0:00:03
448500 -- [-1039.989] (-1047.020) (-1041.382) (-1042.015) * [-1040.249] (-1042.883) (-1040.387) (-1042.086) -- 0:00:03
449000 -- (-1039.052) (-1049.664) [-1044.842] (-1041.333) * (-1041.273) (-1041.187) [-1041.827] (-1042.548) -- 0:00:03
449500 -- (-1040.812) [-1045.196] (-1042.926) (-1042.105) * (-1040.383) (-1045.531) [-1041.283] (-1045.981) -- 0:00:03
450000 -- [-1040.585] (-1046.616) (-1045.015) (-1044.093) * (-1041.615) (-1044.049) (-1041.079) [-1041.200] -- 0:00:03
Average standard deviation of split frequencies: 0.010075
450500 -- (-1040.501) [-1042.147] (-1043.495) (-1046.784) * (-1043.536) (-1041.032) (-1040.690) [-1041.578] -- 0:00:03
451000 -- (-1041.547) [-1041.381] (-1039.634) (-1043.578) * (-1042.336) [-1039.633] (-1043.105) (-1041.563) -- 0:00:03
451500 -- (-1041.130) (-1041.181) [-1042.673] (-1044.013) * [-1042.547] (-1041.927) (-1045.113) (-1041.585) -- 0:00:03
452000 -- (-1041.393) (-1042.123) (-1041.969) [-1042.538] * [-1042.490] (-1043.616) (-1038.574) (-1045.664) -- 0:00:03
452500 -- (-1043.276) [-1039.859] (-1042.219) (-1043.862) * [-1043.653] (-1043.337) (-1043.216) (-1045.319) -- 0:00:03
453000 -- (-1042.634) (-1042.259) [-1039.968] (-1042.595) * [-1041.682] (-1042.112) (-1041.637) (-1042.871) -- 0:00:03
453500 -- (-1045.087) [-1040.212] (-1041.738) (-1041.534) * [-1041.485] (-1044.482) (-1042.248) (-1039.920) -- 0:00:03
454000 -- [-1038.031] (-1043.309) (-1041.833) (-1046.277) * [-1042.665] (-1046.625) (-1041.202) (-1039.851) -- 0:00:03
454500 -- (-1038.374) (-1042.120) (-1042.119) [-1041.829] * (-1040.182) [-1041.602] (-1045.324) (-1042.238) -- 0:00:03
455000 -- [-1042.431] (-1044.040) (-1041.644) (-1043.262) * (-1043.689) (-1038.722) [-1043.612] (-1044.333) -- 0:00:03
Average standard deviation of split frequencies: 0.010719
455500 -- [-1042.463] (-1045.246) (-1042.108) (-1042.431) * [-1040.462] (-1042.307) (-1041.766) (-1041.762) -- 0:00:03
456000 -- (-1040.399) [-1042.048] (-1043.177) (-1043.475) * [-1041.734] (-1041.916) (-1044.174) (-1037.938) -- 0:00:03
456500 -- [-1039.652] (-1042.275) (-1043.435) (-1043.303) * (-1041.446) [-1042.967] (-1043.819) (-1048.875) -- 0:00:03
457000 -- [-1038.865] (-1043.156) (-1041.703) (-1042.717) * [-1039.811] (-1042.624) (-1041.919) (-1042.009) -- 0:00:03
457500 -- (-1040.276) (-1044.734) [-1042.654] (-1043.136) * (-1041.244) [-1043.454] (-1041.393) (-1041.541) -- 0:00:02
458000 -- [-1040.908] (-1045.666) (-1042.405) (-1045.084) * [-1042.667] (-1042.598) (-1042.233) (-1042.010) -- 0:00:02
458500 -- (-1043.660) [-1041.083] (-1040.993) (-1039.427) * (-1051.626) [-1045.785] (-1041.554) (-1043.498) -- 0:00:02
459000 -- [-1040.427] (-1042.810) (-1040.001) (-1041.545) * (-1042.702) (-1041.675) [-1041.064] (-1040.835) -- 0:00:02
459500 -- (-1041.892) (-1042.887) [-1041.665] (-1041.869) * [-1039.554] (-1042.629) (-1041.914) (-1046.021) -- 0:00:02
460000 -- (-1045.231) (-1040.855) [-1042.137] (-1041.127) * (-1043.101) [-1040.108] (-1042.529) (-1046.608) -- 0:00:02
Average standard deviation of split frequencies: 0.011041
460500 -- [-1043.461] (-1043.422) (-1039.191) (-1041.933) * [-1043.110] (-1041.140) (-1043.123) (-1047.986) -- 0:00:02
461000 -- (-1041.729) (-1039.405) [-1040.920] (-1042.796) * (-1044.517) (-1041.481) (-1039.636) [-1044.139] -- 0:00:02
461500 -- (-1040.741) [-1039.835] (-1041.626) (-1043.526) * (-1044.206) (-1040.313) (-1041.841) [-1039.146] -- 0:00:02
462000 -- (-1040.422) (-1044.093) (-1041.733) [-1042.646] * (-1044.006) (-1039.965) [-1040.946] (-1041.653) -- 0:00:02
462500 -- [-1045.772] (-1040.712) (-1044.112) (-1043.375) * [-1042.164] (-1042.999) (-1039.632) (-1037.161) -- 0:00:02
463000 -- [-1043.459] (-1040.935) (-1043.435) (-1044.961) * (-1042.278) (-1041.332) [-1041.305] (-1037.328) -- 0:00:02
463500 -- (-1040.906) (-1040.928) [-1043.050] (-1044.126) * (-1044.012) (-1041.745) [-1036.783] (-1043.526) -- 0:00:02
464000 -- (-1041.808) (-1043.974) [-1042.020] (-1042.500) * (-1043.346) (-1039.763) [-1041.726] (-1041.553) -- 0:00:02
464500 -- (-1039.601) (-1041.620) [-1041.796] (-1041.000) * (-1045.527) (-1039.616) [-1041.391] (-1044.775) -- 0:00:02
465000 -- (-1041.531) (-1042.764) [-1039.170] (-1039.905) * [-1039.047] (-1038.750) (-1045.817) (-1041.409) -- 0:00:02
Average standard deviation of split frequencies: 0.010755
465500 -- [-1044.036] (-1045.104) (-1041.752) (-1040.954) * (-1046.260) (-1038.797) (-1041.421) [-1040.781] -- 0:00:02
466000 -- (-1044.487) (-1045.495) (-1043.025) [-1040.620] * (-1041.050) [-1041.541] (-1042.843) (-1041.558) -- 0:00:02
466500 -- (-1046.280) [-1044.251] (-1042.580) (-1041.236) * (-1045.068) [-1039.151] (-1042.744) (-1041.136) -- 0:00:02
467000 -- (-1041.702) (-1043.630) [-1041.280] (-1041.634) * (-1042.382) (-1038.989) [-1040.213] (-1041.639) -- 0:00:02
467500 -- (-1041.099) (-1046.523) [-1043.041] (-1043.299) * (-1046.346) [-1043.676] (-1042.193) (-1043.453) -- 0:00:02
468000 -- (-1045.809) (-1043.320) (-1041.840) [-1041.495] * (-1042.104) (-1040.801) [-1040.160] (-1044.859) -- 0:00:02
468500 -- [-1040.501] (-1044.303) (-1042.442) (-1041.513) * (-1039.916) [-1041.990] (-1040.544) (-1042.534) -- 0:00:02
469000 -- (-1038.240) (-1043.123) [-1043.508] (-1042.174) * (-1040.408) (-1040.281) [-1038.507] (-1047.778) -- 0:00:02
469500 -- (-1043.585) [-1038.706] (-1040.920) (-1044.006) * (-1044.446) (-1042.262) [-1039.521] (-1040.863) -- 0:00:02
470000 -- (-1045.172) (-1042.963) (-1043.781) [-1040.464] * (-1042.497) (-1041.605) (-1041.678) [-1040.995] -- 0:00:02
Average standard deviation of split frequencies: 0.011334
470500 -- (-1043.075) [-1040.425] (-1042.905) (-1042.122) * [-1042.125] (-1041.422) (-1041.555) (-1041.909) -- 0:00:02
471000 -- (-1039.842) (-1039.831) (-1042.219) [-1042.458] * (-1043.949) (-1042.056) [-1042.523] (-1044.311) -- 0:00:02
471500 -- (-1042.195) (-1041.821) (-1041.984) [-1042.117] * (-1044.195) [-1041.771] (-1043.252) (-1042.622) -- 0:00:01
472000 -- (-1042.277) (-1040.987) [-1041.028] (-1044.656) * (-1041.165) [-1041.739] (-1047.062) (-1047.554) -- 0:00:01
472500 -- (-1041.947) (-1040.901) (-1041.812) [-1041.959] * (-1042.378) [-1041.460] (-1041.828) (-1041.818) -- 0:00:01
473000 -- (-1042.673) (-1041.660) (-1042.080) [-1042.554] * [-1045.017] (-1039.299) (-1040.988) (-1046.353) -- 0:00:01
473500 -- (-1042.599) (-1041.565) (-1041.850) [-1040.725] * [-1044.072] (-1041.224) (-1046.115) (-1044.685) -- 0:00:01
474000 -- [-1044.895] (-1040.746) (-1039.765) (-1042.930) * (-1040.148) [-1041.706] (-1041.568) (-1043.261) -- 0:00:01
474500 -- (-1044.114) (-1043.787) (-1040.533) [-1044.273] * (-1043.082) (-1042.440) (-1041.939) [-1042.729] -- 0:00:01
475000 -- (-1044.718) (-1044.305) [-1041.521] (-1042.306) * (-1042.271) (-1041.009) [-1040.764] (-1042.021) -- 0:00:01
Average standard deviation of split frequencies: 0.011676
475500 -- (-1040.461) [-1045.305] (-1042.942) (-1044.921) * (-1042.353) (-1043.894) [-1043.314] (-1042.707) -- 0:00:01
476000 -- [-1040.245] (-1045.522) (-1040.714) (-1045.653) * (-1040.526) (-1041.772) [-1040.967] (-1040.668) -- 0:00:01
476500 -- (-1039.785) (-1041.321) (-1043.260) [-1043.017] * (-1041.166) (-1043.676) (-1042.457) [-1041.440] -- 0:00:01
477000 -- [-1040.967] (-1041.059) (-1042.517) (-1043.433) * (-1041.862) (-1041.217) (-1041.882) [-1040.476] -- 0:00:01
477500 -- (-1044.005) (-1040.881) (-1045.030) [-1038.561] * (-1041.305) (-1041.877) (-1039.773) [-1042.453] -- 0:00:01
478000 -- (-1043.439) (-1044.504) (-1039.027) [-1037.641] * (-1045.182) (-1040.510) (-1038.899) [-1039.179] -- 0:00:01
478500 -- (-1046.790) [-1042.162] (-1039.793) (-1042.071) * [-1045.901] (-1043.080) (-1044.011) (-1039.519) -- 0:00:01
479000 -- (-1047.125) (-1040.805) [-1046.062] (-1040.543) * [-1044.081] (-1041.691) (-1042.789) (-1040.137) -- 0:00:01
479500 -- (-1041.835) [-1042.349] (-1041.378) (-1042.270) * (-1045.099) (-1041.637) [-1042.571] (-1038.118) -- 0:00:01
480000 -- (-1045.227) (-1042.551) [-1041.207] (-1040.601) * (-1041.601) (-1041.298) [-1042.862] (-1040.022) -- 0:00:01
Average standard deviation of split frequencies: 0.011304
480500 -- (-1049.425) (-1041.815) (-1040.160) [-1039.041] * [-1041.642] (-1042.426) (-1057.234) (-1041.454) -- 0:00:01
481000 -- (-1042.151) [-1041.293] (-1042.408) (-1042.748) * (-1038.692) (-1042.897) [-1044.823] (-1042.564) -- 0:00:01
481500 -- [-1040.760] (-1039.733) (-1044.044) (-1041.836) * (-1040.197) (-1041.215) (-1042.158) [-1041.483] -- 0:00:01
482000 -- (-1043.522) (-1042.393) [-1040.653] (-1042.754) * (-1040.532) [-1042.124] (-1040.635) (-1039.669) -- 0:00:01
482500 -- (-1044.550) [-1040.621] (-1044.751) (-1039.336) * (-1040.257) (-1042.974) [-1040.535] (-1042.179) -- 0:00:01
483000 -- (-1042.770) [-1043.818] (-1041.727) (-1043.393) * [-1039.199] (-1041.593) (-1040.732) (-1042.942) -- 0:00:01
483500 -- (-1044.215) [-1041.575] (-1039.946) (-1044.282) * (-1041.057) [-1042.907] (-1043.476) (-1043.915) -- 0:00:01
484000 -- (-1044.277) (-1043.622) (-1045.450) [-1045.214] * (-1040.667) (-1041.448) [-1039.076] (-1045.397) -- 0:00:01
484500 -- (-1043.944) (-1050.458) [-1043.893] (-1040.981) * (-1038.746) (-1041.682) (-1044.504) [-1043.914] -- 0:00:01
485000 -- (-1042.453) (-1041.737) (-1041.925) [-1042.575] * (-1041.388) [-1041.355] (-1041.618) (-1043.574) -- 0:00:01
Average standard deviation of split frequencies: 0.011384
485500 -- [-1041.767] (-1042.555) (-1046.272) (-1042.433) * (-1044.836) [-1042.485] (-1046.823) (-1041.130) -- 0:00:01
486000 -- (-1042.601) [-1039.158] (-1045.772) (-1040.984) * (-1041.479) [-1042.738] (-1043.767) (-1040.677) -- 0:00:00
486500 -- (-1041.524) (-1039.063) (-1041.480) [-1039.319] * (-1044.038) [-1046.355] (-1048.601) (-1042.604) -- 0:00:00
487000 -- [-1041.905] (-1038.773) (-1039.775) (-1043.091) * (-1039.107) (-1045.271) [-1042.872] (-1050.117) -- 0:00:00
487500 -- (-1042.715) (-1041.613) (-1041.148) [-1037.929] * [-1043.065] (-1043.034) (-1042.453) (-1042.578) -- 0:00:00
488000 -- [-1038.588] (-1041.519) (-1040.812) (-1041.362) * (-1042.576) [-1039.519] (-1043.396) (-1040.573) -- 0:00:00
488500 -- (-1043.068) [-1040.105] (-1044.092) (-1039.672) * (-1051.349) [-1040.282] (-1041.285) (-1043.028) -- 0:00:00
489000 -- (-1042.310) (-1043.442) [-1041.255] (-1039.785) * (-1043.324) (-1042.804) (-1042.546) [-1043.499] -- 0:00:00
489500 -- (-1039.807) (-1041.048) [-1042.129] (-1039.947) * (-1042.359) (-1044.775) [-1042.483] (-1040.947) -- 0:00:00
490000 -- (-1040.578) (-1042.110) [-1041.611] (-1046.705) * (-1040.063) [-1044.159] (-1038.766) (-1041.134) -- 0:00:00
Average standard deviation of split frequencies: 0.011579
490500 -- [-1039.247] (-1042.310) (-1041.250) (-1042.990) * (-1041.301) (-1042.968) (-1039.999) [-1042.393] -- 0:00:00
491000 -- (-1042.652) [-1042.063] (-1047.220) (-1042.428) * (-1042.253) [-1040.870] (-1040.945) (-1043.965) -- 0:00:00
491500 -- (-1042.528) (-1041.758) [-1044.868] (-1040.887) * [-1040.156] (-1039.988) (-1041.817) (-1049.068) -- 0:00:00
492000 -- (-1041.415) (-1043.409) (-1040.663) [-1042.720] * (-1042.779) (-1040.581) [-1039.855] (-1044.418) -- 0:00:00
