--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:01:56 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2158/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -538.16 -540.90
2 -538.17 -541.46
--------------------------------------
TOTAL -538.17 -541.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893935 0.095081 0.331705 1.467940 0.860207 751.00 751.00 1.000
r(A<->C){all} 0.160759 0.018709 0.000119 0.432348 0.120785 71.85 98.54 1.003
r(A<->G){all} 0.169853 0.019723 0.000064 0.432678 0.135733 161.18 214.39 1.019
r(A<->T){all} 0.150896 0.018328 0.000124 0.420930 0.106545 33.27 37.20 0.999
r(C<->G){all} 0.163618 0.020111 0.000176 0.450734 0.124190 44.58 73.22 0.999
r(C<->T){all} 0.165516 0.019754 0.000082 0.450066 0.129666 94.57 127.72 1.005
r(G<->T){all} 0.189358 0.020488 0.000677 0.470551 0.164683 59.46 72.65 1.009
pi(A){all} 0.218545 0.000417 0.181468 0.261247 0.218279 687.01 719.01 0.999
pi(C){all} 0.272755 0.000507 0.232903 0.321633 0.272868 721.50 736.25 1.000
pi(G){all} 0.297283 0.000510 0.254960 0.340267 0.297225 619.37 641.37 0.999
pi(T){all} 0.211417 0.000388 0.175473 0.251312 0.210857 751.00 751.00 1.000
alpha{1,2} 0.413045 0.223420 0.000428 1.456631 0.228278 437.91 510.21 1.001
alpha{3} 0.431150 0.236407 0.000526 1.425635 0.269571 567.56 593.42 0.999
pinvar{all} 0.995526 0.000030 0.985626 0.999996 0.997351 416.11 537.91 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -522.996138
Model 2: PositiveSelection -522.996154
Model 0: one-ratio -522.996185
Model 3: discrete -522.996174
Model 7: beta -522.996031
Model 8: beta&w>1 -522.996055
Model 0 vs 1 9.399999999004649E-5
Model 2 vs 1 3.200000014658144E-5
Model 8 vs 7 4.799999987881165E-5
>C1
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C2
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C3
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C4
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C5
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C6
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
C1 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C2 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C3 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C4 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C5 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C6 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
**************************************************
C1 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C2 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C3 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C4 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C5 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C6 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
**************************************************
C1 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C2 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C3 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C4 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C5 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C6 CRTSVPAPEVIQMDETVLCADGEQEKLASW
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3900]--->[3900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.462 Mb, Max= 30.660 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C2 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C3 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C4 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C5 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
C6 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
**************************************************
C1 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C2 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C3 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C4 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C5 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
C6 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
**************************************************
C1 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C2 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C3 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C4 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C5 CRTSVPAPEVIQMDETVLCADGEQEKLASW
C6 CRTSVPAPEVIQMDETVLCADGEQEKLASW
******************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
C2 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
C3 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
C4 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
C5 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
C6 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
**************************************************
C1 CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
C2 CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
C3 CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
C4 CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
C5 CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
C6 CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
**************************************************
C1 GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
C2 GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
C3 GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
C4 GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
C5 GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
C6 GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
**************************************************
C1 GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
C2 GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
C3 GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
C4 GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
C5 GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
C6 GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
**************************************************
C1 CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
C2 CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
C3 CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
C4 CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
C5 CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
C6 CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
**************************************************
C1 TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
C2 TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
C3 TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
C4 TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
C5 TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
C6 TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
**************************************************
C1 TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
C2 TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
C3 TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
C4 TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
C5 TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
C6 TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
**************************************************
C1 CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
C2 CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
C3 CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
C4 CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
C5 CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
C6 CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
****************************************
>C1
ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>C2
ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>C3
ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>C4
ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>C5
ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>C6
ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG
CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG
GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC
GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC
CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG
TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT
TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT
CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>C1
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C2