492500 -- (-1043.397) (-1041.962) (-1042.237) [-1039.293] * (-1039.175) (-1040.906) [-1041.324] (-1040.195) -- 0:00:00
493000 -- (-1042.151) [-1042.108] (-1044.406) (-1041.714) * [-1040.878] (-1039.397) (-1041.889) (-1044.606) -- 0:00:00
493500 -- [-1042.515] (-1042.263) (-1043.493) (-1043.201) * (-1038.976) [-1039.384] (-1042.937) (-1043.009) -- 0:00:00
494000 -- (-1045.344) (-1041.822) (-1043.982) [-1044.369] * [-1040.160] (-1042.703) (-1041.219) (-1039.620) -- 0:00:00
494500 -- [-1047.717] (-1041.283) (-1043.151) (-1044.346) * (-1041.780) (-1040.600) (-1041.187) [-1044.054] -- 0:00:00
495000 -- (-1041.646) (-1040.966) (-1040.942) [-1041.645] * (-1040.120) (-1041.502) (-1042.907) [-1043.962] -- 0:00:00
Average standard deviation of split frequencies: 0.011905
495500 -- (-1040.860) [-1039.643] (-1042.854) (-1039.394) * (-1043.907) [-1042.432] (-1041.642) (-1038.469) -- 0:00:00
496000 -- [-1042.074] (-1043.889) (-1042.419) (-1042.769) * (-1045.836) [-1038.819] (-1045.631) (-1041.682) -- 0:00:00
496500 -- (-1044.604) (-1042.405) (-1037.972) [-1043.080] * (-1039.438) (-1042.337) [-1040.147] (-1042.232) -- 0:00:00
497000 -- (-1042.816) [-1042.936] (-1042.179) (-1041.291) * [-1039.246] (-1039.072) (-1041.264) (-1038.922) -- 0:00:00
497500 -- [-1041.252] (-1042.545) (-1044.411) (-1044.138) * (-1041.756) (-1041.499) (-1043.954) [-1039.349] -- 0:00:00
498000 -- [-1041.789] (-1042.680) (-1043.217) (-1046.001) * (-1041.353) (-1039.128) [-1040.467] (-1040.318) -- 0:00:00
498500 -- (-1040.268) (-1044.952) (-1043.164) [-1042.862] * (-1039.662) (-1041.758) [-1040.684] (-1040.412) -- 0:00:00
499000 -- [-1046.302] (-1043.499) (-1040.024) (-1040.496) * (-1038.916) [-1043.804] (-1043.209) (-1041.825) -- 0:00:00
499500 -- (-1040.779) (-1041.543) (-1040.677) [-1041.628] * (-1038.697) (-1040.432) (-1044.196) [-1041.372] -- 0:00:00
500000 -- (-1041.887) (-1041.242) [-1041.343] (-1039.308) * (-1041.877) [-1044.738] (-1041.987) (-1042.011) -- 0:00:00
Average standard deviation of split frequencies: 0.011745
Analysis completed in 35 seconds
Analysis used 33.45 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1034.65
Likelihood of best state for "cold" chain of run 2 was -1034.72
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
79.3 % ( 77 %) Dirichlet(Revmat{all})
98.2 % ( 97 %) Slider(Revmat{all})
29.4 % ( 31 %) Dirichlet(Pi{all})
32.5 % ( 23 %) Slider(Pi{all})
77.9 % ( 69 %) Multiplier(Alpha{1,2})
88.8 % ( 80 %) Multiplier(Alpha{3})
28.0 % ( 23 %) Slider(Pinvar{all})
89.0 % ( 90 %) ExtSPR(Tau{all},V{all})
60.9 % ( 53 %) ExtTBR(Tau{all},V{all})
89.0 % ( 93 %) NNI(Tau{all},V{all})
78.2 % ( 79 %) ParsSPR(Tau{all},V{all})
30.5 % ( 31 %) Multiplier(V{all})
92.2 % ( 90 %) Nodeslider(V{all})
35.3 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
77.7 % ( 64 %) Dirichlet(Revmat{all})
98.1 % ( 98 %) Slider(Revmat{all})
28.1 % ( 31 %) Dirichlet(Pi{all})
31.8 % ( 26 %) Slider(Pi{all})
77.7 % ( 73 %) Multiplier(Alpha{1,2})
89.4 % ( 78 %) Multiplier(Alpha{3})
27.0 % ( 17 %) Slider(Pinvar{all})
89.2 % ( 88 %) ExtSPR(Tau{all},V{all})
61.2 % ( 64 %) ExtTBR(Tau{all},V{all})
89.1 % ( 88 %) NNI(Tau{all},V{all})
78.3 % ( 75 %) ParsSPR(Tau{all},V{all})
30.7 % ( 30 %) Multiplier(V{all})
91.9 % ( 89 %) Nodeslider(V{all})
35.4 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.79 0.62 0.48
2 | 83553 0.82 0.65
3 | 83408 83358 0.83
4 | 83344 83229 83108
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.79 0.61 0.47
2 | 83174 0.81 0.65
3 | 83014 83982 0.83
4 | 83554 83260 83016
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1040.49
| 2 2 2 1 2 |
| 2 1 2 2 |
| 1 1 2 12 2 1 |
| 1 22 21 2 2 1 |
| 1 12 1 1 2 2 11 |
|1 2 * 2 2 1 * 2 1 22|
| 1 1 212 2 2 2 1 1 1 12 1 |
| 1 11 2 2 2 1 1 1 2 2 1 |
| 2 2 2 2 2 1 11 1 1 2 22 1 |
| 2 21 1 1 1 2 |
| 1 1 1 2 2 2 2 1 2 |
|2 2 1 1 1 2 1 1 |
| 1 1 * |
| 2 2 1 1|
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1043.05
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1040.36 -1044.25
2 -1039.99 -1045.26
--------------------------------------
TOTAL -1040.15 -1044.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.867378 0.085904 0.345847 1.420957 0.828449 609.95 641.02 0.999
r(A<->C){all} 0.183516 0.024453 0.000457 0.488048 0.139534 125.40 142.54 1.009
r(A<->G){all} 0.198716 0.022710 0.000199 0.489660 0.162819 60.62 83.11 1.060
r(A<->T){all} 0.175851 0.021863 0.000011 0.469769 0.139719 93.68 154.01 1.010
r(C<->G){all} 0.114629 0.012792 0.000044 0.351432 0.078106 151.19 165.47 1.021
r(C<->T){all} 0.158335 0.020696 0.000028 0.448718 0.112089 105.90 114.73 1.000
r(G<->T){all} 0.168953 0.020769 0.000049 0.457586 0.128828 151.12 154.59 1.009
pi(A){all} 0.153523 0.000179 0.128252 0.179625 0.153268 557.89 593.35 0.999
pi(C){all} 0.293191 0.000297 0.257707 0.325088 0.293636 670.75 710.87 0.999
pi(G){all} 0.331321 0.000315 0.296237 0.366428 0.330976 596.61 622.21 1.000
pi(T){all} 0.221965 0.000250 0.194202 0.255379 0.221391 512.57 604.71 1.000
alpha{1,2} 0.344045 0.154305 0.000770 1.046784 0.226117 487.68 520.46 0.999
alpha{3} 0.352938 0.190226 0.000126 1.254449 0.173888 301.46 361.43 1.000
pinvar{all} 0.993102 0.000025 0.983685 0.999342 0.994246 541.86 555.09 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .*...*
9 -- ....**
10 -- .****.
11 -- .*..*.
12 -- ..****
13 -- .***.*
14 -- .**.**
15 -- ...**.
16 -- .**...
17 -- .*..**
18 -- .*.*..
19 -- ..*.*.
20 -- ..*..*
21 -- ...*.*
22 -- .*.***
23 -- ..***.
24 -- ..**.*
25 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 437 0.290945 0.021656 0.275632 0.306258 2
8 250 0.166445 0.000000 0.166445 0.166445 2
9 236 0.157124 0.007532 0.151798 0.162450 2
10 234 0.155792 0.015065 0.145140 0.166445 2
11 233 0.155126 0.004708 0.151798 0.158455 2
12 226 0.150466 0.005649 0.146471 0.154461 2
13 221 0.147137 0.027305 0.127830 0.166445 2
14 190 0.126498 0.026364 0.107856 0.145140 2
15 188 0.125166 0.005649 0.121172 0.129161 2
16 180 0.119840 0.003766 0.117177 0.122503 2
17 176 0.117177 0.003766 0.114514 0.119840 2
18 174 0.115846 0.009416 0.109188 0.122503 2
19 174 0.115846 0.013182 0.106525 0.125166 2
20 172 0.114514 0.009416 0.107856 0.121172 2
21 168 0.111851 0.016948 0.099867 0.123835 2
22 166 0.110519 0.001883 0.109188 0.111851 2
23 166 0.110519 0.011299 0.102530 0.118509 2
24 165 0.109854 0.023539 0.093209 0.126498 2
25 157 0.104527 0.016006 0.093209 0.115846 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.086528 0.008423 0.000020 0.274737 0.059993 0.999 2
length{all}[2] 0.088400 0.008514 0.000011 0.265356 0.062117 0.999 2
length{all}[3] 0.092078 0.008687 0.000116 0.280904 0.061884 1.000 2
length{all}[4] 0.091667 0.008722 0.000033 0.265704 0.061232 1.000 2
length{all}[5] 0.128900 0.013910 0.000028 0.357906 0.097695 0.999 2
length{all}[6] 0.090588 0.010238 0.000009 0.280466 0.058806 1.000 2
length{all}[7] 0.132151 0.015024 0.000518 0.371821 0.096620 0.998 2
length{all}[8] 0.096444 0.009135 0.000317 0.274957 0.065163 0.997 2
length{all}[9] 0.093523 0.008899 0.000326 0.275081 0.064674 1.001 2
length{all}[10] 0.092754 0.007778 0.000513 0.252626 0.072650 0.996 2
length{all}[11] 0.095036 0.009645 0.000767 0.283143 0.064287 0.996 2
length{all}[12] 0.081286 0.007044 0.000094 0.224316 0.062254 0.999 2
length{all}[13] 0.093039 0.006787 0.000008 0.267493 0.066445 0.996 2
length{all}[14] 0.078237 0.006741 0.000396 0.221049 0.052829 0.996 2
length{all}[15] 0.106519 0.010846 0.000047 0.344345 0.083466 0.995 2
length{all}[16] 0.089830 0.011198 0.000211 0.262221 0.055399 0.996 2
length{all}[17] 0.109314 0.011649 0.000576 0.321425 0.074134 0.996 2
length{all}[18] 0.073376 0.005964 0.000908 0.226314 0.052763 1.004 2
length{all}[19] 0.090409 0.007900 0.000027 0.250374 0.065338 0.994 2
length{all}[20] 0.098684 0.011128 0.000964 0.289721 0.072699 0.994 2
length{all}[21] 0.084041 0.008254 0.000388 0.244822 0.054176 1.002 2
length{all}[22] 0.086706 0.009958 0.000460 0.248839 0.058646 0.995 2
length{all}[23] 0.113399 0.011467 0.000316 0.291363 0.086240 1.001 2
length{all}[24] 0.094557 0.011936 0.001091 0.309905 0.057013 1.005 2
length{all}[25] 0.097244 0.012021 0.001436 0.304643 0.056901 0.994 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.011745
Maximum standard deviation of split frequencies = 0.027305
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.998
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------- C1 (1)
|
|---------------------------------------------- C2 (2)
|
|---------------------------------------------- C3 (3)
+
|--------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------- C6 (6)
|-------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 34 trees
90 % credible set contains 85 trees
95 % credible set contains 94 trees
99 % credible set contains 102 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 753
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 251 / 251 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 251 / 251 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 3
0.060485 0.086608 0.075758 0.057676 0.069379 0.055812 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1107.672485
Iterating by ming2
Initial: fx= 1107.672485
x= 0.06049 0.08661 0.07576 0.05768 0.06938 0.05581 0.30000 1.30000
1 h-m-p 0.0000 0.0002 584.8090 +++ 1032.480791 m 0.0002 14 | 1/8
2 h-m-p 0.0000 0.0000 1251.9050 ++ 1029.060217 m 0.0000 25 | 2/8
3 h-m-p 0.0000 0.0000 659.1119 ++ 1021.753208 m 0.0000 36 | 3/8
4 h-m-p 0.0005 0.0025 9.2592 +YYYYCCC 1019.035939 6 0.0019 56 | 3/8
5 h-m-p 0.0086 0.2240 2.0604 ++YYYCC 1018.332219 4 0.1292 74 | 3/8
6 h-m-p 0.2448 8.0000 1.0869 CCYC 1018.194349 3 0.2479 90 | 3/8
7 h-m-p 0.4752 3.4702 0.5670 YCCC 1018.058694 3 0.8624 106 | 3/8
8 h-m-p 0.1787 0.8934 2.3675 CYCCC 1017.862654 4 0.3132 129 | 3/8
9 h-m-p 1.6000 8.0000 0.4572 CYC 1017.803832 2 1.1294 143 | 3/8
10 h-m-p 0.8070 8.0000 0.6399 YC 1017.724503 1 1.8155 160 | 3/8
11 h-m-p 1.6000 8.0000 0.5399 CCCC 1017.674312 3 2.3346 182 | 3/8
12 h-m-p 1.6000 8.0000 0.5775 +YCCC 1017.616456 3 5.2095 204 | 3/8
13 h-m-p 1.6000 8.0000 1.0458 YCCC 1017.544008 3 3.8223 225 | 3/8
14 h-m-p 1.6000 8.0000 1.9557 CCC 1017.504541 2 2.1345 240 | 3/8
15 h-m-p 1.6000 8.0000 1.2987 +CC 1017.485532 1 6.1819 254 | 3/8
16 h-m-p 1.6000 8.0000 3.6805 YCC 1017.467985 2 2.8069 268 | 3/8
17 h-m-p 1.6000 8.0000 5.1891 YC 1017.456309 1 3.6458 280 | 3/8
18 h-m-p 1.6000 8.0000 8.1000 YCC 1017.449124 2 2.6586 294 | 3/8
19 h-m-p 1.6000 8.0000 11.2282 YC 1017.443329 1 3.9307 306 | 3/8
20 h-m-p 1.6000 8.0000 17.2035 YC 1017.440111 1 2.6751 318 | 3/8
21 h-m-p 1.6000 8.0000 24.2745 YC 1017.437542 1 3.8942 330 | 3/8
22 h-m-p 1.6000 8.0000 37.5950 YC 1017.436022 1 2.6756 342 | 3/8
23 h-m-p 1.6000 8.0000 52.9477 +YC 1017.434835 1 4.0287 355 | 3/8
24 h-m-p 1.0385 5.1927 81.8180 +YC 1017.434145 1 2.6027 368 | 3/8
25 h-m-p 0.3687 1.8436 114.9395 ++ 1017.433751 m 1.8436 379 | 4/8
26 h-m-p 1.6000 8.0000 0.0008 Y 1017.433750 0 0.9986 390 | 4/8
27 h-m-p 1.6000 8.0000 0.0000 C 1017.433750 0 0.4818 405 | 4/8
28 h-m-p 1.6000 8.0000 0.0000 ---Y 1017.433750 0 0.0028 423
Out..
lnL = -1017.433750
424 lfun, 424 eigenQcodon, 2544 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 3
0.075188 0.074989 0.101726 0.019325 0.094790 0.101875 1.201805 0.867803 0.349891
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.103419
np = 9
lnL0 = -1121.537611
Iterating by ming2
Initial: fx= 1121.537611
x= 0.07519 0.07499 0.10173 0.01933 0.09479 0.10187 1.20180 0.86780 0.34989
1 h-m-p 0.0000 0.0001 553.3026 ++ 1095.094013 m 0.0001 14 | 0/9
2 h-m-p 0.0000 0.0000 4481.4960 ++ 1036.234507 m 0.0000 26 | 1/9
3 h-m-p 0.0000 0.0000 15396.6807 ++ 1036.075348 m 0.0000 38 | 2/9
4 h-m-p 0.0000 0.0001 375.4444 ++ 1027.541625 m 0.0001 50 | 3/9
5 h-m-p 0.0005 0.0026 7.7197 +YYYCCC 1025.875170 5 0.0020 70 | 3/9
6 h-m-p 0.0008 0.0042 10.6458 +YYYYYCCCCC 1022.709339 9 0.0034 96 | 3/9
7 h-m-p 0.0138 0.1773 2.6404 +YCYCCC 1022.274158 5 0.0802 117 | 3/9
8 h-m-p 0.0490 0.2449 2.7870 +YCCCC 1021.885989 4 0.1345 137 | 3/9
9 h-m-p 0.3102 1.5512 0.2070 YCYCCC 1021.351982 5 0.8273 157 | 3/9
10 h-m-p 0.1861 0.9307 0.5926 +CC 1020.458011 1 0.7797 178 | 3/9
11 h-m-p 0.0741 0.3707 0.1932 ++ 1020.356335 m 0.3707 196 | 3/9
12 h-m-p 0.0000 0.0000 0.2169
h-m-p: 5.46268842e-18 2.73134421e-17 2.16865846e-01 1020.356335
.. | 3/9
13 h-m-p 0.0000 0.0001 3813.4889 CYCYCCC 1018.507773 6 0.0000 239 | 3/9
14 h-m-p 0.0000 0.0001 90.3570 CCCC 1018.432729 3 0.0000 257 | 3/9
15 h-m-p 0.0000 0.0002 24.7132 CCC 1018.428003 2 0.0000 273 | 3/9
16 h-m-p 0.0160 8.0000 0.1443 +++CCC 1018.412977 2 1.3326 292 | 3/9
17 h-m-p 0.0428 0.2141 0.2770 ++ 1018.405122 m 0.2141 310 | 4/9
18 h-m-p 0.1667 3.4339 0.2739 -C 1018.405117 0 0.0106 329 | 4/9
19 h-m-p 1.1740 8.0000 0.0025 C 1018.404882 0 1.2554 346 | 4/9
20 h-m-p 0.4040 8.0000 0.0077 ++YC 1018.404376 1 5.1839 366 | 4/9
21 h-m-p 1.6000 8.0000 0.0007 Y 1018.404371 0 0.9601 383 | 4/9
22 h-m-p 1.6000 8.0000 0.0000 ++ 1018.404369 m 8.0000 400 | 4/9
23 h-m-p 1.3126 8.0000 0.0001 C 1018.404368 0 1.4840 417 | 4/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1018.404368 0 1.0134 434 | 4/9
25 h-m-p 1.6000 8.0000 0.0000 +Y 1018.404368 0 4.8194 452 | 4/9
26 h-m-p 1.2502 8.0000 0.0000 ----------Y 1018.404368 0 0.0000 479
Out..
lnL = -1018.404368
480 lfun, 1440 eigenQcodon, 5760 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 3
0.055608 0.097376 0.086016 0.077231 0.013473 0.012785 1.044828 1.383933 0.436295 0.131862 1130.115689
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.054451
np = 11
lnL0 = -1045.370711
Iterating by ming2
Initial: fx= 1045.370711
x= 0.05561 0.09738 0.08602 0.07723 0.01347 0.01279 1.04483 1.38393 0.43629 0.13186 951.42857
1 h-m-p 0.0000 0.0003 98.3643 +++ 1042.798848 m 0.0003 17 | 1/11
2 h-m-p 0.0000 0.0000 3649.4509 ++ 1035.101013 m 0.0000 31 | 2/11
3 h-m-p 0.0000 0.0002 456.6112 +YCYCCC 1030.722659 5 0.0002 54 | 2/11
4 h-m-p 0.0000 0.0000 329.7082 ++ 1030.429436 m 0.0000 68 | 3/11
5 h-m-p 0.0000 0.0004 101.0802 +CYYYCYCCC 1028.145549 8 0.0003 95 | 3/11
6 h-m-p 0.0024 0.0708 12.6258 ++YCYYYCYCCC 1016.447097 9 0.0670 125 | 3/11
7 h-m-p 0.1676 0.8378 0.9686 +YCYCCC 1015.464043 5 0.5074 148 | 3/11
8 h-m-p 0.0248 0.1238 2.7956 YCYCCC 1015.033566 5 0.0688 178 | 3/11
9 h-m-p 0.1212 0.6061 0.3489 YCYCCC 1014.592440 5 0.3429 200 | 3/11
10 h-m-p 0.5703 2.9894 0.2098 +C 1014.361480 0 2.2272 223 | 3/11
11 h-m-p 0.0470 0.2351 0.6158 ++ 1014.294055 m 0.2351 245 | 4/11
12 h-m-p 0.1066 8.0000 1.3439 +CCCCC 1014.124802 4 0.4976 276 | 4/11
13 h-m-p 0.9502 4.7508 0.0375 YYCCC 1014.087208 4 0.9928 296 | 4/11
14 h-m-p 1.0887 7.6106 0.0342 YC 1014.080848 1 0.6088 318 | 4/11
15 h-m-p 1.0493 8.0000 0.0198 C 1014.080356 0 0.9482 339 | 4/11
16 h-m-p 1.6000 8.0000 0.0090 C 1014.080283 0 2.0581 360 | 4/11
17 h-m-p 1.6000 8.0000 0.0046 Y 1014.080275 0 0.8870 381 | 4/11
18 h-m-p 1.6000 8.0000 0.0004 C 1014.080274 0 2.4435 402 | 4/11
19 h-m-p 0.8444 8.0000 0.0012 ++ 1014.080269 m 8.0000 423 | 4/11
20 h-m-p 0.2857 8.0000 0.0339 ++C 1014.080221 0 5.0169 446 | 4/11
21 h-m-p 1.6000 8.0000 0.1055 ++ 1014.079861 m 8.0000 467 | 4/11
22 h-m-p 1.4905 8.0000 0.5665 YC 1014.079661 1 3.6234 489 | 4/11
23 h-m-p 1.6000 8.0000 0.2198 C 1014.079601 0 1.4846 510 | 4/11
24 h-m-p 0.8805 8.0000 0.3705 +Y 1014.079567 0 5.6832 532 | 4/11
25 h-m-p 1.6000 8.0000 1.1304 Y 1014.079517 0 2.5931 553 | 4/11
26 h-m-p 1.1290 8.0000 2.5963 ++ 1014.079234 m 8.0000 567 | 4/11
27 h-m-p 0.1225 0.6123 116.7924 ++ 1014.078410 m 0.6123 581 | 4/11
28 h-m-p -0.0000 -0.0000 433.6936
h-m-p: -0.00000000e+00 -0.00000000e+00 4.33693599e+02 1014.078410
.. | 4/11
29 h-m-p 0.0000 0.0011 3.9081 YC 1014.078261 1 0.0000 607 | 4/11
30 h-m-p 0.0001 0.0088 0.6298 Y 1014.078256 0 0.0000 621 | 4/11
31 h-m-p 0.0009 0.4370 0.0170 --Y 1014.078256 0 0.0000 644 | 4/11
32 h-m-p 0.0160 8.0000 0.0096 +++Y 1014.078229 0 0.7439 668 | 4/11
33 h-m-p 1.6000 8.0000 0.0008 C 1014.078228 0 2.3218 689 | 4/11
34 h-m-p 1.6000 8.0000 0.0002 C 1014.078228 0 1.6077 710 | 4/11
35 h-m-p 1.6000 8.0000 0.0001 Y 1014.078228 0 1.0003 731 | 4/11
36 h-m-p 0.4914 8.0000 0.0002 +C 1014.078228 0 2.3287 753 | 4/11
37 h-m-p 0.6746 8.0000 0.0007 ++ 1014.078228 m 8.0000 774 | 4/11
38 h-m-p 1.0958 8.0000 0.0051 ++ 1014.078225 m 8.0000 795 | 4/11
39 h-m-p 0.0485 8.0000 0.8376 +++YC 1014.078161 1 2.1916 820 | 4/11
40 h-m-p 1.6000 8.0000 0.9036 ++ 1014.077602 m 8.0000 841 | 4/11
41 h-m-p 0.0084 0.0419 501.4858 ++ 1014.076007 m 0.0419 862 | 5/11
42 h-m-p 0.0568 8.0000 0.0210 +C 1014.075984 0 0.2983 877 | 5/11
43 h-m-p 0.2802 8.0000 0.0224 C 1014.075932 0 0.4059 897 | 5/11
44 h-m-p 1.6000 8.0000 0.0011 Y 1014.075929 0 1.2620 917 | 5/11
45 h-m-p 1.6000 8.0000 0.0001 Y 1014.075929 0 0.2069 937 | 5/11
46 h-m-p 0.2554 8.0000 0.0001 --Y 1014.075929 0 0.0040 959
Out..