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C3
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C4
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C5
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
>C6
MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
CRTSVPAPEVIQMDETVLCADGEQEKLASW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 390 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856451
Setting output file names to "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 948280401
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5166904393
Seed = 358619291
Swapseed = 1579856451
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -872.838697 -- -24.965149
Chain 2 -- -872.838697 -- -24.965149
Chain 3 -- -872.838564 -- -24.965149
Chain 4 -- -872.838697 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -872.838697 -- -24.965149
Chain 2 -- -872.838697 -- -24.965149
Chain 3 -- -872.838697 -- -24.965149
Chain 4 -- -872.838697 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-872.839] (-872.839) (-872.839) (-872.839) * [-872.839] (-872.839) (-872.839) (-872.839)
500 -- [-546.182] (-556.028) (-553.204) (-550.493) * (-552.641) (-548.475) (-544.030) [-542.756] -- 0:00:00
1000 -- [-545.266] (-552.603) (-552.566) (-549.378) * (-549.473) (-556.677) [-547.479] (-546.593) -- 0:00:00
1500 -- (-551.950) [-549.261] (-547.919) (-548.745) * (-549.792) [-550.968] (-547.609) (-550.557) -- 0:00:00
2000 -- [-547.878] (-555.123) (-554.433) (-547.770) * (-543.579) (-549.904) [-546.924] (-554.066) -- 0:04:09
2500 -- (-549.929) [-541.961] (-560.109) (-550.026) * [-545.351] (-561.117) (-549.442) (-560.714) -- 0:03:19
3000 -- (-549.312) [-544.233] (-549.091) (-549.910) * (-547.425) [-551.674] (-546.398) (-546.723) -- 0:02:45
3500 -- (-546.944) [-544.526] (-557.277) (-546.248) * (-553.407) [-545.927] (-546.825) (-548.265) -- 0:02:21
4000 -- (-548.042) (-546.594) (-546.507) [-548.448] * (-559.563) (-548.342) [-553.292] (-552.891) -- 0:02:04
4500 -- [-550.461] (-543.243) (-544.268) (-551.003) * (-550.423) (-546.654) [-541.086] (-549.556) -- 0:01:50
5000 -- [-547.828] (-547.908) (-544.902) (-550.071) * (-551.381) (-540.729) [-544.010] (-545.926) -- 0:01:39
Average standard deviation of split frequencies: 0.135707
5500 -- (-550.151) (-542.521) [-547.773] (-549.375) * (-559.808) [-543.600] (-551.363) (-541.798) -- 0:01:29
6000 -- (-551.821) (-544.426) [-545.415] (-549.955) * (-539.341) (-552.985) (-551.341) [-546.972] -- 0:01:22
6500 -- (-552.064) [-549.973] (-554.094) (-549.684) * [-543.082] (-549.648) (-547.392) (-546.480) -- 0:01:15
7000 -- [-548.229] (-556.419) (-545.133) (-548.737) * (-542.310) (-553.087) [-544.793] (-561.215) -- 0:01:10
7500 -- (-543.113) [-547.797] (-546.109) (-552.716) * (-541.285) [-545.004] (-552.573) (-547.391) -- 0:01:05
8000 -- (-551.357) (-555.676) (-550.335) [-552.408] * (-538.732) (-544.182) (-549.016) [-542.844] -- 0:01:01
8500 -- (-553.449) (-547.706) (-551.173) [-544.730] * (-537.314) (-560.193) [-548.563] (-547.188) -- 0:00:57
9000 -- (-545.869) (-562.204) [-545.124] (-547.821) * (-537.657) (-548.756) [-545.103] (-548.776) -- 0:00:54
9500 -- (-550.510) (-561.453) [-552.441] (-552.247) * [-538.199] (-549.554) (-543.383) (-545.874) -- 0:00:51
10000 -- (-550.404) (-540.558) (-546.802) [-550.384] * (-540.786) [-546.403] (-549.549) (-549.702) -- 0:00:49
Average standard deviation of split frequencies: 0.072920
10500 -- (-549.135) [-538.964] (-546.152) (-546.314) * [-537.909] (-546.652) (-546.219) (-553.206) -- 0:00:46
11000 -- (-542.677) (-539.092) [-545.118] (-542.280) * [-539.002] (-547.269) (-547.973) (-545.541) -- 0:00:44
11500 -- (-542.261) (-538.365) [-543.911] (-541.921) * (-541.461) (-545.781) (-549.649) [-546.093] -- 0:00:42
12000 -- (-551.330) (-538.684) [-552.691] (-538.017) * [-540.632] (-542.273) (-545.829) (-554.301) -- 0:00:40
12500 -- [-546.034] (-538.224) (-547.909) (-537.952) * (-539.452) [-545.554] (-546.318) (-553.683) -- 0:00:39
13000 -- (-547.144) [-541.808] (-547.162) (-537.655) * (-540.344) (-549.957) (-544.166) [-546.837] -- 0:00:37
13500 -- (-549.434) (-538.880) [-549.597] (-540.153) * [-542.449] (-551.045) (-547.431) (-547.766) -- 0:00:36
14000 -- (-556.424) (-539.328) [-546.634] (-538.586) * (-539.068) (-552.021) [-542.205] (-550.681) -- 0:00:34
14500 -- (-547.764) [-542.357] (-550.203) (-542.253) * (-540.110) (-554.330) [-544.285] (-553.505) -- 0:00:33
15000 -- (-542.965) (-539.405) (-557.278) [-540.914] * (-539.647) [-547.540] (-554.448) (-545.439) -- 0:00:32
Average standard deviation of split frequencies: 0.058926
15500 -- (-546.842) (-541.960) (-553.142) [-537.681] * (-537.400) (-550.300) [-544.590] (-549.877) -- 0:00:31
16000 -- (-558.346) (-538.896) [-548.944] (-537.457) * (-540.244) (-543.908) [-548.734] (-544.709) -- 0:00:30
16500 -- [-547.848] (-538.233) (-540.161) (-537.589) * (-537.832) [-547.900] (-548.715) (-548.805) -- 0:00:29
17000 -- [-543.982] (-537.321) (-537.557) (-538.310) * (-538.851) (-550.291) [-545.174] (-559.426) -- 0:00:28
17500 -- [-543.158] (-537.423) (-538.982) (-539.350) * (-537.246) (-544.859) [-543.374] (-567.011) -- 0:00:27
18000 -- [-550.147] (-538.768) (-537.573) (-537.466) * [-538.687] (-555.065) (-546.881) (-551.219) -- 0:00:26
18500 -- (-549.865) [-537.699] (-542.521) (-537.053) * [-539.113] (-544.623) (-544.129) (-547.813) -- 0:00:26
19000 -- (-548.722) [-539.048] (-537.380) (-537.774) * (-539.182) (-546.018) (-546.155) [-537.468] -- 0:00:50
19500 -- (-554.365) [-538.555] (-538.847) (-538.416) * (-539.282) (-544.582) (-541.173) [-540.723] -- 0:00:49
20000 -- (-556.090) [-538.324] (-539.545) (-542.699) * [-538.206] (-549.039) (-551.196) (-541.277) -- 0:00:48
Average standard deviation of split frequencies: 0.063628
20500 -- (-555.279) [-538.937] (-540.040) (-542.386) * (-540.829) (-544.894) (-557.208) [-541.749] -- 0:00:46
21000 -- (-547.165) (-539.982) (-539.934) [-537.916] * [-540.200] (-544.868) (-548.187) (-544.090) -- 0:00:45
21500 -- (-563.970) [-541.323] (-538.691) (-537.787) * [-538.333] (-545.718) (-545.081) (-541.246) -- 0:00:44
22000 -- (-553.423) (-540.101) (-538.860) [-539.716] * (-537.359) [-549.220] (-549.866) (-543.612) -- 0:00:43
22500 -- [-543.554] (-538.233) (-538.669) (-539.020) * [-537.746] (-551.580) (-550.564) (-540.251) -- 0:00:42
23000 -- (-543.785) (-536.788) [-537.457] (-537.605) * (-536.756) (-560.437) [-545.819] (-540.254) -- 0:00:41
23500 -- (-550.905) (-538.231) [-538.307] (-539.806) * [-539.309] (-553.455) (-544.989) (-539.422) -- 0:00:40
24000 -- (-553.263) (-536.830) (-538.545) [-539.457] * (-537.206) (-549.831) (-550.651) [-538.809] -- 0:00:39
24500 -- (-555.705) [-538.152] (-539.240) (-539.176) * [-540.455] (-554.536) (-548.487) (-541.849) -- 0:00:38
25000 -- (-545.338) (-538.224) (-537.013) [-538.715] * (-539.220) [-550.727] (-540.947) (-542.440) -- 0:00:38
Average standard deviation of split frequencies: 0.055217
25500 -- (-548.773) (-538.464) [-540.491] (-540.176) * [-538.075] (-550.803) (-543.239) (-541.771) -- 0:00:37
26000 -- (-551.800) (-536.887) [-537.357] (-537.419) * (-539.329) (-546.944) [-539.258] (-540.477) -- 0:00:36
26500 -- (-555.097) (-543.610) (-537.352) [-538.897] * (-538.759) (-546.563) [-537.045] (-539.717) -- 0:00:35
27000 -- (-539.132) [-543.761] (-537.332) (-537.552) * (-539.882) (-559.910) [-539.974] (-539.149) -- 0:00:35
27500 -- [-538.587] (-541.915) (-537.582) (-537.456) * (-538.390) (-547.870) (-539.421) [-538.115] -- 0:00:34
28000 -- (-539.966) (-540.715) (-539.728) [-541.680] * (-538.013) (-549.483) (-537.234) [-537.556] -- 0:00:33
28500 -- (-536.851) (-537.818) (-539.805) [-538.522] * [-537.776] (-552.724) (-537.892) (-538.332) -- 0:00:33
29000 -- (-539.327) (-538.766) (-538.286) [-537.386] * (-539.656) (-552.979) [-537.345] (-539.901) -- 0:00:32
29500 -- (-539.343) (-543.617) (-540.642) [-537.934] * (-536.800) (-544.775) [-539.726] (-542.728) -- 0:00:31
30000 -- (-540.283) (-543.457) [-541.558] (-538.457) * [-537.672] (-554.368) (-537.933) (-539.671) -- 0:00:31
Average standard deviation of split frequencies: 0.039967
30500 -- [-537.074] (-543.438) (-538.996) (-538.092) * (-540.042) (-544.006) (-539.505) [-537.882] -- 0:00:30
31000 -- [-541.176] (-541.406) (-537.973) (-539.090) * (-540.764) [-546.850] (-542.793) (-539.751) -- 0:00:30
31500 -- (-545.972) [-538.332] (-540.008) (-537.917) * [-538.698] (-552.051) (-539.026) (-541.091) -- 0:00:29