lnL = -1014.075929
960 lfun, 3840 eigenQcodon, 17280 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1019.557658 S = -1015.793388 -7.218351
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:08
did 20 / 57 patterns 0:08
did 30 / 57 patterns 0:08
did 40 / 57 patterns 0:08
did 50 / 57 patterns 0:08
did 57 / 57 patterns 0:08
Time used: 0:08
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 3
0.057295 0.031683 0.020092 0.038367 0.097859 0.040896 1.255541 0.858917 0.553535 499.500000 1040.068723 1661.771878
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 0.010091
np = 12
lnL0 = -1077.302814
Iterating by ming2
Initial: fx= 1077.302814
x= 0.05730 0.03168 0.02009 0.03837 0.09786 0.04090 1.25554 0.85892 0.55353 499.50000 951.42857 951.42857
1 h-m-p 0.0000 0.0001 555.0758 ++ 1051.788982 m 0.0001 17 | 0/12
2 h-m-p 0.0000 0.0000 4340.1907 ++ 1044.434954 m 0.0000 32 | 1/12
3 h-m-p 0.0000 0.0000 14552.2141 ++ 1037.044390 m 0.0000 47 | 2/12
4 h-m-p 0.0000 0.0001 321.6945 ++ 1028.378330 m 0.0001 62 | 3/12
5 h-m-p 0.0000 0.0001 240.7995 +YYYYCCC 1026.195817 6 0.0001 86 | 3/12
6 h-m-p 0.0068 0.0369 2.2313 +YYCYYYCC 1022.366680 7 0.0314 111 | 3/12
7 h-m-p 0.1048 0.5241 0.1566 YCCCC 1021.665098 4 0.2450 133 | 3/12
8 h-m-p 0.1692 0.8460 0.0720 CCC 1021.601388 2 0.1451 161 | 3/12
9 h-m-p 0.0115 0.9902 0.9059 ++YCCC 1020.079122 3 0.4252 192 | 3/12
10 h-m-p 0.0974 0.4872 0.1189 YCYCCC 1019.633740 5 0.2525 224 | 3/12
11 h-m-p 0.1596 8.0000 0.1882 +YYCCC 1019.296358 4 1.0395 255 | 3/12
12 h-m-p 1.3118 6.5590 0.0787 YCCCC 1019.049094 4 2.7211 286 | 3/12
13 h-m-p 1.6000 8.0000 0.0683 YCCC 1018.965206 3 3.0809 315 | 3/12
14 h-m-p 1.6000 8.0000 0.1111 CCC 1018.917397 2 2.1784 343 | 3/12
15 h-m-p 1.6000 8.0000 0.0746 +YC 1018.855369 1 7.1433 369 | 3/12
16 h-m-p 1.6000 8.0000 0.1506 ++ 1018.490600 m 8.0000 393 | 3/12
17 h-m-p 0.8759 4.3795 1.3315 YCYCCC 1018.208730 5 1.9243 425 | 3/12
18 h-m-p 0.8732 8.0000 2.9343 +CYCCC 1017.681663 4 3.0821 448 | 3/12
19 h-m-p 1.6000 8.0000 1.9466 YCCCC 1017.485835 4 3.2560 470 | 3/12
20 h-m-p 1.6000 8.0000 1.7709 YCC 1017.444050 2 2.7279 488 | 3/12
21 h-m-p 1.6000 8.0000 1.5046 C 1017.435102 0 1.4719 503 | 3/12
22 h-m-p 1.6000 8.0000 0.2599 YC 1017.434949 1 1.0701 519 | 3/12
23 h-m-p 1.6000 8.0000 0.0625 C 1017.434933 0 1.6931 543 | 3/12
24 h-m-p 1.6000 8.0000 0.0089 Y 1017.434933 0 1.2155 567 | 3/12
25 h-m-p 1.6000 8.0000 0.0002 ----Y 1017.434933 0 0.0016 595
Out..
lnL = -1017.434933
596 lfun, 2384 eigenQcodon, 10728 P(t)
Time used: 0:11
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 3
0.106311 0.106384 0.043698 0.063368 0.079946 0.027922 1.201649 0.698534 1.263035
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.078598
np = 9
lnL0 = -1110.162652
Iterating by ming2
Initial: fx= 1110.162652
x= 0.10631 0.10638 0.04370 0.06337 0.07995 0.02792 1.20165 0.69853 1.26303
1 h-m-p 0.0000 0.0001 542.8919 ++ 1074.703692 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 10282.8440 ++ 1044.618041 m 0.0000 26 | 1/9
3 h-m-p 0.0000 0.0000 1138.0422 +YYCYCC 1043.659062 5 0.0000 46 | 1/9
4 h-m-p 0.0000 0.0001 252.8616 +YYYCCC 1041.966251 5 0.0000 66 | 1/9
5 h-m-p 0.0002 0.0047 61.5425 +++ 1025.256620 m 0.0047 79 | 2/9
6 h-m-p 0.0000 0.0000 190.7846 ++ 1025.237384 m 0.0000 91 | 3/9
7 h-m-p 0.0014 0.6976 0.6360 ++++YCYYCCC 1023.489804 6 0.4824 116 | 3/9
8 h-m-p 0.1327 0.6634 1.3242 YCYCCC 1022.979615 5 0.3402 142 | 3/9
9 h-m-p 0.2025 1.0126 0.7485 YYCCC 1022.693558 4 0.3430 160 | 3/9
10 h-m-p 0.0016 0.0078 64.2168 C 1022.692420 0 0.0004 178 | 3/9
11 h-m-p 0.0220 0.4304 1.0948 +++ 1022.346847 m 0.4304 191 | 4/9
12 h-m-p 0.0258 0.3158 4.4974 +CCCC 1022.217591 3 0.1069 210 | 4/9
13 h-m-p 1.6000 8.0000 0.0347 +YCC 1022.179859 2 5.0178 226 | 4/9
14 h-m-p 1.6000 8.0000 0.0222 CCC 1022.171764 2 1.2785 247 | 4/9
15 h-m-p 0.7577 8.0000 0.0374 CC 1022.170139 1 0.1663 266 | 4/9
16 h-m-p 0.0565 8.0000 0.1100 C 1022.168241 0 0.0565 283 | 4/9
17 h-m-p 0.0355 6.6659 0.1751 C 1022.166257 0 0.0355 300 | 4/9
18 h-m-p 0.0263 4.5426 0.2364 CC 1022.164532 1 0.0234 319 | 4/9
19 h-m-p 0.0185 3.4531 0.2983 CC 1022.163077 1 0.0160 338 | 4/9
20 h-m-p 0.0129 2.8074 0.3705 CC 1022.161826 1 0.0116 357 | 4/9
21 h-m-p 0.0092 2.0354 0.4656 C 1022.160757 0 0.0090 374 | 4/9
22 h-m-p 0.0070 1.0974 0.5945 C 1022.159903 0 0.0066 391 | 4/9
23 h-m-p 0.0052 0.6940 0.7632 C 1022.159168 0 0.0052 408 | 4/9
24 h-m-p 0.0040 0.4797 0.9737 C 1022.158531 0 0.0040 425 | 4/9
25 h-m-p 0.0032 0.3508 1.2275 C 1022.157962 0 0.0034 442 | 4/9
26 h-m-p 0.1224 8.0000 0.0338 +++YCCC 1022.050518 3 5.4457 462 | 4/9
27 h-m-p 0.2780 1.3899 0.0732 YCC 1022.043589 2 0.1492 482 | 4/9
28 h-m-p 0.0387 3.0885 0.2820 ++YYC 1022.018116 2 0.4959 503 | 4/9
29 h-m-p 0.3190 1.5949 0.4018 YCC 1022.008510 2 0.2015 523 | 4/9
30 h-m-p 0.0793 0.5725 1.0210 CCC 1021.992082 2 0.1303 544 | 4/9
31 h-m-p 0.8318 6.1549 0.1599 YCCC 1021.923041 3 1.3902 561 | 4/9
32 h-m-p 0.2541 1.2704 0.4890 CC 1021.922205 1 0.0517 580 | 4/9
33 h-m-p 0.2176 3.4286 0.1162 CC 1021.919086 1 0.1873 599 | 4/9
34 h-m-p 0.3664 3.1064 0.0594 CY 1021.916584 1 0.0998 618 | 4/9
35 h-m-p 0.0196 2.1546 0.3019 +YC 1021.914861 1 0.0586 637 | 4/9
36 h-m-p 0.0299 1.7128 0.5921 CC 1021.913825 1 0.0356 656 | 4/9
37 h-m-p 0.0242 1.4972 0.8724 C 1021.913176 0 0.0238 673 | 4/9
38 h-m-p 0.0180 1.1643 1.1511 C 1021.912704 0 0.0174 690 | 4/9
39 h-m-p 0.1377 8.0000 0.1455 ++YYCCC 1021.878589 4 2.2719 710 | 4/9
40 h-m-p 0.5797 2.8985 0.3511 -YC 1021.878405 1 0.0625 729 | 4/9
41 h-m-p 0.0876 3.9337 0.2503 YC 1021.877217 1 0.1994 747 | 4/9
42 h-m-p 0.1035 1.9198 0.4825 C 1021.875945 0 0.0900 764 | 4/9
43 h-m-p 0.0658 1.3349 0.6604 C 1021.874475 0 0.0658 781 | 4/9
44 h-m-p 0.0544 1.0679 0.7982 YC 1021.873172 1 0.0447 799 | 4/9
45 h-m-p 0.0385 0.6425 0.9265 CC 1021.871948 1 0.0337 818 | 4/9
46 h-m-p 0.0291 0.3536 1.0726 CY 1021.870921 1 0.0249 837 | 4/9
47 h-m-p 0.3962 8.0000 0.0674 ++YCYC 1021.830750 3 6.9479 855 | 3/9
48 h-m-p 0.0008 0.0041 58.3764 YCYC 1021.830327 3 0.0001 876 | 3/9
49 h-m-p 0.1150 8.0000 0.0432 +CYC 1021.828319 2 0.3950 892 | 3/9
50 h-m-p 0.0801 5.8086 0.2131 +YCC 1021.819789 2 0.6746 914 | 3/9
51 h-m-p 0.8664 4.3318 0.0134 --C 1021.819788 0 0.0141 934 | 3/9
52 h-m-p 0.0100 1.6740 0.0190 +Y 1021.819783 0 0.0289 953 | 3/9
53 h-m-p 0.0175 1.7095 0.0314 C 1021.819779 0 0.0237 971 | 3/9
54 h-m-p 0.0180 1.9978 0.0414 C 1021.819777 0 0.0181 989 | 3/9
55 h-m-p 0.0145 2.6250 0.0515 C 1021.819775 0 0.0134 1007 | 3/9
56 h-m-p 0.0111 4.2866 0.0621 C 1021.819774 0 0.0092 1025 | 3/9
57 h-m-p 0.0160 8.0000 0.0733 C 1021.819774 0 0.0055 1043 | 3/9
58 h-m-p 0.0160 8.0000 0.0853 Y 1021.819774 0 0.0022 1061 | 3/9
59 h-m-p 0.0160 8.0000 0.0975 ------C 1021.819774 0 0.0000 1085 | 3/9
60 h-m-p 0.0067 3.3413 0.7272 Y 1021.819773 0 0.0013 1103 | 3/9
61 h-m-p 0.0160 8.0000 0.1224 -------------.. | 3/9
62 h-m-p 0.0000 0.0002 268871.0751 ---YCYCCCC 1018.412028 6 0.0000 1164 | 3/9
63 h-m-p 0.0001 0.0006 10.0365 YC 1018.411198 1 0.0000 1177 | 3/9
64 h-m-p 0.0002 0.0193 0.7770 YC 1018.411165 1 0.0001 1190 | 3/9
65 h-m-p 0.0003 0.1503 4.5131 YC 1018.410840 1 0.0002 1209 | 3/9
66 h-m-p 0.0243 1.5944 0.0393 ++++ 1018.410004 m 1.5944 1223 | 3/9
67 h-m-p -0.0000 -0.0000 0.0006
h-m-p: -0.00000000e+00 -0.00000000e+00 6.25611366e-04 1018.410004
.. | 3/9
68 h-m-p 0.0001 0.0306 0.1762 C 1018.410004 0 0.0000 1256 | 3/9
69 h-m-p 0.0160 8.0000 0.0071 Y 1018.410003 0 0.0360 1274 | 3/9
70 h-m-p 0.0003 0.1275 2.2903 -C 1018.410003 0 0.0000 1293 | 3/9
71 h-m-p 0.0137 2.0059 0.0029 ----Y 1018.410003 0 0.0000 1309 | 3/9
72 h-m-p 0.0160 8.0000 0.0003 ++Y 1018.410003 0 0.5442 1329 | 3/9
73 h-m-p 0.0085 0.1577 0.0177 +++ 1018.410002 m 0.1577 1348 | 4/9
74 h-m-p 0.8649 8.0000 0.0032 C 1018.410002 0 0.3289 1366 | 4/9
75 h-m-p 1.6000 8.0000 0.0001 C 1018.410002 0 1.2848 1383 | 4/9
76 h-m-p 1.6000 8.0000 0.0000 Y 1018.410002 0 1.2397 1400 | 4/9
77 h-m-p 1.6000 8.0000 0.0000 Y 1018.410002 0 0.7527 1417 | 4/9
78 h-m-p 0.2538 8.0000 0.0000 Y 1018.410002 0 0.2538 1434 | 4/9
79 h-m-p 0.1374 8.0000 0.0000 ------C 1018.410002 0 0.0000 1457
Out..