32000 -- (-538.766) (-537.557) (-539.859) [-538.768] * (-537.747) (-550.561) [-539.541] (-540.471) -- 0:00:29
32500 -- (-538.475) (-539.595) [-538.355] (-541.351) * [-537.667] (-542.567) (-539.146) (-540.267) -- 0:00:28
33000 -- [-537.827] (-537.220) (-539.747) (-538.362) * (-539.966) (-549.780) [-540.325] (-539.031) -- 0:00:28
33500 -- (-537.436) [-537.500] (-542.661) (-541.223) * (-541.963) (-544.836) (-537.511) [-539.326] -- 0:00:27
34000 -- (-539.501) (-537.590) [-541.649] (-540.816) * [-542.716] (-548.460) (-539.671) (-540.875) -- 0:00:27
34500 -- [-537.423] (-539.266) (-544.226) (-537.983) * (-544.328) [-545.577] (-538.020) (-543.838) -- 0:00:26
35000 -- (-537.978) (-541.756) [-541.099] (-539.190) * (-540.971) (-551.147) (-539.615) [-543.991] -- 0:00:26
Average standard deviation of split frequencies: 0.047757
35500 -- [-537.267] (-542.667) (-538.724) (-538.025) * (-542.615) (-545.412) [-538.251] (-538.486) -- 0:00:39
36000 -- (-539.300) (-541.032) [-536.850] (-541.360) * (-539.158) [-548.609] (-538.037) (-537.940) -- 0:00:38
36500 -- (-539.194) [-539.569] (-539.110) (-539.945) * [-539.575] (-551.610) (-538.367) (-538.125) -- 0:00:38
37000 -- (-540.035) (-540.580) (-538.885) [-537.562] * (-539.625) [-542.886] (-538.223) (-536.621) -- 0:00:37
37500 -- [-538.365] (-538.873) (-539.095) (-538.670) * (-540.615) [-546.936] (-537.193) (-541.513) -- 0:00:37
38000 -- (-538.691) (-540.147) [-538.493] (-541.873) * (-539.258) [-551.065] (-543.967) (-542.161) -- 0:00:36
38500 -- (-537.916) (-539.372) (-536.963) [-539.006] * (-538.730) [-548.745] (-543.059) (-539.612) -- 0:00:35
39000 -- (-537.334) (-537.826) (-540.149) [-537.693] * [-541.977] (-544.542) (-539.594) (-537.491) -- 0:00:35
39500 -- [-539.622] (-538.547) (-539.194) (-536.970) * (-538.382) (-550.841) [-537.395] (-538.729) -- 0:00:34
40000 -- (-540.120) (-537.463) (-539.727) [-537.515] * (-537.556) (-545.226) (-537.824) [-542.048] -- 0:00:34
Average standard deviation of split frequencies: 0.043148
40500 -- (-538.537) [-537.991] (-539.977) (-536.931) * (-537.499) (-552.401) [-539.163] (-539.977) -- 0:00:34
41000 -- (-539.083) [-541.056] (-541.251) (-537.419) * (-539.696) (-550.373) [-540.792] (-537.705) -- 0:00:33
41500 -- (-539.676) (-537.449) (-537.541) [-540.389] * (-537.448) [-551.440] (-539.138) (-538.157) -- 0:00:33
42000 -- (-538.226) [-538.300] (-538.777) (-540.819) * (-536.488) (-542.581) (-539.522) [-538.941] -- 0:00:32
42500 -- [-538.414] (-537.591) (-539.448) (-540.377) * (-539.032) (-542.741) (-540.402) [-538.758] -- 0:00:32
43000 -- (-539.744) (-537.748) [-537.971] (-540.067) * (-537.403) (-549.085) [-537.237] (-540.203) -- 0:00:31
43500 -- [-538.461] (-537.693) (-537.521) (-538.260) * (-537.547) [-551.497] (-538.023) (-538.792) -- 0:00:31
44000 -- [-538.654] (-539.127) (-536.636) (-539.023) * (-539.069) [-547.422] (-539.931) (-538.945) -- 0:00:31
44500 -- (-539.144) (-544.439) [-536.609] (-539.057) * [-536.808] (-544.275) (-540.417) (-540.649) -- 0:00:30
45000 -- (-537.935) (-538.789) [-537.435] (-537.932) * (-536.817) [-549.223] (-537.266) (-538.268) -- 0:00:30
Average standard deviation of split frequencies: 0.038552
45500 -- [-540.024] (-540.360) (-541.304) (-538.241) * (-538.024) [-546.272] (-541.139) (-539.479) -- 0:00:29
46000 -- (-539.076) (-541.532) (-542.328) [-538.555] * (-539.671) (-545.401) (-540.636) [-538.370] -- 0:00:29
46500 -- (-539.354) (-542.810) [-537.392] (-537.649) * [-537.839] (-551.907) (-541.854) (-538.655) -- 0:00:29
47000 -- (-539.445) (-538.139) (-538.685) [-537.890] * (-538.084) (-545.496) (-539.462) [-537.275] -- 0:00:28
47500 -- (-538.452) (-539.653) (-542.258) [-537.221] * (-537.963) (-546.054) (-539.450) [-540.962] -- 0:00:28
48000 -- [-538.008] (-537.979) (-540.113) (-538.022) * [-537.910] (-544.177) (-537.043) (-538.704) -- 0:00:28
48500 -- [-537.054] (-537.665) (-537.506) (-541.833) * [-537.390] (-546.557) (-538.410) (-539.841) -- 0:00:27
49000 -- (-539.364) (-537.307) [-536.947] (-536.923) * [-537.617] (-549.272) (-537.413) (-536.737) -- 0:00:27
49500 -- (-538.542) [-537.386] (-538.044) (-540.361) * [-538.392] (-547.987) (-537.817) (-537.161) -- 0:00:27
50000 -- (-541.353) [-537.207] (-538.759) (-537.953) * (-537.153) (-545.474) [-538.292] (-539.371) -- 0:00:27
Average standard deviation of split frequencies: 0.033495
50500 -- (-539.524) [-537.013] (-539.102) (-540.357) * (-539.600) [-547.757] (-539.358) (-540.346) -- 0:00:26
51000 -- (-540.304) (-539.876) (-539.544) [-538.112] * (-538.168) (-546.229) (-538.784) [-539.305] -- 0:00:26
51500 -- (-539.917) (-540.357) (-541.505) [-538.613] * (-538.459) (-545.276) [-540.447] (-540.012) -- 0:00:26
52000 -- (-537.481) (-541.136) (-540.288) [-537.673] * (-538.304) (-546.975) (-538.616) [-537.800] -- 0:00:34
52500 -- [-540.951] (-537.852) (-539.135) (-538.531) * [-537.580] (-544.741) (-537.501) (-537.412) -- 0:00:34
53000 -- (-537.695) (-543.596) [-539.440] (-538.516) * (-537.911) [-551.804] (-538.643) (-538.405) -- 0:00:33
53500 -- (-539.653) (-542.756) (-538.634) [-539.004] * [-539.772] (-544.772) (-537.170) (-538.604) -- 0:00:33
54000 -- (-537.099) (-542.561) (-537.761) [-538.586] * (-538.397) (-552.598) (-543.387) [-538.542] -- 0:00:33
54500 -- (-538.192) (-538.862) [-537.232] (-540.043) * (-538.963) (-551.875) [-539.531] (-539.690) -- 0:00:32
55000 -- [-540.177] (-540.971) (-537.951) (-539.620) * [-539.359] (-550.442) (-542.469) (-546.203) -- 0:00:32
Average standard deviation of split frequencies: 0.030398
55500 -- (-538.405) (-539.372) (-537.774) [-537.556] * (-537.106) [-549.449] (-538.279) (-541.197) -- 0:00:32
56000 -- (-537.827) (-537.172) (-538.390) [-538.332] * (-539.370) [-547.245] (-536.897) (-542.494) -- 0:00:31
56500 -- [-539.037] (-538.910) (-537.604) (-538.159) * (-537.765) (-548.525) [-537.111] (-538.139) -- 0:00:31
57000 -- (-537.586) (-537.830) (-540.104) [-538.833] * (-542.933) (-547.805) [-537.731] (-537.959) -- 0:00:31
57500 -- (-539.110) (-538.934) (-538.330) [-537.341] * (-541.841) (-550.457) (-538.268) [-538.741] -- 0:00:30
58000 -- [-537.374] (-541.036) (-540.556) (-538.445) * [-537.509] (-548.830) (-537.389) (-538.072) -- 0:00:30
58500 -- (-540.941) (-539.450) [-545.576] (-538.404) * [-537.936] (-547.077) (-540.651) (-538.416) -- 0:00:30
59000 -- (-537.462) [-538.622] (-537.170) (-538.031) * (-544.078) (-547.163) (-537.567) [-539.215] -- 0:00:29
59500 -- (-539.878) (-537.692) (-541.530) [-538.690] * (-543.097) (-546.298) (-539.169) [-538.136] -- 0:00:29
60000 -- [-539.326] (-542.877) (-538.871) (-541.338) * (-539.878) [-554.055] (-539.238) (-537.169) -- 0:00:29
Average standard deviation of split frequencies: 0.026333
60500 -- (-537.496) (-540.294) [-537.740] (-536.961) * (-542.151) (-557.614) (-539.219) [-539.381] -- 0:00:29
61000 -- (-539.054) (-540.074) (-538.670) [-540.065] * (-540.145) (-542.688) (-538.770) [-539.640] -- 0:00:28
61500 -- (-540.805) [-540.132] (-537.841) (-539.928) * (-541.216) (-554.230) [-537.652] (-539.803) -- 0:00:28
62000 -- (-537.867) (-536.786) (-543.774) [-539.469] * (-539.688) (-544.935) [-540.540] (-539.432) -- 0:00:28
62500 -- (-536.997) [-539.106] (-543.186) (-538.483) * (-539.599) (-547.709) (-538.435) [-538.149] -- 0:00:28
63000 -- (-538.342) (-538.099) [-538.754] (-540.843) * (-539.564) (-545.568) (-540.103) [-540.035] -- 0:00:27
63500 -- (-537.772) (-542.696) [-538.215] (-536.841) * [-541.454] (-548.732) (-541.239) (-540.333) -- 0:00:27
64000 -- (-540.266) (-538.288) [-539.105] (-537.826) * (-540.428) (-542.545) [-539.442] (-537.595) -- 0:00:27
64500 -- (-544.296) (-537.692) (-541.555) [-540.644] * (-538.274) (-543.211) (-540.806) [-536.534] -- 0:00:27
65000 -- (-542.619) (-540.993) [-542.125] (-540.899) * [-538.261] (-556.062) (-540.569) (-537.554) -- 0:00:26
Average standard deviation of split frequencies: 0.022856
65500 -- (-538.956) (-538.635) (-542.717) [-539.647] * (-538.180) [-554.962] (-538.207) (-537.391) -- 0:00:26
66000 -- [-537.016] (-538.534) (-538.663) (-539.891) * (-537.994) [-547.261] (-540.663) (-536.983) -- 0:00:26
66500 -- (-536.701) (-540.072) [-538.409] (-540.168) * [-537.512] (-549.368) (-541.757) (-538.000) -- 0:00:26
67000 -- (-539.780) (-537.612) (-538.222) [-540.540] * (-537.192) (-542.323) [-539.842] (-537.345) -- 0:00:25
67500 -- [-539.085] (-537.701) (-539.208) (-539.346) * (-538.156) [-548.434] (-538.720) (-537.850) -- 0:00:25