lnL = -1018.410002
1458 lfun, 16038 eigenQcodon, 87480 P(t)
Time used: 0:33
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 3
0.066029 0.055286 0.059713 0.029062 0.079407 0.072318 1.057126 0.900000 0.736564 1.971284 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.082837
np = 11
lnL0 = -1037.100050
Iterating by ming2
Initial: fx= 1037.100050
x= 0.06603 0.05529 0.05971 0.02906 0.07941 0.07232 1.05713 0.90000 0.73656 1.97128 951.42857
1 h-m-p 0.0000 0.0006 174.6986 ++CYYYYYYYYC 1024.322092 10 0.0005 30 | 0/11
2 h-m-p 0.0003 0.0014 41.1052 ++ 1021.618135 m 0.0014 44 | 1/11
3 h-m-p 0.0000 0.0000 87223.9383 +YCYC 1021.141944 3 0.0000 63 | 1/11
4 h-m-p 0.0001 0.0004 76.1987 +YYCYCCC 1020.655452 6 0.0003 87 | 1/11
5 h-m-p 0.0000 0.0001 110.2762 +YYCC 1020.548957 3 0.0001 106 | 1/11
6 h-m-p 0.0001 0.0003 9.9257 +CC 1020.536615 1 0.0002 123 | 1/11
7 h-m-p 0.0002 0.0012 0.8771 ++ 1020.529343 m 0.0012 137 | 2/11
8 h-m-p 0.0006 0.0870 1.7705 +++YYCYYCCCC 1018.897162 8 0.0687 177 | 2/11
9 h-m-p 0.1791 1.5816 0.6791 +YYYYYYCCCC 1018.388374 10 0.7256 205 | 2/11
10 h-m-p 0.2574 1.2871 0.3434 CYCCC 1018.037204 4 0.4716 235 | 2/11
11 h-m-p 0.1208 0.6040 0.5388 CYCCC 1017.887918 4 0.2259 265 | 2/11
12 h-m-p 0.2873 1.6986 0.4237 CCCC 1017.778093 3 0.4916 294 | 2/11
13 h-m-p 0.7141 5.6959 0.2917 CCC 1017.710683 2 1.0093 321 | 2/11
14 h-m-p 1.0111 5.0557 0.2462 CYCCC 1017.607597 4 1.6669 351 | 2/11
15 h-m-p 0.6378 3.1891 0.5578 YCYCCC 1017.362867 5 1.5012 382 | 2/11
16 h-m-p 0.3118 1.5589 0.6111 CC 1017.318271 1 0.3125 407 | 2/11
17 h-m-p 1.0133 5.0663 0.1010 YCCCC 1017.279947 4 1.1078 437 | 2/11
18 h-m-p 0.4768 3.1867 0.2346 CCC 1017.272231 2 0.5976 464 | 2/11
19 h-m-p 1.6000 8.0000 0.0238 CC 1017.271013 1 0.4814 489 | 2/11
20 h-m-p 0.9629 8.0000 0.0119 YC 1017.270804 1 0.6123 513 | 2/11
21 h-m-p 1.6000 8.0000 0.0036 C 1017.270779 0 0.5737 536 | 2/11
22 h-m-p 1.6000 8.0000 0.0009 C 1017.270778 0 1.7057 559 | 2/11
23 h-m-p 1.6000 8.0000 0.0009 +Y 1017.270777 0 4.3837 583 | 2/11
24 h-m-p 1.3240 8.0000 0.0030 Y 1017.270775 0 2.5855 606 | 2/11
25 h-m-p 1.6000 8.0000 0.0011 ++ 1017.270772 m 8.0000 629 | 2/11
26 h-m-p 0.7819 8.0000 0.0116 ++ 1017.270730 m 8.0000 652 | 2/11
27 h-m-p 0.0146 7.2880 6.5391 ++++YC 1017.266763 1 2.7638 680 | 2/11
28 h-m-p 0.5087 2.5434 11.6313 ++ 1017.253591 m 2.5434 694 | 3/11
29 h-m-p 0.0652 2.2026 41.9466 C 1017.253189 0 0.0742 708 | 3/11
30 h-m-p 1.6000 8.0000 0.6094 YC 1017.251718 1 0.7925 723 | 3/11
31 h-m-p 0.4549 8.0000 1.0616 +C 1017.251687 0 1.7221 746 | 3/11
32 h-m-p 1.5840 8.0000 1.1542 ++ 1017.251551 m 8.0000 760 | 3/11
33 h-m-p 1.6000 8.0000 4.2205 YC 1017.251461 1 2.7566 775 | 3/11
34 h-m-p 1.6000 8.0000 6.3267 C 1017.251411 0 2.0564 789 | 3/11
35 h-m-p 1.6000 8.0000 6.0407 +Y 1017.251371 0 4.5872 804 | 3/11
36 h-m-p 0.4109 2.0545 12.4664 ++ 1017.251346 m 2.0545 818 | 3/11
37 h-m-p 0.0000 0.0000 13.6830
h-m-p: 0.00000000e+00 0.00000000e+00 1.36829882e+01 1017.251346
.. | 3/11
38 h-m-p 0.0000 0.0242 0.2418 Y 1017.251345 0 0.0000 843 | 3/11
39 h-m-p 0.0003 0.1645 0.0514 --------Y 1017.251345 0 0.0000 873 | 3/11
40 h-m-p 0.0005 0.2332 0.0371 Y 1017.251345 0 0.0001 895 | 3/11
41 h-m-p 0.0160 8.0000 0.0195 -------------.. | 3/11
42 h-m-p 0.0023 1.1283 0.0981 ------------ | 3/11
43 h-m-p 0.0023 1.1283 0.0981 ------------
Out..
lnL = -1017.251345
993 lfun, 11916 eigenQcodon, 65538 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1029.415948 S = -1021.890914 -10.632601
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:49
did 20 / 57 patterns 0:49
did 30 / 57 patterns 0:50
did 40 / 57 patterns 0:50
did 50 / 57 patterns 0:50
did 57 / 57 patterns 0:50
Time used: 0:50
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=251
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
NC_002677_1_NP_302384_1_1256_ML2075 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAERLVTPQRSASG
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG
*************************************** **********
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
NC_002677_1_NP_302384_1_1256_ML2075 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA
**************************************************
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
NC_002677_1_NP_302384_1_1256_ML2075 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA
**************************************************
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
NC_002677_1_NP_302384_1_1256_ML2075 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS
**************************************************
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
NC_002677_1_NP_302384_1_1256_ML2075 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH
***.**********************************************
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 R
NC_002677_1_NP_302384_1_1256_ML2075 R
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 R
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 R
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 R
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 R
*
>NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC CGC >NC_002677_1_NP_302384_1_1256_ML2075 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC CGC >NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC GACCTGATCTTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC CGC >NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC GACCTGATCTTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC CGC >NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC GTTTCCTGGAGGCTGAGAGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC CGC >NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 GTGAGTGCGCCCGATAGCCCGGCACTGGTCGGGATGTCGATTGGGGCGGT CTTGGATCTGCTGAGGTCGGATTTTCCTGATGTGACAATCTCCAAGATTC GTTTCCTGGAGGCTGAGGGGCTCGTGACCCCTCAGCGTTCTGCATCGGGG TACCGGCGGTTCACCGCGTATGATTGTGCACGGCTGCGGTTCATCCTAAC TGCACAGCGCGATCACTATCTACCGCTGAAGGTTATTAGGGCGCAGCTGG ACGCCCAGCCTGATGGTGAGTTACCATCATTCGGGTCGCCTTATGTCGCA CCCCGATTGTTTTCGGTGACGGGCGGCCCGGGTGCCGGTGTCGGATCGGG GGTCGGATCCGACATCCCGGCGGTATCGCCCGCCGGCGTCCGGCTGAGTC GAGAAGACCTCTTGGACCGCTCAGGAGTGGCAGACGACTTGTTGACGGCG CTGCTCAAGGCCGGTGTGATTACCACCGGGCCGGGCGGATTTTTCGATGA GCATGCAATCGTGATCCTCCAATGCGCGCGGGCGCTGTCCGAGTACGGTG TTGAGCCGCGGCATCTGCGAGCCTTCCGGTCAGCGGCTGACCGCCAGTCC GACCTGATCGTCCAAATCGCCGGGCCGATCGTCAAAGCCGGTAAGGCCGG TGCCCGTGACCGCGCCGACGACTTGGCGCGTGAGGTTGCTGCGCTCGCCA TCACTTTGCACACTTCGTTGATCAAATCTGCGGTTCGCGGCGTTCTACAC CGC
>NC_011896_1_WP_010908704_1_2210_MLBR_RS10465 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH R >NC_002677_1_NP_302384_1_1256_ML2075 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH R >NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH R >NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS DLIFQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH R >NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAERLVTPQRSASG YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH R >NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670 VSAPDSPALVGMSIGAVLDLLRSDFPDVTISKIRFLEAEGLVTPQRSASG YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPSFGSPYVA PRLFSVTGGPGAGVGSGVGSDIPAVSPAGVRLSREDLLDRSGVADDLLTA LLKAGVITTGPGGFFDEHAIVILQCARALSEYGVEPRHLRAFRSAADRQS DLIVQIAGPIVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRGVLH R
#NEXUS
[ID: 5807435921]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908704_1_2210_MLBR_RS10465
NC_002677_1_NP_302384_1_1256_ML2075
NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780
NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175
NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355
NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908704_1_2210_MLBR_RS10465,
2 NC_002677_1_NP_302384_1_1256_ML2075,
3 NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780,
4 NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175,
5 NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355,
6 NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.059993,2:0.06211662,3:0.06188394,4:0.06123185,5:0.09769542,6:0.05880647);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.059993,2:0.06211662,3:0.06188394,4:0.06123185,5:0.09769542,6:0.05880647);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1040.36 -1044.25
2 -1039.99 -1045.26
--------------------------------------
TOTAL -1040.15 -1044.87
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2075/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.867378 0.085904 0.345847 1.420957 0.828449 609.95 641.02 0.999
r(A<->C){all} 0.183516 0.024453 0.000457 0.488048 0.139534 125.40 142.54 1.009
r(A<->G){all} 0.198716 0.022710 0.000199 0.489660 0.162819 60.62 83.11 1.060
r(A<->T){all} 0.175851 0.021863 0.000011 0.469769 0.139719 93.68 154.01 1.010
r(C<->G){all} 0.114629 0.012792 0.000044 0.351432 0.078106 151.19 165.47 1.021
r(C<->T){all} 0.158335 0.020696 0.000028 0.448718 0.112089 105.90 114.73 1.000
r(G<->T){all} 0.168953 0.020769 0.000049 0.457586 0.128828 151.12 154.59 1.009
pi(A){all} 0.153523 0.000179 0.128252 0.179625 0.153268 557.89 593.35 0.999
pi(C){all} 0.293191 0.000297 0.257707 0.325088 0.293636 670.75 710.87 0.999
pi(G){all} 0.331321 0.000315 0.296237 0.366428 0.330976 596.61 622.21 1.000
pi(T){all} 0.221965 0.000250 0.194202 0.255379 0.221391 512.57 604.71 1.000
alpha{1,2} 0.344045 0.154305 0.000770 1.046784 0.226117 487.68 520.46 0.999
alpha{3} 0.352938 0.190226 0.000126 1.254449 0.173888 301.46 361.43 1.000
pinvar{all} 0.993102 0.000025 0.983685 0.999342 0.994246 541.86 555.09 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2075/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 251
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 6 6 7 7 6 6 | TCC 4 4 4 4 4 4 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 4 4 4 4 4 4 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 5 5 5 5 5 5 | CCC 3 3 3 3 3 3 | CAC 3 3 3 3 3 3 | CGC 6 6 6 6 6 6
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 12 12 12 12 12 12 | CCG 7 7 7 7 7 7 | CAG 5 5 5 5 5 5 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 3 3 3 3 3 3 | Asn AAT 0 0 0 0 0 0 | Ser AGT 2 2 2 2 2 2
ATC 10 10 10 10 10 10 | ACC 4 4 4 4 4 4 | AAC 0 0 0 0 0 0 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 2 2 2 2 2 | AAG 4 4 4 4 4 4 | AGG 2 2 2 2 3 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 3 3 3 3 3 3 | Asp GAT 8 8 8 8 8 8 | Gly GGT 7 7 7 7 7 7
GTC 8 8 7 7 8 8 | GCC 11 11 11 11 11 11 | GAC 11 11 11 11 11 11 | GGC 5 5 5 5 5 5
GTA 1 1 1 1 1 1 | GCA 7 7 7 7 7 7 | Glu GAA 1 1 1 1 1 1 | GGA 4 4 4 4 4 4
GTG 7 7 7 7 7 7 | GCG 12 12 12 12 12 12 | GAG 7 7 7 7 7 7 | GGG 8 8 8 8 7 8
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465
position 1: T:0.16733 C:0.27092 A:0.14343 G:0.41833
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22178 C:0.29615 A:0.15272 G:0.32935
#2: NC_002677_1_NP_302384_1_1256_ML2075
position 1: T:0.16733 C:0.27092 A:0.14343 G:0.41833
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22178 C:0.29615 A:0.15272 G:0.32935
#3: NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780
position 1: T:0.17131 C:0.27092 A:0.14343 G:0.41434
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22311 C:0.29615 A:0.15272 G:0.32802
#4: NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175
position 1: T:0.17131 C:0.27092 A:0.14343 G:0.41434
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22311 C:0.29615 A:0.15272 G:0.32802
#5: NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355
position 1: T:0.16733 C:0.27092 A:0.14741 G:0.41434
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22178 C:0.29615 A:0.15405 G:0.32802
#6: NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670
position 1: T:0.16733 C:0.27092 A:0.14343 G:0.41833
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22178 C:0.29615 A:0.15272 G:0.32935
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 12 | Tyr Y TAT 18 | Cys C TGT 6
TTC 38 | TCC 24 | TAC 12 | TGC 6
Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 48 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 24 | His H CAT 12 | Arg R CGT 24
CTC 30 | CCC 18 | CAC 18 | CGC 36
CTA 18 | CCA 6 | Gln Q CAA 12 | CGA 18
CTG 72 | CCG 42 | CAG 30 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 18 | Asn N AAT 0 | Ser S AGT 12
ATC 60 | ACC 24 | AAC 0 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 6 | ACG 12 | AAG 24 | AGG 13
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 18 | Asp D GAT 48 | Gly G GGT 42
GTC 46 | GCC 66 | GAC 66 | GGC 30
GTA 6 | GCA 42 | Glu E GAA 6 | GGA 24
GTG 42 | GCG 72 | GAG 42 | GGG 47
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16866 C:0.27092 A:0.14409 G:0.41633
position 2: T:0.29482 C:0.29880 A:0.19920 G:0.20717
position 3: T:0.20319 C:0.31873 A:0.11554 G:0.36255
Average T:0.22222 C:0.29615 A:0.15294 G:0.32869
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 3
lnL(ntime: 6 np: 8): -1017.433750 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004009 0.004009 0.004010 0.000004 1.201805 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.012041
(1: 0.000004, 2: 0.000004, 3: 0.004009, 4: 0.004009, 5: 0.004010, 6: 0.000004);
(NC_011896_1_WP_010908704_1_2210_MLBR_RS10465: 0.000004, NC_002677_1_NP_302384_1_1256_ML2075: 0.000004, NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780: 0.004009, NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175: 0.004009, NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355: 0.004010, NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.20180
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 537.9 215.1 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 537.9 215.1 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.004 537.9 215.1 999.0000 0.0019 0.0000 1.0 0.0
7..4 0.004 537.9 215.1 999.0000 0.0019 0.0000 1.0 0.0
7..5 0.004 537.9 215.1 999.0000 0.0019 0.0000 1.0 0.0
7..6 0.000 537.9 215.1 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0056
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 3
lnL(ntime: 6 np: 9): -1018.404368 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004033 0.004033 0.004033 0.000004 1.044828 0.210386 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.012112
(1: 0.000004, 2: 0.000004, 3: 0.004033, 4: 0.004033, 5: 0.004033, 6: 0.000004);
(NC_011896_1_WP_010908704_1_2210_MLBR_RS10465: 0.000004, NC_002677_1_NP_302384_1_1256_ML2075: 0.000004, NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780: 0.004033, NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175: 0.004033, NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355: 0.004033, NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.04483
MLEs of dN/dS (w) for site classes (K=2)
p: 0.21039 0.78961
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 539.3 213.7 0.7896 0.0000 0.0000 0.0 0.0
7..2 0.000 539.3 213.7 0.7896 0.0000 0.0000 0.0 0.0
7..3 0.004 539.3 213.7 0.7896 0.0012 0.0016 0.7 0.3
7..4 0.004 539.3 213.7 0.7896 0.0012 0.0016 0.7 0.3
7..5 0.004 539.3 213.7 0.7896 0.0012 0.0016 0.7 0.3
7..6 0.000 539.3 213.7 0.7896 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 3
lnL(ntime: 6 np: 11): -1014.075929 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004051 0.004050 0.004115 0.000004 1.255541 0.984148 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.012228
(1: 0.000004, 2: 0.000004, 3: 0.004051, 4: 0.004050, 5: 0.004115, 6: 0.000004);
(NC_011896_1_WP_010908704_1_2210_MLBR_RS10465: 0.000004, NC_002677_1_NP_302384_1_1256_ML2075: 0.000004, NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780: 0.004051, NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175: 0.004050, NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355: 0.004115, NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.25554
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98415 0.00000 0.01585
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 537.4 215.6 15.8361 0.0000 0.0000 0.0 0.0
7..2 0.000 537.4 215.6 15.8361 0.0000 0.0000 0.0 0.0
7..3 0.004 537.4 215.6 15.8361 0.0018 0.0001 1.0 0.0
7..4 0.004 537.4 215.6 15.8361 0.0018 0.0001 1.0 0.0
7..5 0.004 537.4 215.6 15.8361 0.0019 0.0001 1.0 0.0
7..6 0.000 537.4 215.6 15.8361 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
40 G 1.000** 999.000
204 V 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
1 V 0.512 4.618 +- 4.045
2 S 0.513 4.626 +- 4.046
3 A 0.512 4.618 +- 4.045
4 P 0.512 4.621 +- 4.045
5 D 0.512 4.622 +- 4.045
6 S 0.513 4.623 +- 4.046
7 P 0.512 4.620 +- 4.045
8 A 0.513 4.627 +- 4.046
9 L 0.512 4.622 +- 4.045
10 V 0.512 4.620 +- 4.045
11 G 0.512 4.619 +- 4.045
12 M 0.512 4.619 +- 4.045
13 S 0.513 4.622 +- 4.045
14 I 0.513 4.625 +- 4.046
15 G 0.512 4.619 +- 4.045
16 A 0.512 4.618 +- 4.045
17 V 0.512 4.620 +- 4.045
18 L 0.513 4.623 +- 4.046
19 D 0.512 4.622 +- 4.045
20 L 0.512 4.622 +- 4.045
21 L 0.512 4.622 +- 4.045
22 R 0.513 4.623 +- 4.046
23 S 0.513 4.622 +- 4.045
24 D 0.512 4.622 +- 4.045
25 F 0.513 4.624 +- 4.046
26 P 0.513 4.625 +- 4.046
27 D 0.512 4.622 +- 4.045
28 V 0.512 4.618 +- 4.045
29 T 0.513 4.628 +- 4.046
30 I 0.512 4.621 +- 4.045
31 S 0.513 4.622 +- 4.045
32 K 0.513 4.623 +- 4.046
33 I 0.513 4.625 +- 4.046
34 R 0.513 4.626 +- 4.046
35 F 0.512 4.621 +- 4.045
36 L 0.512 4.622 +- 4.045
37 E 0.512 4.617 +- 4.045
38 A 0.513 4.624 +- 4.046
39 E 0.512 4.617 +- 4.045
40 G 0.882 7.510 +- 3.050
41 L 0.512 4.621 +- 4.045
42 V 0.512 4.618 +- 4.045
43 T 0.513 4.622 +- 4.045
44 P 0.513 4.625 +- 4.046
45 Q 0.512 4.621 +- 4.045
46 R 0.513 4.626 +- 4.046
47 S 0.513 4.626 +- 4.046
48 A 0.513 4.627 +- 4.046
49 S 0.513 4.622 +- 4.045
50 G 0.512 4.619 +- 4.045
51 Y 0.513 4.624 +- 4.046
52 R 0.513 4.622 +- 4.045
53 R 0.513 4.622 +- 4.045
54 F 0.512 4.621 +- 4.045
55 T 0.513 4.622 +- 4.045
56 A 0.512 4.618 +- 4.045
57 Y 0.513 4.627 +- 4.046
58 D 0.512 4.622 +- 4.045
59 C 0.513 4.626 +- 4.046
60 A 0.513 4.627 +- 4.046
61 R 0.513 4.622 +- 4.045
62 L 0.512 4.622 +- 4.045
63 R 0.513 4.622 +- 4.045
64 F 0.512 4.621 +- 4.045
65 I 0.512 4.621 +- 4.045
66 L 0.513 4.628 +- 4.046
67 T 0.513 4.626 +- 4.046
68 A 0.513 4.627 +- 4.046
69 Q 0.512 4.621 +- 4.045
70 R 0.513 4.623 +- 4.045
71 D 0.512 4.622 +- 4.045
72 H 0.512 4.621 +- 4.045
73 Y 0.513 4.627 +- 4.046
74 L 0.513 4.628 +- 4.046
75 P 0.512 4.620 +- 4.045
76 L 0.512 4.622 +- 4.045
77 K 0.513 4.623 +- 4.046
78 V 0.513 4.624 +- 4.046
79 I 0.513 4.625 +- 4.046
80 R 0.513 4.623 +- 4.046
81 A 0.512 4.618 +- 4.045
82 Q 0.512 4.621 +- 4.045
83 L 0.512 4.622 +- 4.045
84 D 0.512 4.618 +- 4.045
85 A 0.512 4.620 +- 4.045
86 Q 0.512 4.621 +- 4.045
87 P 0.513 4.625 +- 4.046
88 D 0.512 4.622 +- 4.045
89 G 0.513 4.625 +- 4.046
90 E 0.512 4.617 +- 4.045
91 L 0.513 4.628 +- 4.046
92 P 0.513 4.628 +- 4.046
93 S 0.513 4.629 +- 4.046
94 F 0.512 4.621 +- 4.045
95 G 0.512 4.619 +- 4.045
96 S 0.513 4.622 +- 4.045
97 P 0.513 4.625 +- 4.046
98 Y 0.513 4.627 +- 4.046
99 V 0.512 4.620 +- 4.045
100 A 0.513 4.627 +- 4.046
101 P 0.512 4.621 +- 4.045
102 R 0.513 4.629 +- 4.046
103 L 0.513 4.623 +- 4.046
104 F 0.513 4.624 +- 4.046
105 S 0.513 4.622 +- 4.045
106 V 0.512 4.618 +- 4.045
107 T 0.512 4.621 +- 4.045
108 G 0.512 4.620 +- 4.045
109 G 0.512 4.620 +- 4.045
110 P 0.512 4.620 +- 4.045
111 G 0.513 4.625 +- 4.046
112 A 0.512 4.620 +- 4.045
113 G 0.513 4.625 +- 4.046
114 V 0.512 4.620 +- 4.045
115 G 0.513 4.628 +- 4.046
116 S 0.513 4.622 +- 4.045
117 G 0.512 4.619 +- 4.045
118 V 0.512 4.620 +- 4.045
119 G 0.513 4.628 +- 4.046
120 S 0.513 4.622 +- 4.045
121 D 0.512 4.618 +- 4.045
122 I 0.512 4.621 +- 4.045
123 P 0.512 4.620 +- 4.045
124 A 0.512 4.618 +- 4.045
125 V 0.513 4.627 +- 4.046
126 S 0.513 4.622 +- 4.045
127 P 0.512 4.621 +- 4.045
128 A 0.512 4.620 +- 4.045
129 G 0.512 4.620 +- 4.045
130 V 0.512 4.620 +- 4.045
131 R 0.513 4.622 +- 4.045
132 L 0.512 4.622 +- 4.045
133 S 0.513 4.626 +- 4.046
134 R 0.513 4.629 +- 4.046
135 E 0.513 4.625 +- 4.046
136 D 0.512 4.618 +- 4.045
137 L 0.512 4.621 +- 4.045
138 L 0.513 4.623 +- 4.046
139 D 0.512 4.618 +- 4.045
140 R 0.513 4.623 +- 4.045
141 S 0.513 4.629 +- 4.046
142 G 0.513 4.628 +- 4.046
143 V 0.512 4.618 +- 4.045
144 A 0.513 4.627 +- 4.046
145 D 0.512 4.618 +- 4.045
146 D 0.512 4.618 +- 4.045
147 L 0.513 4.623 +- 4.046
148 L 0.513 4.623 +- 4.046
149 T 0.512 4.621 +- 4.045
150 A 0.512 4.618 +- 4.045
151 L 0.512 4.622 +- 4.045
152 L 0.512 4.621 +- 4.045
153 K 0.513 4.623 +- 4.046
154 A 0.512 4.620 +- 4.045
155 G 0.513 4.625 +- 4.046
156 V 0.512 4.618 +- 4.045
157 I 0.513 4.625 +- 4.046
158 T 0.513 4.622 +- 4.045
159 T 0.513 4.622 +- 4.045
160 G 0.512 4.619 +- 4.045
161 P 0.512 4.620 +- 4.045
162 G 0.512 4.620 +- 4.045
163 G 0.513 4.628 +- 4.046
164 F 0.513 4.624 +- 4.046
165 F 0.512 4.621 +- 4.045
166 D 0.512 4.622 +- 4.045
167 E 0.512 4.617 +- 4.045
168 H 0.513 4.624 +- 4.046
169 A 0.513 4.627 +- 4.046
170 I 0.512 4.621 +- 4.045
171 V 0.512 4.618 +- 4.045
172 I 0.512 4.621 +- 4.045
173 L 0.512 4.621 +- 4.045
174 Q 0.513 4.627 +- 4.046
175 C 0.513 4.623 +- 4.046
176 A 0.512 4.618 +- 4.045
177 R 0.513 4.622 +- 4.045
178 A 0.512 4.618 +- 4.045
179 L 0.512 4.622 +- 4.045
180 S 0.513 4.622 +- 4.045
181 E 0.512 4.617 +- 4.045
182 Y 0.513 4.624 +- 4.046