68000 -- (-538.191) (-541.460) [-537.641] (-538.657) * (-537.561) [-542.049] (-539.768) (-537.417) -- 0:00:25
68500 -- (-538.238) (-538.097) [-538.386] (-536.912) * (-541.843) (-543.700) [-541.962] (-539.852) -- 0:00:25
69000 -- (-538.459) (-542.163) [-540.217] (-543.903) * (-539.432) [-542.052] (-538.213) (-538.702) -- 0:00:31
69500 -- [-538.945] (-539.931) (-541.366) (-540.983) * (-537.507) [-545.587] (-539.845) (-544.639) -- 0:00:30
70000 -- (-537.381) (-537.007) (-537.427) [-541.189] * [-538.866] (-552.052) (-541.108) (-544.868) -- 0:00:30
Average standard deviation of split frequencies: 0.026016
70500 -- (-537.215) (-539.113) (-537.141) [-538.402] * [-539.497] (-543.727) (-539.744) (-539.052) -- 0:00:30
71000 -- (-537.155) (-539.065) [-538.428] (-539.644) * (-539.258) (-544.208) [-540.532] (-539.505) -- 0:00:30
71500 -- (-543.152) [-538.651] (-538.813) (-537.896) * [-541.736] (-548.852) (-537.734) (-539.652) -- 0:00:29
72000 -- (-542.534) (-542.056) [-537.895] (-537.038) * (-540.588) (-541.891) [-540.932] (-537.408) -- 0:00:29
72500 -- (-538.904) (-540.569) [-537.663] (-538.710) * (-540.269) (-547.570) [-541.817] (-538.486) -- 0:00:29
73000 -- [-539.681] (-538.340) (-539.468) (-545.997) * (-540.236) (-543.624) (-538.379) [-539.027] -- 0:00:29
73500 -- (-537.499) (-538.586) [-539.591] (-540.470) * (-539.261) [-546.341] (-542.414) (-541.716) -- 0:00:29
74000 -- (-541.155) (-538.983) [-538.703] (-542.707) * [-539.394] (-549.895) (-539.105) (-536.623) -- 0:00:28
74500 -- [-540.699] (-541.100) (-540.941) (-539.511) * (-540.116) (-553.447) [-538.364] (-540.514) -- 0:00:28
75000 -- (-539.151) [-539.229] (-538.155) (-537.807) * (-539.578) (-554.210) [-538.307] (-541.404) -- 0:00:28
Average standard deviation of split frequencies: 0.025431
75500 -- (-538.507) [-542.746] (-539.263) (-540.063) * (-538.237) [-548.730] (-537.613) (-544.283) -- 0:00:28
76000 -- (-537.753) (-537.534) (-537.509) [-542.611] * (-538.025) [-549.625] (-540.294) (-537.760) -- 0:00:27
76500 -- (-546.708) [-539.039] (-536.892) (-541.046) * [-540.253] (-547.208) (-544.356) (-538.228) -- 0:00:27
77000 -- (-542.206) [-539.666] (-536.917) (-538.070) * (-540.448) [-548.563] (-539.362) (-538.356) -- 0:00:27
77500 -- (-537.662) [-540.291] (-539.216) (-539.416) * (-540.031) (-548.442) [-538.010] (-540.031) -- 0:00:27
78000 -- [-539.824] (-537.488) (-540.169) (-543.326) * (-541.417) (-544.945) [-537.610] (-541.106) -- 0:00:27
78500 -- (-539.535) [-543.022] (-541.310) (-536.898) * (-537.704) (-544.491) [-541.394] (-538.498) -- 0:00:26
79000 -- (-540.459) [-539.062] (-538.345) (-537.849) * (-537.743) [-549.122] (-543.583) (-538.349) -- 0:00:26
79500 -- (-542.531) [-542.966] (-538.576) (-538.297) * (-537.888) (-553.218) [-540.000] (-539.247) -- 0:00:26
80000 -- (-539.596) (-538.826) (-539.778) [-538.208] * (-538.118) (-550.070) [-539.781] (-538.069) -- 0:00:26
Average standard deviation of split frequencies: 0.024489
80500 -- [-538.138] (-538.293) (-539.553) (-545.682) * [-538.014] (-543.782) (-538.233) (-541.596) -- 0:00:26
81000 -- (-538.839) [-538.619] (-540.941) (-540.160) * (-537.601) (-555.322) (-539.900) [-541.399] -- 0:00:25
81500 -- (-537.354) (-537.832) (-538.621) [-537.413] * (-540.180) (-543.243) [-537.891] (-537.828) -- 0:00:25
82000 -- (-538.310) [-538.597] (-538.705) (-542.184) * (-540.985) [-546.457] (-537.213) (-536.783) -- 0:00:25
82500 -- (-538.739) (-538.214) [-538.120] (-539.335) * [-537.816] (-568.242) (-537.609) (-538.967) -- 0:00:25
83000 -- [-540.234] (-539.154) (-537.059) (-537.731) * (-538.692) (-547.777) [-540.723] (-538.126) -- 0:00:25
83500 -- (-537.790) (-541.937) (-537.083) [-538.426] * (-538.227) (-553.420) (-538.779) [-538.267] -- 0:00:24
84000 -- (-537.643) (-539.017) [-537.597] (-542.215) * (-544.783) (-539.422) (-540.946) [-537.905] -- 0:00:24
84500 -- (-540.589) (-536.765) [-539.004] (-537.751) * (-543.241) (-539.174) [-538.583] (-540.120) -- 0:00:24
85000 -- (-543.308) (-539.031) [-540.913] (-537.933) * (-540.752) (-536.814) [-540.341] (-539.040) -- 0:00:24
Average standard deviation of split frequencies: 0.020882
85500 -- (-543.795) [-537.443] (-541.469) (-542.134) * [-538.082] (-538.641) (-540.041) (-541.871) -- 0:00:24
86000 -- [-538.232] (-538.789) (-540.052) (-542.354) * (-539.392) (-539.856) [-539.307] (-540.828) -- 0:00:24
86500 -- (-537.244) (-538.902) [-539.575] (-542.478) * (-540.035) [-539.334] (-542.180) (-543.003) -- 0:00:28
87000 -- [-538.978] (-537.733) (-540.849) (-539.099) * (-539.873) [-539.644] (-539.010) (-540.950) -- 0:00:28
87500 -- (-541.677) (-541.382) (-539.278) [-544.415] * (-538.572) (-539.321) [-541.197] (-537.009) -- 0:00:28
88000 -- (-538.116) (-536.850) [-543.742] (-537.449) * (-539.226) (-538.598) [-536.804] (-539.499) -- 0:00:28
88500 -- (-538.948) [-539.386] (-538.406) (-543.626) * (-540.673) [-537.667] (-539.014) (-538.409) -- 0:00:27
89000 -- (-539.696) (-539.442) [-537.745] (-543.056) * [-542.634] (-537.531) (-538.200) (-541.333) -- 0:00:27
89500 -- (-542.109) (-539.064) (-537.499) [-539.549] * (-538.047) (-538.285) [-537.385] (-538.478) -- 0:00:27
90000 -- [-540.570] (-538.496) (-537.367) (-538.468) * [-536.879] (-539.087) (-538.513) (-538.876) -- 0:00:27
Average standard deviation of split frequencies: 0.023137
90500 -- (-545.789) (-540.834) (-537.539) [-537.833] * (-537.840) [-539.084] (-540.956) (-537.973) -- 0:00:27
91000 -- (-543.871) (-539.127) [-539.758] (-537.982) * (-539.061) (-539.643) (-541.873) [-540.219] -- 0:00:26
91500 -- (-543.149) [-542.137] (-539.262) (-537.011) * (-539.349) (-539.908) (-539.055) [-538.452] -- 0:00:26
92000 -- (-540.018) [-538.681] (-541.268) (-539.023) * (-537.499) (-543.474) [-540.521] (-538.571) -- 0:00:26
92500 -- (-543.174) (-537.681) [-540.561] (-537.838) * [-539.351] (-538.980) (-539.375) (-537.793) -- 0:00:26
93000 -- (-540.491) (-538.765) (-540.195) [-539.641] * (-542.624) (-540.934) (-541.588) [-537.593] -- 0:00:26
93500 -- (-539.502) (-537.767) [-537.932] (-539.113) * (-537.512) [-539.413] (-543.056) (-538.589) -- 0:00:26
94000 -- [-540.644] (-537.703) (-537.498) (-539.328) * (-537.483) (-538.958) [-539.859] (-539.730) -- 0:00:25
94500 -- [-543.588] (-540.751) (-537.086) (-540.171) * (-537.711) [-543.557] (-544.203) (-539.862) -- 0:00:25
95000 -- (-542.323) [-539.144] (-539.207) (-537.485) * [-538.961] (-541.877) (-540.450) (-538.145) -- 0:00:25
Average standard deviation of split frequencies: 0.020187
95500 -- [-538.698] (-539.502) (-538.616) (-537.481) * (-537.784) (-541.215) (-541.834) [-539.331] -- 0:00:25
96000 -- [-538.796] (-537.191) (-540.642) (-539.254) * (-540.880) (-541.394) [-540.010] (-538.489) -- 0:00:25
96500 -- [-541.228] (-538.211) (-540.656) (-540.909) * (-539.318) (-539.429) [-540.010] (-540.659) -- 0:00:25
97000 -- (-539.034) (-539.976) (-538.229) [-538.546] * (-537.382) [-537.644] (-540.029) (-542.638) -- 0:00:24
97500 -- (-537.300) (-543.410) [-537.843] (-542.155) * (-539.470) (-537.201) [-537.903] (-544.714) -- 0:00:24
98000 -- (-537.891) (-539.539) [-540.498] (-538.771) * (-537.608) (-539.814) [-538.791] (-542.055) -- 0:00:24
98500 -- (-537.806) (-538.062) [-537.748] (-536.968) * (-540.784) (-538.567) [-540.829] (-543.376) -- 0:00:24
99000 -- (-539.566) (-537.952) (-537.101) [-537.940] * (-541.559) [-537.716] (-538.750) (-541.441) -- 0:00:24
99500 -- (-538.187) (-539.671) (-538.505) [-538.908] * (-538.788) (-539.484) [-540.026] (-537.176) -- 0:00:24
100000 -- [-538.999] (-543.283) (-537.198) (-538.356) * (-538.113) (-540.002) [-538.290] (-538.066) -- 0:00:24
Average standard deviation of split frequencies: 0.019772
100500 -- (-541.719) (-539.205) [-538.125] (-539.698) * (-538.982) [-538.286] (-537.738) (-540.416) -- 0:00:23
101000 -- (-539.000) (-537.126) (-536.705) [-538.957] * (-537.254) [-543.467] (-537.355) (-539.506) -- 0:00:23
101500 -- (-537.914) (-539.089) (-537.783) [-538.775] * [-539.268] (-544.106) (-537.501) (-540.702) -- 0:00:23
102000 -- (-540.985) (-539.738) (-537.660) [-540.094] * (-539.539) (-540.310) (-537.317) [-537.460] -- 0:00:23
102500 -- (-538.448) (-539.202) (-537.364) [-537.461] * (-537.305) [-539.105] (-538.956) (-538.727) -- 0:00:23
103000 -- [-540.998] (-537.472) (-538.444) (-538.253) * [-538.306] (-539.282) (-541.181) (-538.213) -- 0:00:23
103500 -- (-538.422) [-538.198] (-538.757) (-542.409) * [-539.479] (-538.428) (-539.517) (-536.860) -- 0:00:26
104000 -- (-543.365) [-537.411] (-541.340) (-544.593) * (-538.647) (-539.134) (-539.446) [-539.456] -- 0:00:26
104500 -- (-542.651) [-539.435] (-540.670) (-549.330) * (-539.248) [-537.438] (-537.411) (-537.685) -- 0:00:26
105000 -- (-538.289) (-540.645) [-537.369] (-539.404) * (-540.873) (-538.662) [-537.433] (-537.198) -- 0:00:26
Average standard deviation of split frequencies: 0.019193
105500 -- [-538.873] (-540.696) (-543.152) (-542.779) * (-544.857) (-536.655) [-539.951] (-542.018) -- 0:00:26
106000 -- (-536.889) [-539.373] (-539.585) (-539.692) * [-538.183] (-538.272) (-539.153) (-538.585) -- 0:00:26
106500 -- (-539.426) (-539.569) (-537.879) [-537.931] * (-537.406) (-537.363) [-540.249] (-537.620) -- 0:00:25
107000 -- [-536.875] (-538.439) (-539.084) (-536.809) * (-541.859) (-537.436) [-539.345] (-537.320) -- 0:00:25
107500 -- (-538.965) (-538.672) [-538.604] (-537.507) * (-538.783) (-537.571) (-538.136) [-540.255] -- 0:00:25
108000 -- (-538.085) (-538.290) (-537.487) [-537.412] * (-540.799) [-538.076] (-537.436) (-537.929) -- 0:00:25
108500 -- [-539.407] (-540.082) (-538.347) (-540.645) * (-539.023) [-537.245] (-537.935) (-538.664) -- 0:00:25
109000 -- [-539.291] (-539.858) (-545.487) (-536.921) * (-538.163) [-538.751] (-542.252) (-539.683) -- 0:00:25
109500 -- (-539.606) (-538.504) (-542.175) [-539.195] * (-537.444) (-540.352) [-538.441] (-540.107) -- 0:00:24
110000 -- (-538.959) [-539.873] (-537.857) (-540.210) * (-536.839) (-541.471) [-538.356] (-539.652) -- 0:00:24
Average standard deviation of split frequencies: 0.016815
110500 -- (-537.664) (-540.364) [-538.085] (-539.390) * (-536.873) [-537.621] (-536.899) (-537.228) -- 0:00:24
111000 -- [-546.232] (-541.500) (-537.724) (-538.783) * (-544.289) (-540.416) (-539.236) [-538.457] -- 0:00:24
111500 -- (-545.233) [-537.078] (-537.012) (-539.440) * (-538.877) [-538.483] (-537.361) (-539.429) -- 0:00:24
112000 -- (-537.896) (-537.935) [-540.410] (-539.439) * [-539.149] (-540.017) (-540.879) (-537.957) -- 0:00:24
112500 -- [-539.825] (-540.091) (-538.380) (-540.308) * (-538.505) [-540.286] (-542.057) (-538.805) -- 0:00:24
113000 -- [-538.628] (-544.009) (-547.694) (-539.757) * (-538.608) [-537.759] (-539.694) (-536.912) -- 0:00:23
113500 -- [-540.766] (-540.132) (-537.468) (-539.895) * (-537.388) [-540.636] (-538.096) (-538.971) -- 0:00:23
114000 -- [-541.120] (-540.333) (-537.172) (-539.244) * [-538.310] (-538.540) (-540.392) (-538.519) -- 0:00:23
114500 -- (-537.155) (-543.640) [-537.927] (-545.002) * (-539.286) [-539.077] (-538.680) (-537.244) -- 0:00:23
115000 -- (-537.378) [-537.049] (-537.320) (-538.532) * (-540.131) (-538.859) [-537.620] (-539.331) -- 0:00:23
Average standard deviation of split frequencies: 0.015400
115500 -- (-539.968) [-539.039] (-539.177) (-541.541) * (-537.412) (-538.810) (-537.467) [-539.006] -- 0:00:23
116000 -- (-539.161) (-538.975) [-540.523] (-540.864) * (-540.474) (-538.524) (-539.185) [-537.827] -- 0:00:23
116500 -- (-537.497) [-538.909] (-540.408) (-543.367) * (-539.185) [-539.346] (-542.214) (-539.648) -- 0:00:23
117000 -- (-537.901) (-538.833) [-537.039] (-538.368) * (-538.558) [-538.305] (-543.003) (-538.437) -- 0:00:22
117500 -- [-538.914] (-537.953) (-540.863) (-537.648) * [-538.733] (-538.768) (-542.122) (-537.764) -- 0:00:22
118000 -- [-538.422] (-538.117) (-541.358) (-537.553) * (-538.574) (-537.854) [-541.032] (-540.342) -- 0:00:22
118500 -- (-541.906) (-539.928) [-542.005] (-540.510) * (-538.649) [-537.648] (-538.083) (-537.973) -- 0:00:22
119000 -- (-544.239) [-540.531] (-537.827) (-538.231) * (-544.845) (-537.118) (-541.261) [-538.345] -- 0:00:22
119500 -- [-537.293] (-539.681) (-539.731) (-541.061) * (-540.363) (-540.355) (-540.206) [-540.419] -- 0:00:22
120000 -- (-537.971) (-538.540) (-539.055) [-542.079] * (-536.816) [-539.276] (-537.729) (-539.219) -- 0:00:22
Average standard deviation of split frequencies: 0.015167
120500 -- (-544.285) [-538.718] (-537.095) (-539.493) * (-539.395) (-538.613) [-537.153] (-538.551) -- 0:00:25
121000 -- [-537.801] (-540.750) (-537.415) (-537.182) * (-540.950) (-537.873) (-539.588) [-538.250] -- 0:00:25
121500 -- (-539.824) [-541.760] (-537.090) (-538.429) * (-538.551) (-538.289) (-539.612) [-538.246] -- 0:00:24
122000 -- (-543.204) (-540.382) [-538.440] (-537.147) * (-539.529) (-537.398) (-537.428) [-537.832] -- 0:00:24
122500 -- (-543.737) (-537.716) (-538.796) [-542.732] * (-539.547) [-537.623] (-539.199) (-540.562) -- 0:00:24
123000 -- [-539.951] (-538.956) (-540.584) (-539.147) * (-537.942) (-539.199) [-538.034] (-540.749) -- 0:00:24
123500 -- (-539.489) [-537.662] (-536.876) (-541.178) * [-538.509] (-538.930) (-537.967) (-539.182) -- 0:00:24
124000 -- (-539.148) (-539.368) (-538.123) [-538.984] * (-538.242) [-536.980] (-539.441) (-537.531) -- 0:00:24
124500 -- (-538.589) [-543.845] (-537.696) (-540.433) * [-538.109] (-537.754) (-538.251) (-539.834) -- 0:00:24
125000 -- (-537.910) (-541.188) (-537.902) [-537.517] * (-539.807) [-538.601] (-537.392) (-546.417) -- 0:00:24
Average standard deviation of split frequencies: 0.014550
125500 -- (-541.625) (-538.787) (-537.812) [-539.302] * (-538.775) [-538.275] (-539.789) (-537.669) -- 0:00:23
126000 -- [-539.324] (-540.834) (-538.482) (-540.496) * (-537.870) [-537.961] (-538.950) (-538.778) -- 0:00:23
126500 -- (-537.510) [-539.245] (-541.465) (-540.886) * (-541.323) (-540.464) [-542.531] (-544.225) -- 0:00:23
127000 -- (-538.264) (-538.095) (-538.894) [-537.626] * (-539.917) (-539.203) (-538.025) [-538.273] -- 0:00:23
127500 -- (-538.763) (-537.596) [-537.204] (-537.257) * [-536.952] (-538.561) (-540.303) (-538.057) -- 0:00:23
128000 -- (-541.308) (-539.120) [-537.284] (-538.847) * (-537.135) (-540.371) [-540.530] (-537.794) -- 0:00:23
128500 -- (-539.961) (-541.288) [-539.790] (-538.468) * [-538.115] (-538.987) (-538.096) (-539.265) -- 0:00:23
129000 -- (-537.209) [-540.710] (-545.906) (-537.016) * (-538.466) [-538.303] (-542.463) (-539.067) -- 0:00:23
129500 -- (-537.968) (-541.305) [-539.793] (-538.518) * (-537.905) [-542.836] (-540.056) (-540.097) -- 0:00:22
130000 -- (-541.113) (-539.396) [-541.774] (-537.492) * (-537.634) [-541.601] (-539.844) (-538.556) -- 0:00:22
Average standard deviation of split frequencies: 0.016836
130500 -- (-538.749) [-539.267] (-539.950) (-538.627) * (-537.860) (-541.321) (-537.983) [-537.928] -- 0:00:22
131000 -- (-537.422) (-540.016) (-537.676) [-538.579] * [-537.852] (-546.706) (-537.495) (-537.142) -- 0:00:22
131500 -- [-537.361] (-540.378) (-537.813) (-539.450) * (-537.567) [-542.476] (-537.792) (-538.630) -- 0:00:22
132000 -- (-540.463) [-540.172] (-537.267) (-539.811) * (-539.454) [-538.564] (-539.036) (-538.888) -- 0:00:22
132500 -- (-538.959) [-539.246] (-537.451) (-539.158) * (-540.333) (-538.855) (-539.656) [-539.087] -- 0:00:22
133000 -- [-538.230] (-540.641) (-537.063) (-537.770) * (-537.867) (-543.124) (-539.281) [-537.417] -- 0:00:22
133500 -- [-537.665] (-540.920) (-542.638) (-537.354) * (-536.760) (-540.833) (-538.499) [-538.448] -- 0:00:21
134000 -- (-538.687) (-538.832) [-540.490] (-537.659) * [-540.341] (-538.935) (-536.827) (-539.338) -- 0:00:21
134500 -- (-538.101) (-537.592) (-538.894) [-537.137] * [-537.240] (-538.185) (-538.815) (-538.990) -- 0:00:21
135000 -- (-538.592) (-539.472) (-537.577) [-538.771] * (-537.596) (-538.177) (-539.425) [-538.247] -- 0:00:21
Average standard deviation of split frequencies: 0.015983
135500 -- (-537.523) (-539.810) (-538.934) [-539.849] * (-542.378) (-538.272) (-537.853) [-539.128] -- 0:00:21
136000 -- (-541.561) [-539.350] (-539.690) (-539.395) * [-539.948] (-538.745) (-540.386) (-539.121) -- 0:00:21
136500 -- (-541.254) (-540.767) [-537.890] (-540.142) * (-542.861) (-537.844) [-538.299] (-539.522) -- 0:00:21
137000 -- (-538.741) (-542.098) (-538.238) [-538.185] * (-540.031) [-538.156] (-539.632) (-536.871) -- 0:00:21
137500 -- (-540.364) (-537.531) (-538.142) [-538.552] * (-540.804) (-543.694) (-538.490) [-536.888] -- 0:00:23
138000 -- (-540.807) (-537.294) (-540.370) [-538.603] * (-538.943) [-541.968] (-536.872) (-539.754) -- 0:00:23
138500 -- (-539.011) (-539.058) (-538.267) [-538.868] * (-538.863) (-539.019) [-542.908] (-539.185) -- 0:00:23
139000 -- (-542.991) (-538.595) (-538.109) [-538.873] * (-542.019) (-537.450) (-538.209) [-537.818] -- 0:00:23