183 G 0.513 4.625 +- 4.046
184 V 0.513 4.624 +- 4.046
185 E 0.512 4.617 +- 4.045
186 P 0.512 4.620 +- 4.045
187 R 0.513 4.622 +- 4.045
188 H 0.513 4.624 +- 4.046
189 L 0.512 4.622 +- 4.045
190 R 0.513 4.629 +- 4.046
191 A 0.512 4.620 +- 4.045
192 F 0.512 4.621 +- 4.045
193 R 0.513 4.622 +- 4.045
194 S 0.513 4.629 +- 4.046
195 A 0.512 4.618 +- 4.045
196 A 0.513 4.624 +- 4.046
197 D 0.512 4.618 +- 4.045
198 R 0.513 4.623 +- 4.045
199 Q 0.512 4.621 +- 4.045
200 S 0.513 4.622 +- 4.045
201 D 0.512 4.618 +- 4.045
202 L 0.512 4.622 +- 4.045
203 I 0.512 4.621 +- 4.045
204 V 0.978* 8.201 +- 2.251
205 Q 0.513 4.627 +- 4.046
206 I 0.512 4.621 +- 4.045
207 A 0.512 4.620 +- 4.045
208 G 0.512 4.619 +- 4.045
209 P 0.512 4.620 +- 4.045
210 I 0.512 4.621 +- 4.045
211 V 0.512 4.620 +- 4.045
212 K 0.513 4.628 +- 4.046
213 A 0.512 4.620 +- 4.045
214 G 0.513 4.625 +- 4.046
215 K 0.513 4.623 +- 4.046
216 A 0.512 4.620 +- 4.045
217 G 0.513 4.625 +- 4.046
218 A 0.512 4.620 +- 4.045
219 R 0.513 4.626 +- 4.046
220 D 0.512 4.618 +- 4.045
221 R 0.513 4.623 +- 4.045
222 A 0.512 4.620 +- 4.045
223 D 0.512 4.618 +- 4.045
224 D 0.512 4.618 +- 4.045
225 L 0.513 4.623 +- 4.046
226 A 0.512 4.618 +- 4.045
227 R 0.513 4.626 +- 4.046
228 E 0.512 4.617 +- 4.045
229 V 0.513 4.624 +- 4.046
230 A 0.513 4.624 +- 4.046
231 A 0.512 4.618 +- 4.045
232 L 0.512 4.621 +- 4.045
233 A 0.512 4.620 +- 4.045
234 I 0.512 4.621 +- 4.045
235 T 0.513 4.626 +- 4.046
236 L 0.513 4.623 +- 4.046
237 H 0.512 4.621 +- 4.045
238 T 0.513 4.626 +- 4.046
239 S 0.513 4.622 +- 4.045
240 L 0.513 4.623 +- 4.046
241 I 0.512 4.621 +- 4.045
242 K 0.513 4.628 +- 4.046
243 S 0.513 4.626 +- 4.046
244 A 0.512 4.618 +- 4.045
245 V 0.513 4.624 +- 4.046
246 R 0.513 4.623 +- 4.045
247 G 0.512 4.620 +- 4.045
248 V 0.513 4.624 +- 4.046
249 L 0.513 4.628 +- 4.046
250 H 0.512 4.621 +- 4.045
251 R 0.513 4.623 +- 4.045
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
w2: 0.004 0.011 0.023 0.042 0.066 0.095 0.129 0.167 0.209 0.253
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.001
0.003 0.002 0.001
0.007 0.004 0.003 0.002 0.001
0.010 0.008 0.007 0.004 0.003 0.001 0.001
0.014 0.011 0.010 0.008 0.006 0.004 0.003 0.001 0.001
0.017 0.015 0.014 0.011 0.010 0.008 0.006 0.004 0.003 0.001 0.001
0.020 0.018 0.017 0.015 0.014 0.011 0.010 0.007 0.006 0.004 0.003 0.001 0.001
0.023 0.021 0.020 0.018 0.017 0.015 0.014 0.011 0.010 0.007 0.006 0.004 0.003 0.001 0.001
0.026 0.024 0.023 0.021 0.020 0.018 0.017 0.015 0.013 0.011 0.010 0.007 0.006 0.004 0.003 0.001 0.001
0.028 0.026 0.026 0.024 0.023 0.021 0.020 0.018 0.017 0.015 0.013 0.011 0.010 0.007 0.006 0.004 0.003 0.001 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 3
lnL(ntime: 6 np: 12): -1017.434933 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004010 0.004010 0.004010 0.000004 1.201649 1.000000 0.000000 498.889126 951.559537 951.620535
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.012042
(1: 0.000004, 2: 0.000004, 3: 0.004010, 4: 0.004010, 5: 0.004010, 6: 0.000004);
(NC_011896_1_WP_010908704_1_2210_MLBR_RS10465: 0.000004, NC_002677_1_NP_302384_1_1256_ML2075: 0.000004, NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780: 0.004010, NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175: 0.004010, NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355: 0.004010, NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.20165
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 498.88913 951.55954 951.62054
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 537.9 215.1 498.8891 0.0000 0.0000 0.0 0.0
7..2 0.000 537.9 215.1 498.8891 0.0000 0.0000 0.0 0.0
7..3 0.004 537.9 215.1 498.8891 0.0019 0.0000 1.0 0.0
7..4 0.004 537.9 215.1 498.8891 0.0019 0.0000 1.0 0.0
7..5 0.004 537.9 215.1 498.8891 0.0019 0.0000 1.0 0.0
7..6 0.000 537.9 215.1 498.8891 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
1 V 1.000** 498.889
2 S 1.000** 498.889
3 A 1.000** 498.889
4 P 1.000** 498.889
5 D 1.000** 498.889
6 S 1.000** 498.889
7 P 1.000** 498.889
8 A 1.000** 498.889
9 L 1.000** 498.889
10 V 1.000** 498.889
11 G 1.000** 498.889
12 M 1.000** 498.889
13 S 1.000** 498.889
14 I 1.000** 498.889
15 G 1.000** 498.889
16 A 1.000** 498.889
17 V 1.000** 498.889
18 L 1.000** 498.889
19 D 1.000** 498.889
20 L 1.000** 498.889
21 L 1.000** 498.889
22 R 1.000** 498.889
23 S 1.000** 498.889
24 D 1.000** 498.889
25 F 1.000** 498.889
26 P 1.000** 498.889
27 D 1.000** 498.889
28 V 1.000** 498.889
29 T 1.000** 498.889
30 I 1.000** 498.889
31 S 1.000** 498.889
32 K 1.000** 498.889
33 I 1.000** 498.889
34 R 1.000** 498.889
35 F 1.000** 498.889
36 L 1.000** 498.889
37 E 1.000** 498.889
38 A 1.000** 498.889
39 E 1.000** 498.889
40 G 1.000** 498.889
41 L 1.000** 498.889
42 V 1.000** 498.889
43 T 1.000** 498.889
44 P 1.000** 498.889
45 Q 1.000** 498.889
46 R 1.000** 498.889
47 S 1.000** 498.889
48 A 1.000** 498.889
49 S 1.000** 498.889
50 G 1.000** 498.889
51 Y 1.000** 498.889
52 R 1.000** 498.889
53 R 1.000** 498.889
54 F 1.000** 498.889
55 T 1.000** 498.889
56 A 1.000** 498.889
57 Y 1.000** 498.889
58 D 1.000** 498.889
59 C 1.000** 498.889
60 A 1.000** 498.889
61 R 1.000** 498.889
62 L 1.000** 498.889
63 R 1.000** 498.889
64 F 1.000** 498.889
65 I 1.000** 498.889
66 L 1.000** 498.889
67 T 1.000** 498.889
68 A 1.000** 498.889
69 Q 1.000** 498.889
70 R 1.000** 498.889
71 D 1.000** 498.889
72 H 1.000** 498.889
73 Y 1.000** 498.889
74 L 1.000** 498.889
75 P 1.000** 498.889
76 L 1.000** 498.889
77 K 1.000** 498.889
78 V 1.000** 498.889
79 I 1.000** 498.889
80 R 1.000** 498.889
81 A 1.000** 498.889
82 Q 1.000** 498.889
83 L 1.000** 498.889
84 D 1.000** 498.889
85 A 1.000** 498.889
86 Q 1.000** 498.889
87 P 1.000** 498.889
88 D 1.000** 498.889
89 G 1.000** 498.889
90 E 1.000** 498.889
91 L 1.000** 498.889
92 P 1.000** 498.889
93 S 1.000** 498.889
94 F 1.000** 498.889
95 G 1.000** 498.889
96 S 1.000** 498.889
97 P 1.000** 498.889
98 Y 1.000** 498.889
99 V 1.000** 498.889
100 A 1.000** 498.889
101 P 1.000** 498.889
102 R 1.000** 498.889
103 L 1.000** 498.889
104 F 1.000** 498.889
105 S 1.000** 498.889
106 V 1.000** 498.889
107 T 1.000** 498.889
108 G 1.000** 498.889
109 G 1.000** 498.889
110 P 1.000** 498.889
111 G 1.000** 498.889
112 A 1.000** 498.889
113 G 1.000** 498.889
114 V 1.000** 498.889
115 G 1.000** 498.889
116 S 1.000** 498.889
117 G 1.000** 498.889
118 V 1.000** 498.889
119 G 1.000** 498.889
120 S 1.000** 498.889
121 D 1.000** 498.889
122 I 1.000** 498.889
123 P 1.000** 498.889
124 A 1.000** 498.889
125 V 1.000** 498.889
126 S 1.000** 498.889
127 P 1.000** 498.889
128 A 1.000** 498.889
129 G 1.000** 498.889
130 V 1.000** 498.889
131 R 1.000** 498.889
132 L 1.000** 498.889
133 S 1.000** 498.889
134 R 1.000** 498.889
135 E 1.000** 498.889
136 D 1.000** 498.889
137 L 1.000** 498.889
138 L 1.000** 498.889
139 D 1.000** 498.889
140 R 1.000** 498.889
141 S 1.000** 498.889
142 G 1.000** 498.889
143 V 1.000** 498.889
144 A 1.000** 498.889
145 D 1.000** 498.889
146 D 1.000** 498.889
147 L 1.000** 498.889
148 L 1.000** 498.889
149 T 1.000** 498.889
150 A 1.000** 498.889
151 L 1.000** 498.889
152 L 1.000** 498.889
153 K 1.000** 498.889
154 A 1.000** 498.889
155 G 1.000** 498.889
156 V 1.000** 498.889
157 I 1.000** 498.889
158 T 1.000** 498.889
159 T 1.000** 498.889
160 G 1.000** 498.889
161 P 1.000** 498.889
162 G 1.000** 498.889
163 G 1.000** 498.889
164 F 1.000** 498.889
165 F 1.000** 498.889
166 D 1.000** 498.889
167 E 1.000** 498.889
168 H 1.000** 498.889
169 A 1.000** 498.889
170 I 1.000** 498.889
171 V 1.000** 498.889
172 I 1.000** 498.889
173 L 1.000** 498.889
174 Q 1.000** 498.889
175 C 1.000** 498.889
176 A 1.000** 498.889
177 R 1.000** 498.889
178 A 1.000** 498.889
179 L 1.000** 498.889
180 S 1.000** 498.889
181 E 1.000** 498.889
182 Y 1.000** 498.889
183 G 1.000** 498.889
184 V 1.000** 498.889
185 E 1.000** 498.889
186 P 1.000** 498.889
187 R 1.000** 498.889
188 H 1.000** 498.889
189 L 1.000** 498.889
190 R 1.000** 498.889
191 A 1.000** 498.889
192 F 1.000** 498.889
193 R 1.000** 498.889
194 S 1.000** 498.889
195 A 1.000** 498.889
196 A 1.000** 498.889
197 D 1.000** 498.889
198 R 1.000** 498.889
199 Q 1.000** 498.889
200 S 1.000** 498.889
201 D 1.000** 498.889
202 L 1.000** 498.889
203 I 1.000** 498.889
204 V 1.000** 498.889
205 Q 1.000** 498.889
206 I 1.000** 498.889
207 A 1.000** 498.889
208 G 1.000** 498.889
209 P 1.000** 498.889
210 I 1.000** 498.889
211 V 1.000** 498.889
212 K 1.000** 498.889
213 A 1.000** 498.889
214 G 1.000** 498.889
215 K 1.000** 498.889
216 A 1.000** 498.889
217 G 1.000** 498.889
218 A 1.000** 498.889
219 R 1.000** 498.889
220 D 1.000** 498.889
221 R 1.000** 498.889
222 A 1.000** 498.889
223 D 1.000** 498.889
224 D 1.000** 498.889
225 L 1.000** 498.889
226 A 1.000** 498.889
227 R 1.000** 498.889
228 E 1.000** 498.889
229 V 1.000** 498.889
230 A 1.000** 498.889
231 A 1.000** 498.889
232 L 1.000** 498.889
233 A 1.000** 498.889
234 I 1.000** 498.889
235 T 1.000** 498.889
236 L 1.000** 498.889
237 H 1.000** 498.889
238 T 1.000** 498.889
239 S 1.000** 498.889
240 L 1.000** 498.889
241 I 1.000** 498.889
242 K 1.000** 498.889
243 S 1.000** 498.889
244 A 1.000** 498.889
245 V 1.000** 498.889
246 R 1.000** 498.889
247 G 1.000** 498.889
248 V 1.000** 498.889
249 L 1.000** 498.889
250 H 1.000** 498.889
251 R 1.000** 498.889
Note: more than one w>1. Check rst for details
Time used: 0:11
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 3
lnL(ntime: 6 np: 9): -1018.410002 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004031 0.004031 0.004031 0.000004 1.057126 0.047781 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.012104
(1: 0.000004, 2: 0.000004, 3: 0.004031, 4: 0.004031, 5: 0.004031, 6: 0.000004);
(NC_011896_1_WP_010908704_1_2210_MLBR_RS10465: 0.000004, NC_002677_1_NP_302384_1_1256_ML2075: 0.000004, NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780: 0.004031, NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175: 0.004031, NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355: 0.004031, NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.05713
Parameters in M7 (beta):
p = 0.04778 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 539.2 213.8 0.9000 0.0000 0.0000 0.0 0.0
7..2 0.000 539.2 213.8 0.9000 0.0000 0.0000 0.0 0.0
7..3 0.004 539.2 213.8 0.9000 0.0013 0.0014 0.7 0.3
7..4 0.004 539.2 213.8 0.9000 0.0013 0.0014 0.7 0.3
7..5 0.004 539.2 213.8 0.9000 0.0013 0.0014 0.7 0.3
7..6 0.000 539.2 213.8 0.9000 0.0000 0.0000 0.0 0.0
Time used: 0:33
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 3
check convergence..