139500 -- (-537.304) (-540.128) [-539.399] (-539.556) * (-538.709) (-542.137) [-540.622] (-539.117) -- 0:00:23
140000 -- [-537.238] (-538.327) (-540.825) (-537.974) * (-539.834) [-539.057] (-541.549) (-538.934) -- 0:00:23
Average standard deviation of split frequencies: 0.014522
140500 -- [-537.032] (-545.078) (-537.832) (-541.189) * (-540.312) [-540.076] (-539.436) (-538.024) -- 0:00:23
141000 -- (-539.775) (-540.767) [-538.415] (-543.361) * [-540.905] (-538.740) (-537.359) (-539.616) -- 0:00:22
141500 -- (-539.048) (-540.724) (-539.854) [-538.277] * (-544.706) (-538.375) (-539.037) [-537.810] -- 0:00:22
142000 -- (-538.995) (-543.253) [-537.968] (-540.582) * (-541.979) [-539.823] (-538.069) (-536.976) -- 0:00:22
142500 -- [-545.937] (-537.588) (-537.416) (-537.896) * (-541.857) (-541.177) (-539.781) [-538.369] -- 0:00:22
143000 -- (-540.455) [-537.550] (-537.828) (-537.813) * [-540.361] (-537.894) (-538.523) (-543.263) -- 0:00:22
143500 -- [-537.800] (-541.296) (-537.543) (-539.971) * (-540.785) [-539.467] (-538.675) (-538.429) -- 0:00:22
144000 -- (-539.579) [-538.003] (-538.411) (-538.428) * (-537.505) (-538.380) (-540.173) [-537.966] -- 0:00:22
144500 -- (-538.991) (-543.157) [-537.362] (-538.757) * [-537.803] (-538.164) (-540.677) (-537.885) -- 0:00:22
145000 -- (-542.408) (-539.200) (-539.181) [-538.070] * [-538.442] (-539.162) (-542.491) (-538.355) -- 0:00:22
Average standard deviation of split frequencies: 0.015068
145500 -- (-540.060) (-539.587) [-538.085] (-537.608) * [-540.256] (-541.098) (-540.649) (-537.915) -- 0:00:21
146000 -- (-541.490) (-540.740) [-539.001] (-537.337) * [-539.987] (-539.812) (-538.734) (-537.554) -- 0:00:21
146500 -- (-542.372) [-538.576] (-544.608) (-537.042) * (-543.853) (-537.557) [-538.567] (-539.454) -- 0:00:21
147000 -- (-543.141) (-543.247) (-542.772) [-537.140] * (-537.355) (-538.426) (-538.388) [-539.464] -- 0:00:21
147500 -- [-543.251] (-539.935) (-541.756) (-538.738) * [-538.878] (-540.335) (-539.428) (-537.801) -- 0:00:21
148000 -- (-547.406) (-538.867) [-542.924] (-539.014) * (-542.113) (-538.910) [-539.404] (-537.542) -- 0:00:21
148500 -- (-543.165) (-537.673) (-538.038) [-542.227] * (-544.812) [-540.069] (-540.511) (-537.686) -- 0:00:21
149000 -- (-539.480) (-541.542) (-538.778) [-538.540] * [-538.132] (-538.272) (-539.150) (-539.117) -- 0:00:21
149500 -- (-539.201) [-538.455] (-538.052) (-537.469) * (-538.300) [-538.262] (-540.280) (-539.256) -- 0:00:21
150000 -- (-537.032) (-541.274) [-539.604] (-539.069) * (-541.090) (-539.344) (-540.924) [-538.460] -- 0:00:21
Average standard deviation of split frequencies: 0.013906
150500 -- [-537.567] (-537.503) (-538.600) (-538.162) * (-538.885) (-537.081) (-543.046) [-538.718] -- 0:00:20
151000 -- [-539.668] (-537.379) (-536.793) (-539.322) * (-536.932) [-536.783] (-541.318) (-541.113) -- 0:00:20
151500 -- (-540.557) (-538.500) (-539.346) [-537.195] * (-539.375) [-538.168] (-543.345) (-537.622) -- 0:00:20
152000 -- (-541.385) (-540.246) [-538.883] (-544.273) * (-537.986) (-540.136) [-537.658] (-537.171) -- 0:00:20
152500 -- [-537.290] (-538.966) (-538.531) (-540.521) * (-539.852) [-539.469] (-541.041) (-543.298) -- 0:00:20
153000 -- (-537.203) (-537.755) [-537.799] (-540.751) * (-538.407) (-538.025) [-543.761] (-547.143) -- 0:00:20
153500 -- [-537.266] (-541.349) (-539.965) (-536.890) * [-541.394] (-537.993) (-540.760) (-546.555) -- 0:00:20
154000 -- (-538.735) (-538.170) [-537.480] (-538.205) * [-542.921] (-537.787) (-539.311) (-537.472) -- 0:00:20
154500 -- [-538.906] (-538.917) (-538.503) (-537.688) * (-537.391) (-537.045) (-538.678) [-539.687] -- 0:00:20
155000 -- (-541.896) (-544.633) [-538.151] (-540.267) * [-537.532] (-537.203) (-539.490) (-539.810) -- 0:00:22
Average standard deviation of split frequencies: 0.015109
155500 -- (-540.169) (-540.143) [-538.089] (-538.543) * (-537.902) (-538.758) (-538.966) [-536.797] -- 0:00:22
156000 -- (-540.975) (-536.762) (-545.350) [-539.289] * [-536.963] (-543.083) (-539.711) (-537.909) -- 0:00:22
156500 -- (-538.273) (-537.019) [-542.151] (-541.725) * (-539.595) [-541.547] (-536.766) (-538.501) -- 0:00:21
157000 -- (-536.653) [-537.889] (-538.330) (-539.052) * [-539.631] (-540.282) (-538.819) (-539.868) -- 0:00:21
157500 -- [-543.728] (-540.500) (-538.992) (-539.726) * (-539.526) (-538.172) (-541.828) [-538.912] -- 0:00:21
158000 -- [-539.391] (-537.322) (-537.492) (-541.454) * (-537.541) [-537.059] (-538.515) (-539.179) -- 0:00:21
158500 -- (-537.653) (-537.080) (-538.066) [-538.724] * (-540.410) (-537.439) [-538.639] (-538.456) -- 0:00:21
159000 -- [-538.886] (-538.129) (-538.450) (-539.955) * (-542.262) [-538.382] (-539.917) (-537.991) -- 0:00:21
159500 -- (-539.461) (-537.535) (-538.135) [-541.183] * (-536.859) (-538.932) (-541.847) [-538.758] -- 0:00:21
160000 -- (-537.361) (-536.821) (-539.361) [-544.315] * (-540.541) (-540.645) (-540.928) [-540.487] -- 0:00:21
Average standard deviation of split frequencies: 0.016137
160500 -- (-538.071) (-539.362) [-540.988] (-538.493) * (-537.750) (-540.049) (-540.197) [-538.930] -- 0:00:21
161000 -- (-538.137) (-537.384) (-544.996) [-537.056] * (-538.270) (-536.871) [-537.404] (-539.671) -- 0:00:21
161500 -- (-539.517) (-537.194) (-537.544) [-539.244] * (-540.413) (-537.514) (-538.134) [-541.539] -- 0:00:20
162000 -- (-538.636) (-540.091) [-539.464] (-538.864) * [-540.426] (-537.386) (-542.141) (-544.984) -- 0:00:20
162500 -- (-538.535) (-539.144) (-537.558) [-540.925] * (-545.030) (-538.835) [-538.659] (-545.790) -- 0:00:20
163000 -- [-537.886] (-538.881) (-539.555) (-537.145) * (-541.143) [-540.085] (-541.194) (-538.716) -- 0:00:20
163500 -- (-537.052) (-539.272) [-539.124] (-541.570) * [-538.727] (-538.250) (-540.526) (-537.409) -- 0:00:20
164000 -- (-539.681) (-538.862) (-540.276) [-540.186] * (-539.728) (-543.288) (-538.182) [-538.967] -- 0:00:20
164500 -- (-540.434) (-536.990) (-538.014) [-537.554] * [-539.586] (-538.900) (-537.339) (-539.622) -- 0:00:20
165000 -- (-545.411) (-538.486) [-538.697] (-538.699) * (-541.165) (-536.875) [-537.836] (-539.601) -- 0:00:20
Average standard deviation of split frequencies: 0.016705
165500 -- (-543.417) [-537.960] (-540.854) (-537.149) * (-539.251) (-537.492) [-538.910] (-540.757) -- 0:00:20
166000 -- (-539.266) (-537.784) [-538.434] (-538.995) * [-542.090] (-538.640) (-538.042) (-539.628) -- 0:00:20
166500 -- (-537.494) (-538.044) (-538.720) [-537.036] * (-540.008) (-538.882) (-539.326) [-538.319] -- 0:00:20
167000 -- [-537.015] (-537.480) (-538.647) (-540.867) * [-537.824] (-538.595) (-541.880) (-537.434) -- 0:00:19
167500 -- (-538.817) [-538.215] (-540.085) (-539.989) * [-539.202] (-543.227) (-540.625) (-538.594) -- 0:00:19
168000 -- (-541.122) [-538.952] (-539.377) (-539.918) * [-541.470] (-539.023) (-540.886) (-537.274) -- 0:00:19
168500 -- (-539.475) (-541.295) (-538.033) [-538.742] * (-539.585) (-540.319) (-541.262) [-537.959] -- 0:00:19
169000 -- (-537.228) [-537.620] (-537.842) (-538.632) * (-540.122) (-539.641) (-538.070) [-539.486] -- 0:00:19
169500 -- (-537.379) (-540.802) (-538.865) [-538.651] * (-537.253) [-537.646] (-543.898) (-538.917) -- 0:00:19
170000 -- (-539.034) (-541.021) (-538.433) [-539.679] * (-541.031) [-537.205] (-543.356) (-539.217) -- 0:00:19
Average standard deviation of split frequencies: 0.016055
170500 -- (-539.607) (-539.342) (-540.993) [-539.353] * (-538.439) (-538.366) [-539.179] (-543.017) -- 0:00:19
171000 -- [-536.875] (-537.414) (-540.740) (-538.837) * (-540.968) [-537.383] (-541.068) (-538.003) -- 0:00:19
171500 -- (-539.554) (-543.737) [-537.643] (-541.192) * (-538.973) [-539.512] (-539.158) (-539.382) -- 0:00:19
172000 -- (-546.355) [-540.235] (-537.366) (-537.972) * (-539.532) (-540.837) [-537.288] (-539.247) -- 0:00:20
172500 -- (-540.503) (-538.299) [-538.159] (-539.026) * (-539.205) [-539.244] (-541.425) (-542.144) -- 0:00:20
173000 -- [-541.298] (-538.103) (-537.789) (-538.368) * (-539.863) (-537.435) [-539.030] (-541.518) -- 0:00:20
173500 -- (-538.571) (-539.083) [-537.907] (-537.716) * [-537.610] (-540.626) (-542.829) (-539.650) -- 0:00:20
174000 -- (-538.810) (-540.427) [-538.323] (-537.399) * (-536.820) [-538.041] (-541.221) (-537.475) -- 0:00:20
174500 -- (-539.473) [-539.437] (-538.510) (-537.171) * [-537.116] (-539.158) (-540.584) (-541.159) -- 0:00:20