lnL(ntime: 6 np: 11): -1017.251345 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.004426 0.004426 0.000004 0.000004 0.011318 0.004426 0.783879 0.995564 99.000000 8.609098 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.024604
(1: 0.004426, 2: 0.004426, 3: 0.000004, 4: 0.000004, 5: 0.011318, 6: 0.004426);
(NC_011896_1_WP_010908704_1_2210_MLBR_RS10465: 0.004426, NC_002677_1_NP_302384_1_1256_ML2075: 0.004426, NZ_LVXE01000003_1_WP_064430289_1_1202_A3216_RS01780: 0.000004, NZ_LYPH01000033_1_WP_064430289_1_1284_A8144_RS06175: 0.000004, NZ_CP029543_1_WP_111481066_1_2232_DIJ64_RS11355: 0.011318, NZ_AP014567_1_WP_010908704_1_2295_JK2ML_RS11670: 0.004426);
Detailed output identifying parameters
kappa (ts/tv) = 0.78388
Parameters in M8 (beta&w>1):
p0 = 0.99556 p = 99.00000 q = 8.60910
(p1 = 0.00444) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09956 0.09956 0.09956 0.09956 0.09956 0.09956 0.09956 0.09956 0.09956 0.09956 0.00444
w: 0.87316 0.89308 0.90403 0.91228 0.91932 0.92579 0.93213 0.93877 0.94648 0.95796 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.004 542.0 211.0 5.3477 0.0019 0.0004 1.0 0.1
7..2 0.004 542.0 211.0 5.3477 0.0019 0.0004 1.0 0.1
7..3 0.000 542.0 211.0 5.3477 0.0000 0.0000 0.0 0.0
7..4 0.000 542.0 211.0 5.3477 0.0000 0.0000 0.0 0.0
7..5 0.011 542.0 211.0 5.3477 0.0049 0.0009 2.6 0.2
7..6 0.004 542.0 211.0 5.3477 0.0019 0.0004 1.0 0.1
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
204 V 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
40 G 0.841 7.040 +- 3.335
204 V 0.998** 8.251 +- 2.063
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.017 0.024 0.035 0.053 0.080 0.118 0.168 0.212 0.207 0.087
p : 0.112 0.107 0.104 0.101 0.099 0.098 0.096 0.095 0.094 0.094
q : 0.088 0.093 0.096 0.099 0.101 0.102 0.104 0.105 0.106 0.106
ws: 0.003 0.011 0.026 0.046 0.071 0.099 0.130 0.165 0.204 0.246
Time used: 0:50
Model 1: NearlyNeutral -1018.404368
Model 2: PositiveSelection -1014.075929
Model 0: one-ratio -1017.43375
Model 3: discrete -1017.434933
Model 7: beta -1018.410002
Model 8: beta&w>1 -1017.251345
Model 0 vs 1 1.9412359999998898
Model 2 vs 1 8.656878000000006
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
40 G 1.000** 999.000
204 V 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908704_1_2210_MLBR_RS10465)
Pr(w>1) post mean +- SE for w
1 V 0.512 4.618 +- 4.045
2 S 0.513 4.626 +- 4.046
3 A 0.512 4.618 +- 4.045
4 P 0.512 4.621 +- 4.045
5 D 0.512 4.622 +- 4.045
6 S 0.513 4.623 +- 4.046
7 P 0.512 4.620 +- 4.045
8 A 0.513 4.627 +- 4.046
9 L 0.512 4.622 +- 4.045
10 V 0.512 4.620 +- 4.045
11 G 0.512 4.619 +- 4.045
12 M 0.512 4.619 +- 4.045
13 S 0.513 4.622 +- 4.045
14 I 0.513 4.625 +- 4.046
15 G 0.512 4.619 +- 4.045
16 A 0.512 4.618 +- 4.045
17 V 0.512 4.620 +- 4.045
18 L 0.513 4.623 +- 4.046
19 D 0.512 4.622 +- 4.045
20 L 0.512 4.622 +- 4.045
21 L 0.512 4.622 +- 4.045
22 R 0.513 4.623 +- 4.046
23 S 0.513 4.622 +- 4.045
24 D 0.512 4.622 +- 4.045
25 F 0.513 4.624 +- 4.046
26 P 0.513 4.625 +- 4.046
27 D 0.512 4.622 +- 4.045
28 V 0.512 4.618 +- 4.045
29 T 0.513 4.628 +- 4.046
30 I 0.512 4.621 +- 4.045
31 S 0.513 4.622 +- 4.045
32 K 0.513 4.623 +- 4.046
33 I 0.513 4.625 +- 4.046
34 R 0.513 4.626 +- 4.046
35 F 0.512 4.621 +- 4.045
36 L 0.512 4.622 +- 4.045
37 E 0.512 4.617 +- 4.045
38 A 0.513 4.624 +- 4.046
39 E 0.512 4.617 +- 4.045
40 G 0.882 7.510 +- 3.050
41 L 0.512 4.621 +- 4.045
42 V 0.512 4.618 +- 4.045
43 T 0.513 4.622 +- 4.045
44 P 0.513 4.625 +- 4.046
45 Q 0.512 4.621 +- 4.045
46 R 0.513 4.626 +- 4.046
47 S 0.513 4.626 +- 4.046
48 A 0.513 4.627 +- 4.046
49 S 0.513 4.622 +- 4.045
50 G 0.512 4.619 +- 4.045
51 Y 0.513 4.624 +- 4.046
52 R 0.513 4.622 +- 4.045
53 R 0.513 4.622 +- 4.045
54 F 0.512 4.621 +- 4.045
55 T 0.513 4.622 +- 4.045
56 A 0.512 4.618 +- 4.045
57 Y 0.513 4.627 +- 4.046
58 D 0.512 4.622 +- 4.045
59 C 0.513 4.626 +- 4.046
60 A 0.513 4.627 +- 4.046
61 R 0.513 4.622 +- 4.045
62 L 0.512 4.622 +- 4.045
63 R 0.513 4.622 +- 4.045
64 F 0.512 4.621 +- 4.045
65 I 0.512 4.621 +- 4.045
66 L 0.513 4.628 +- 4.046
67 T 0.513 4.626 +- 4.046
68 A 0.513 4.627 +- 4.046
69 Q 0.512 4.621 +- 4.045
70 R 0.513 4.623 +- 4.045
71 D 0.512 4.622 +- 4.045
72 H 0.512 4.621 +- 4.045
73 Y 0.513 4.627 +- 4.046
74 L 0.513 4.628 +- 4.046
75 P 0.512 4.620 +- 4.045
76 L 0.512 4.622 +- 4.045
77 K 0.513 4.623 +- 4.046
78 V 0.513 4.624 +- 4.046
79 I 0.513 4.625 +- 4.046
80 R 0.513 4.623 +- 4.046
81 A 0.512 4.618 +- 4.045
82 Q 0.512 4.621 +- 4.045
83 L 0.512 4.622 +- 4.045
84 D 0.512 4.618 +- 4.045
85 A 0.512 4.620 +- 4.045
86 Q 0.512 4.621 +- 4.045
87 P 0.513 4.625 +- 4.046
88 D 0.512 4.622 +- 4.045
89 G 0.513 4.625 +- 4.046
90 E 0.512 4.617 +- 4.045
91 L 0.513 4.628 +- 4.046
92 P 0.513 4.628 +- 4.046
93 S 0.513 4.629 +- 4.046
94 F 0.512 4.621 +- 4.045
95 G 0.512 4.619 +- 4.045
96 S 0.513 4.622 +- 4.045
97 P 0.513 4.625 +- 4.046
98 Y 0.513 4.627 +- 4.046
99 V 0.512 4.620 +- 4.045
100 A 0.513 4.627 +- 4.046
101 P 0.512 4.621 +- 4.045
102 R 0.513 4.629 +- 4.046
103 L 0.513 4.623 +- 4.046
104 F 0.513 4.624 +- 4.046
105 S 0.513 4.622 +- 4.045
106 V 0.512 4.618 +- 4.045
107 T 0.512 4.621 +- 4.045
108 G 0.512 4.620 +- 4.045
109 G 0.512 4.620 +- 4.045
110 P 0.512 4.620 +- 4.045
111 G 0.513 4.625 +- 4.046
112 A 0.512 4.620 +- 4.045
113 G 0.513 4.625 +- 4.046
114 V 0.512 4.620 +- 4.045
115 G 0.513 4.628 +- 4.046
116 S 0.513 4.622 +- 4.045
117 G 0.512 4.619 +- 4.045
118 V 0.512 4.620 +- 4.045
119 G 0.513 4.628 +- 4.046
120 S 0.513 4.622 +- 4.045
121 D 0.512 4.618 +- 4.045
122 I 0.512 4.621 +- 4.045
123 P 0.512 4.620 +- 4.045
124 A 0.512 4.618 +- 4.045
125 V 0.513 4.627 +- 4.046
126 S 0.513 4.622 +- 4.045
127 P 0.512 4.621 +- 4.045
128 A 0.512 4.620 +- 4.045
129 G 0.512 4.620 +- 4.045
130 V 0.512 4.620 +- 4.045
131 R 0.513 4.622 +- 4.045
132 L 0.512 4.622 +- 4.045
133 S 0.513 4.626 +- 4.046
134 R 0.513 4.629 +- 4.046
135 E 0.513 4.625 +- 4.046
136 D 0.512 4.618 +- 4.045
137 L 0.512 4.621 +- 4.045
138 L 0.513 4.623 +- 4.046
139 D 0.512 4.618 +- 4.045
140 R 0.513 4.623 +- 4.045
141 S 0.513 4.629 +- 4.046
142 G 0.513 4.628 +- 4.046
143 V 0.512 4.618 +- 4.045
144 A 0.513 4.627 +- 4.046
145 D 0.512 4.618 +- 4.045
146 D 0.512 4.618 +- 4.045
147 L 0.513 4.623 +- 4.046
148 L 0.513 4.623 +- 4.046
149 T 0.512 4.621 +- 4.045
150 A 0.512 4.618 +- 4.045
151 L 0.512 4.622 +- 4.045
152 L 0.512 4.621 +- 4.045
153 K 0.513 4.623 +- 4.046
154 A 0.512 4.620 +- 4.045
155 G 0.513 4.625 +- 4.046
156 V 0.512 4.618 +- 4.045
157 I 0.513 4.625 +- 4.046
158 T 0.513 4.622 +- 4.045
159 T 0.513 4.622 +- 4.045
160 G 0.512 4.619 +- 4.045
161 P 0.512 4.620 +- 4.045
162 G 0.512 4.620 +- 4.045
163 G 0.513 4.628 +- 4.046
164 F 0.513 4.624 +- 4.046
165 F 0.512 4.621 +- 4.045
166 D 0.512 4.622 +- 4.045
167 E 0.512 4.617 +- 4.045
168 H 0.513 4.624 +- 4.046
169 A 0.513 4.627 +- 4.046
170 I 0.512 4.621 +- 4.045
171 V 0.512 4.618 +- 4.045
172 I 0.512 4.621 +- 4.045
173 L 0.512 4.621 +- 4.045
174 Q 0.513 4.627 +- 4.046
175 C 0.513 4.623 +- 4.046
176 A 0.512 4.618 +- 4.045
177 R 0.513 4.622 +- 4.045
178 A 0.512 4.618 +- 4.045
179 L 0.512 4.622 +- 4.045
180 S 0.513 4.622 +- 4.045
181 E 0.512 4.617 +- 4.045
182 Y 0.513 4.624 +- 4.046
183 G 0.513 4.625 +- 4.046
184 V 0.513 4.624 +- 4.046
185 E 0.512 4.617 +- 4.045
186 P 0.512 4.620 +- 4.045
187 R 0.513 4.622 +- 4.045
188 H 0.513 4.624 +- 4.046
189 L 0.512 4.622 +- 4.045
190 R 0.513 4.629 +- 4.046
191 A 0.512 4.620 +- 4.045
192 F 0.512 4.621 +- 4.045
193 R 0.513 4.622 +- 4.045
194 S 0.513 4.629 +- 4.046
195 A 0.512 4.618 +- 4.045
196 A 0.513 4.624 +- 4.046
197 D 0.512 4.618 +- 4.045
198 R 0.513 4.623 +- 4.045
199 Q 0.512 4.621 +- 4.045
200 S 0.513 4.622 +- 4.045
201 D 0.512 4.618 +- 4.045
202 L 0.512 4.622 +- 4.045
203 I 0.512 4.621 +- 4.045
204 V 0.978* 8.201 +- 2.251
205 Q 0.513 4.627 +- 4.046
206 I 0.512 4.621 +- 4.045
207 A 0.512 4.620 +- 4.045
208 G 0.512 4.619 +- 4.045
209 P 0.512 4.620 +- 4.045
210 I 0.512 4.621 +- 4.045
211 V 0.512 4.620 +- 4.045
212 K 0.513 4.628 +- 4.046
213 A 0.512 4.620 +- 4.045
214 G 0.513 4.625 +- 4.046
215 K 0.513 4.623 +- 4.046
216 A 0.512 4.620 +- 4.045
217 G 0.513 4.625 +- 4.046
218 A 0.512 4.620 +- 4.045
219 R 0.513 4.626 +- 4.046
220 D 0.512 4.618 +- 4.045
221 R 0.513 4.623 +- 4.045
222 A 0.512 4.620 +- 4.045
223 D 0.512 4.618 +- 4.045
224 D 0.512 4.618 +- 4.045
225 L 0.513 4.623 +- 4.046
226 A 0.512 4.618 +- 4.045
227 R 0.513 4.626 +- 4.046
228 E 0.512 4.617 +- 4.045
229 V 0.513 4.624 +- 4.046
230 A 0.513 4.624 +- 4.046
231 A 0.512 4.618 +- 4.045
232 L 0.512 4.621 +- 4.045
233 A 0.512 4.620 +- 4.045
234 I 0.512 4.621 +- 4.045
235 T 0.513 4.626 +- 4.046
236 L 0.513 4.623 +- 4.046
237 H 0.512 4.621 +- 4.045
238 T 0.513 4.626 +- 4.046
239 S 0.513 4.622 +- 4.045
240 L 0.513 4.623 +- 4.046
241 I 0.512 4.621 +- 4.045
242 K 0.513 4.628 +- 4.046
243 S 0.513 4.626 +- 4.046
244 A 0.512 4.618 +- 4.045
245 V 0.513 4.624 +- 4.046
246 R 0.513 4.623 +- 4.045
247 G 0.512 4.620 +- 4.045
248 V 0.513 4.624 +- 4.046
249 L 0.513 4.628 +- 4.046
250 H 0.512 4.621 +- 4.045
251 R 0.513 4.623 +- 4.045
Model 8 vs 7 2.3173139999998966
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