175000 -- (-537.417) (-537.516) (-539.925) [-537.110] * (-537.224) [-540.856] (-540.221) (-543.385) -- 0:00:20
Average standard deviation of split frequencies: 0.016071
175500 -- (-536.741) [-537.640] (-537.345) (-536.876) * (-543.367) (-540.889) (-540.411) [-538.892] -- 0:00:20
176000 -- (-538.422) (-537.789) [-539.413] (-538.827) * [-547.129] (-538.346) (-538.589) (-540.431) -- 0:00:20
176500 -- [-537.631] (-536.954) (-537.622) (-540.713) * (-539.046) (-540.580) (-537.068) [-540.093] -- 0:00:20
177000 -- [-537.525] (-541.876) (-538.029) (-537.777) * [-538.410] (-538.222) (-537.579) (-538.905) -- 0:00:20
177500 -- (-537.418) [-538.906] (-539.864) (-537.920) * (-537.701) (-539.411) (-538.853) [-539.972] -- 0:00:19
178000 -- (-536.737) (-536.972) (-538.075) [-538.919] * (-539.111) (-538.587) (-538.148) [-541.675] -- 0:00:19
178500 -- [-537.091] (-538.550) (-541.475) (-538.075) * (-538.268) (-540.297) (-537.626) [-540.534] -- 0:00:19
179000 -- (-540.491) [-537.529] (-539.909) (-539.557) * (-541.465) (-537.800) (-538.752) [-539.368] -- 0:00:19
179500 -- (-540.789) (-539.046) (-540.365) [-538.889] * [-542.229] (-539.473) (-537.928) (-542.132) -- 0:00:19
180000 -- [-538.693] (-539.532) (-540.632) (-545.568) * (-538.841) (-538.674) [-537.453] (-541.139) -- 0:00:19
Average standard deviation of split frequencies: 0.015502
180500 -- (-537.236) (-538.014) (-538.898) [-538.813] * [-538.456] (-538.263) (-537.596) (-540.175) -- 0:00:19
181000 -- (-537.524) (-541.096) (-538.103) [-537.866] * [-538.627] (-537.330) (-537.568) (-539.049) -- 0:00:19
181500 -- (-537.096) (-539.520) (-537.882) [-541.375] * (-542.986) [-538.733] (-538.688) (-537.593) -- 0:00:19
182000 -- [-538.609] (-539.428) (-537.778) (-542.715) * (-539.953) [-537.878] (-540.799) (-537.804) -- 0:00:19
182500 -- [-537.683] (-542.250) (-538.352) (-539.199) * (-538.081) (-540.509) (-542.872) [-537.827] -- 0:00:19
183000 -- (-540.486) (-542.650) (-538.156) [-539.230] * (-539.714) (-539.478) (-536.933) [-538.838] -- 0:00:19
183500 -- (-539.351) (-537.431) [-537.400] (-549.037) * [-537.960] (-537.285) (-537.475) (-537.673) -- 0:00:18
184000 -- [-537.011] (-537.083) (-538.060) (-541.749) * (-537.691) (-538.789) [-537.999] (-539.566) -- 0:00:18
184500 -- (-538.056) [-537.980] (-539.207) (-539.849) * (-537.316) (-537.489) [-544.586] (-537.872) -- 0:00:18
185000 -- (-539.650) (-538.298) (-541.926) [-539.236] * (-540.421) (-538.982) [-541.450] (-541.287) -- 0:00:18
Average standard deviation of split frequencies: 0.015058
185500 -- (-537.792) (-538.164) [-539.527] (-537.615) * (-541.636) (-538.682) [-539.603] (-539.345) -- 0:00:18
186000 -- (-537.970) (-539.939) [-541.031] (-538.690) * (-538.921) (-538.960) [-539.561] (-538.921) -- 0:00:18
186500 -- (-536.981) [-539.218] (-540.468) (-539.095) * (-540.044) (-538.268) (-537.564) [-537.941] -- 0:00:18
187000 -- (-536.474) (-540.080) [-539.000] (-538.987) * [-538.097] (-538.557) (-537.272) (-543.886) -- 0:00:18
187500 -- (-537.674) (-542.741) [-539.052] (-538.278) * (-538.978) (-540.036) [-538.113] (-545.459) -- 0:00:18
188000 -- (-538.626) [-539.884] (-538.002) (-540.844) * (-539.255) [-542.398] (-539.589) (-537.939) -- 0:00:18
188500 -- (-541.756) (-537.764) [-539.427] (-541.557) * (-537.845) (-540.623) (-537.401) [-537.424] -- 0:00:18
189000 -- (-541.749) [-537.214] (-541.451) (-540.748) * [-537.125] (-541.944) (-545.259) (-539.087) -- 0:00:19
189500 -- (-540.570) (-536.852) [-540.244] (-538.480) * (-537.105) (-542.225) [-539.476] (-536.770) -- 0:00:19
190000 -- (-539.748) (-541.892) (-538.018) [-540.293] * (-538.671) (-540.674) [-537.166] (-539.292) -- 0:00:19
Average standard deviation of split frequencies: 0.014340
190500 -- (-539.746) (-541.424) [-540.045] (-539.911) * (-539.015) (-542.774) [-539.134] (-537.914) -- 0:00:19
191000 -- (-541.831) (-538.656) (-538.573) [-537.610] * (-538.503) [-537.641] (-540.268) (-540.400) -- 0:00:19
191500 -- [-541.988] (-538.005) (-540.138) (-539.543) * (-538.351) (-537.593) [-539.394] (-539.687) -- 0:00:19
192000 -- (-543.608) [-537.068] (-538.232) (-541.326) * [-537.247] (-538.698) (-539.356) (-537.752) -- 0:00:19
192500 -- [-538.425] (-540.834) (-540.178) (-539.111) * (-537.857) (-537.919) (-544.627) [-539.300] -- 0:00:19
193000 -- [-538.011] (-541.533) (-541.938) (-538.059) * [-539.587] (-538.606) (-542.203) (-543.519) -- 0:00:19
193500 -- (-538.114) (-538.707) [-536.791] (-539.953) * (-542.142) (-537.585) [-544.803] (-540.363) -- 0:00:19
194000 -- (-537.376) [-536.946] (-537.683) (-538.529) * [-539.998] (-539.460) (-538.278) (-538.773) -- 0:00:18
194500 -- (-538.822) [-537.698] (-541.703) (-537.576) * (-539.742) (-540.060) (-545.436) [-537.301] -- 0:00:18
195000 -- [-540.447] (-539.381) (-541.755) (-539.730) * (-539.497) (-538.320) (-541.881) [-537.022] -- 0:00:18
Average standard deviation of split frequencies: 0.013950
195500 -- [-538.055] (-538.741) (-540.830) (-537.647) * [-542.262] (-538.003) (-539.031) (-539.219) -- 0:00:18
196000 -- (-538.654) (-541.856) (-543.159) [-537.075] * (-538.525) (-538.845) [-537.621] (-538.694) -- 0:00:18
196500 -- (-537.260) (-538.218) [-539.609] (-537.700) * (-539.828) (-537.476) (-536.969) [-540.114] -- 0:00:18
197000 -- (-537.239) [-537.206] (-538.531) (-537.372) * [-539.861] (-540.006) (-538.124) (-538.372) -- 0:00:18
197500 -- (-538.664) (-539.359) (-539.301) [-540.570] * [-538.153] (-537.031) (-539.453) (-540.977) -- 0:00:18
198000 -- (-538.322) [-538.394] (-542.231) (-537.784) * [-537.775] (-537.748) (-541.086) (-538.135) -- 0:00:18
198500 -- (-539.364) (-540.545) [-540.246] (-538.376) * [-537.772] (-538.277) (-538.273) (-544.182) -- 0:00:18
199000 -- (-538.804) (-537.268) [-538.654] (-539.619) * [-536.900] (-540.408) (-539.195) (-541.952) -- 0:00:18
199500 -- [-542.226] (-539.993) (-540.011) (-538.492) * (-538.198) (-538.614) (-538.534) [-539.390] -- 0:00:18
200000 -- [-538.694] (-542.184) (-537.790) (-537.779) * [-538.184] (-539.614) (-538.139) (-539.152) -- 0:00:18
Average standard deviation of split frequencies: 0.013948
200500 -- (-540.477) (-541.713) (-542.925) [-539.659] * (-540.307) (-540.158) (-537.234) [-538.230] -- 0:00:17
201000 -- (-545.030) [-537.651] (-537.225) (-540.659) * [-538.437] (-540.480) (-542.151) (-542.506) -- 0:00:17
201500 -- (-544.407) [-541.338] (-540.169) (-539.767) * [-540.752] (-539.686) (-537.669) (-538.748) -- 0:00:17
202000 -- (-538.516) (-538.250) [-539.133] (-539.547) * (-539.351) (-541.150) (-537.804) [-540.021] -- 0:00:17
202500 -- (-537.955) [-539.207] (-537.113) (-536.886) * (-540.772) (-538.202) (-540.449) [-537.108] -- 0:00:17
203000 -- (-540.286) (-537.551) (-540.532) [-544.037] * [-539.372] (-537.454) (-541.573) (-539.994) -- 0:00:17
203500 -- (-538.087) (-538.736) [-540.086] (-538.180) * (-537.913) [-538.183] (-538.119) (-540.311) -- 0:00:17
204000 -- (-537.093) [-537.868] (-536.991) (-537.266) * [-542.356] (-541.009) (-541.189) (-540.545) -- 0:00:17
204500 -- [-537.791] (-538.809) (-540.123) (-538.631) * (-538.960) [-540.214] (-537.939) (-537.250) -- 0:00:17
205000 -- [-538.162] (-537.094) (-538.916) (-538.699) * (-537.559) (-538.308) [-536.746] (-539.145) -- 0:00:17
Average standard deviation of split frequencies: 0.014942
205500 -- (-541.181) (-537.348) [-538.041] (-539.263) * (-540.795) (-541.969) (-538.552) [-537.737] -- 0:00:17
206000 -- (-538.206) (-539.617) [-538.868] (-539.590) * (-540.810) [-538.458] (-540.545) (-538.606) -- 0:00:18
206500 -- (-539.926) [-537.482] (-539.809) (-537.746) * (-539.451) [-538.389] (-539.806) (-537.986) -- 0:00:18
207000 -- [-538.156] (-539.014) (-539.393) (-537.632) * (-540.068) [-540.056] (-542.487) (-538.991) -- 0:00:18
207500 -- (-544.414) (-538.762) [-543.132] (-540.015) * [-540.614] (-539.941) (-538.064) (-539.275) -- 0:00:18
208000 -- (-539.953) [-539.175] (-538.782) (-538.068) * (-539.759) (-538.671) (-537.206) [-539.030] -- 0:00:18
208500 -- (-538.345) (-540.774) [-536.537] (-540.294) * (-542.957) [-537.776] (-537.537) (-541.381) -- 0:00:18
209000 -- (-537.792) [-537.574] (-539.873) (-546.345) * (-540.344) (-538.109) [-539.801] (-538.486) -- 0:00:18
209500 -- (-538.418) (-539.206) [-539.568] (-540.226) * (-539.172) (-538.646) (-539.741) [-541.713] -- 0:00:18
210000 -- (-537.165) (-538.549) (-540.706) [-540.217] * (-537.220) (-538.011) (-541.847) [-541.256] -- 0:00:17
Average standard deviation of split frequencies: 0.015664
210500 -- [-540.414] (-539.445) (-539.562) (-539.012) * (-537.344) [-541.342] (-536.954) (-542.428) -- 0:00:17
211000 -- (-539.090) (-540.874) (-538.497) [-540.165] * (-536.744) (-537.566) [-537.304] (-539.032) -- 0:00:17
211500 -- (-538.465) [-538.187] (-537.618) (-540.570) * [-537.293] (-538.840) (-539.211) (-539.544) -- 0:00:17
212000 -- [-538.084] (-543.157) (-538.100) (-539.038) * (-537.556) [-537.932] (-537.493) (-539.511) -- 0:00:17
212500 -- (-542.453) (-545.365) [-540.180] (-538.261) * (-538.068) [-538.446] (-539.652) (-536.628) -- 0:00:17
213000 -- (-537.221) (-539.773) (-538.367) [-538.855] * [-538.836] (-539.749) (-539.655) (-536.802) -- 0:00:17
213500 -- (-538.110) [-536.964] (-542.680) (-537.129) * (-539.251) [-541.562] (-538.763) (-537.879) -- 0:00:17
214000 -- (-547.033) (-537.362) (-538.264) [-538.136] * (-542.382) (-537.186) [-538.500] (-537.642) -- 0:00:17
214500 -- (-545.200) (-537.825) (-539.475) [-536.690] * [-541.813] (-542.202) (-537.060) (-537.088) -- 0:00:17
215000 -- (-546.986) (-537.959) (-540.821) [-537.488] * (-539.053) (-542.156) [-537.481] (-537.156) -- 0:00:17
Average standard deviation of split frequencies: 0.014671
215500 -- (-539.439) (-538.628) [-540.178] (-536.934) * (-539.131) [-539.611] (-537.460) (-538.395) -- 0:00:17
216000 -- [-540.875] (-540.350) (-538.825) (-538.008) * (-546.461) [-538.631] (-538.987) (-537.880) -- 0:00:17
216500 -- [-539.274] (-538.546) (-538.892) (-538.050) * [-539.356] (-540.000) (-539.655) (-537.525) -- 0:00:17
217000 -- (-539.196) (-540.125) (-540.091) [-537.188] * (-538.231) (-536.795) [-537.103] (-539.621) -- 0:00:16
217500 -- (-538.303) (-538.131) (-537.230) [-539.170] * (-541.675) (-537.354) [-538.368] (-540.389) -- 0:00:16
218000 -- (-541.153) (-539.612) [-537.898] (-539.418) * (-540.184) [-537.642] (-545.174) (-537.783) -- 0:00:16
218500 -- (-540.043) (-537.903) [-537.791] (-539.456) * [-538.747] (-537.157) (-539.897) (-538.292) -- 0:00:16
219000 -- (-538.313) (-536.554) (-539.242) [-538.318] * (-537.922) [-539.569] (-536.872) (-538.672) -- 0:00:16
219500 -- (-538.368) (-539.614) [-537.400] (-537.875) * (-538.737) (-543.202) (-537.288) [-538.142] -- 0:00:16
220000 -- (-538.262) (-537.378) (-539.088) [-539.010] * (-537.811) (-537.177) [-536.934] (-538.783) -- 0:00:16
Average standard deviation of split frequencies: 0.014286
220500 -- [-537.543] (-542.587) (-538.461) (-546.176) * (-539.457) [-538.657] (-539.479) (-539.706) -- 0:00:16
221000 -- [-539.214] (-539.925) (-537.978) (-543.423) * (-539.548) (-540.808) [-537.154] (-538.800) -- 0:00:16
221500 -- (-539.845) [-536.958] (-539.454) (-542.108) * (-538.084) (-538.342) [-536.499] (-538.726) -- 0:00:16
222000 -- (-536.971) [-537.921] (-538.182) (-538.558) * (-538.348) (-543.310) [-536.782] (-537.629) -- 0:00:16
222500 -- [-538.948] (-541.184) (-541.608) (-538.213) * (-537.873) (-542.203) (-536.987) [-538.107] -- 0:00:16
223000 -- (-543.479) [-538.086] (-536.871) (-538.201) * (-537.888) [-540.081] (-537.976) (-540.950) -- 0:00:17
223500 -- (-546.903) (-538.237) [-537.165] (-539.486) * (-537.239) (-541.781) [-537.960] (-540.071) -- 0:00:17
224000 -- (-545.183) (-539.233) (-541.683) [-538.946] * (-537.730) (-539.145) [-537.496] (-538.069) -- 0:00:17
224500 -- (-543.056) (-537.491) (-540.439) [-540.571] * (-537.371) (-538.179) (-536.979) [-537.340] -- 0:00:17
225000 -- [-538.005] (-537.880) (-538.018) (-540.458) * (-539.503) [-539.330] (-537.403) (-541.351) -- 0:00:17
Average standard deviation of split frequencies: 0.014862
225500 -- (-537.880) [-540.483] (-543.086) (-537.660) * (-538.476) (-540.602) [-540.708] (-544.520) -- 0:00:17
226000 -- (-540.791) (-544.202) (-542.150) [-538.634] * [-537.725] (-540.459) (-541.717) (-538.978) -- 0:00:16
226500 -- (-541.722) (-538.630) [-542.181] (-543.234) * (-538.074) [-537.794] (-538.780) (-537.421) -- 0:00:16
227000 -- [-537.402] (-541.838) (-538.438) (-537.322) * (-538.637) (-538.243) (-537.787) [-537.356] -- 0:00:16
227500 -- (-538.766) (-539.625) [-536.943] (-537.270) * [-541.012] (-537.910) (-537.637) (-540.245) -- 0:00:16
228000 -- (-538.549) (-541.178) (-536.765) [-538.808] * (-538.682) (-537.672) (-538.494) [-541.320] -- 0:00:16
228500 -- (-537.179) (-541.588) (-537.753) [-538.483] * [-538.340] (-537.010) (-541.742) (-537.215) -- 0:00:16
229000 -- (-539.224) (-540.864) (-537.267) [-538.340] * [-539.342] (-537.427) (-537.194) (-537.593) -- 0:00:16
229500 -- [-538.361] (-536.665) (-538.948) (-538.551) * [-538.594] (-537.880) (-538.464) (-536.712) -- 0:00:16
230000 -- (-540.208) (-545.324) (-538.846) [-538.724] * [-538.933] (-538.750) (-537.743) (-537.988) -- 0:00:16
Average standard deviation of split frequencies: 0.013156
230500 -- (-539.500) [-538.066] (-537.925) (-537.880) * (-540.837) [-539.847] (-543.539) (-539.292) -- 0:00:16
231000 -- [-538.401] (-536.598) (-536.800) (-540.447) * [-539.946] (-539.067) (-541.660) (-540.576) -- 0:00:16
231500 -- [-538.600] (-539.412) (-547.955) (-543.927) * (-537.753) [-539.070] (-537.644) (-538.835) -- 0:00:16
232000 -- (-539.807) (-537.867) [-541.821] (-537.109) * (-539.268) [-539.235] (-537.318) (-540.516) -- 0:00:16
232500 -- (-538.792) [-537.920] (-539.927) (-538.425) * [-538.297] (-537.700) (-538.012) (-538.654) -- 0:00:16
233000 -- (-540.819) (-539.063) (-538.316) [-540.287] * (-538.647) (-538.855) (-537.487) [-540.254] -- 0:00:16
233500 -- (-537.705) (-539.112) (-537.765) [-541.311] * (-537.862) [-537.983] (-538.179) (-538.429) -- 0:00:15
234000 -- (-540.320) (-538.581) [-538.021] (-541.898) * (-537.691) [-539.655] (-537.568) (-543.783) -- 0:00:15
234500 -- (-539.024) (-537.898) (-539.265) [-538.534] * (-539.546) (-538.374) [-538.484] (-540.461) -- 0:00:15
235000 -- [-538.969] (-546.786) (-538.964) (-537.463) * (-541.773) [-537.936] (-536.888) (-540.348) -- 0:00:15
Average standard deviation of split frequencies: 0.013108
235500 -- [-540.967] (-545.147) (-537.955) (-537.724) * (-537.480) (-539.979) (-544.165) [-540.624] -- 0:00:15
236000 -- (-539.643) (-542.045) [-538.840] (-540.254) * (-538.490) (-540.892) [-540.294] (-544.637) -- 0:00:15
236500 -- (-541.824) [-537.488] (-541.120) (-540.321) * [-538.194] (-538.200) (-538.813) (-539.007) -- 0:00:15
237000 -- (-542.319) (-538.060) [-536.979] (-540.431) * (-539.169) (-538.908) (-537.161) [-537.652] -- 0:00:15
237500 -- (-542.709) (-541.203) [-539.087] (-538.288) * (-539.169) (-541.464) (-539.850) [-540.034] -- 0:00:15
238000 -- (-538.408) [-541.555] (-536.924) (-538.088) * [-539.320] (-541.882) (-538.308) (-541.306) -- 0:00:15
238500 -- [-539.822] (-539.787) (-546.206) (-538.623) * (-538.725) (-539.336) (-538.909) [-537.584] -- 0:00:15
239000 -- (-540.094) [-537.610] (-538.545) (-539.925) * (-539.356) (-536.996) (-538.909) [-538.569] -- 0:00:15
239500 -- (-538.515) (-540.803) [-540.171] (-540.450) * (-539.068) (-544.572) [-538.611] (-539.305) -- 0:00:15
240000 -- (-540.708) (-537.149) [-538.412] (-539.419) * (-537.200) (-542.842) (-538.066) [-541.372] -- 0:00:15
Average standard deviation of split frequencies: 0.013099
240500 -- (-537.851) (-538.921) (-537.754) [-538.483] * (-537.997) (-540.850) [-539.741] (-541.796) -- 0:00:16
241000 -- (-537.838) (-538.350) [-537.834] (-538.408) * (-538.804) (-539.701) [-539.573] (-538.957) -- 0:00:16
241500 -- (-539.447) (-540.609) (-539.126) [-540.280] * (-539.046) (-538.776) (-539.069) [-539.886] -- 0:00:16
242000 -- [-541.066] (-538.573) (-539.025) (-538.025) * (-539.497) (-536.860) [-540.416] (-539.001) -- 0:00:15
242500 -- (-540.210) (-546.739) (-539.398) [-537.920] * (-537.372) (-536.624) (-536.568) [-539.844] -- 0:00:15
243000 -- (-538.449) (-538.300) (-539.638) [-538.615] * (-537.574) [-537.871] (-538.969) (-536.887) -- 0:00:15
243500 -- (-541.586) (-537.405) [-536.785] (-541.489) * (-537.171) [-537.830] (-538.343) (-537.272) -- 0:00:15
244000 -- [-538.343] (-543.393) (-537.042) (-540.862) * (-537.664) (-540.821) (-539.850) [-537.702] -- 0:00:15
244500 -- (-539.065) (-541.173) [-537.502] (-540.488) * [-537.352] (-537.178) (-539.476) (-537.966) -- 0:00:15
245000 -- (-540.341) [-538.824] (-536.745) (-538.371) * (-538.955) (-537.301) [-537.975] (-538.633) -- 0:00:15
Average standard deviation of split frequencies: 0.011723
245500 -- [-539.831] (-540.201) (-536.937) (-538.038) * (-538.075) (-540.069) (-538.831) [-538.756] -- 0:00:15
246000 -- (-536.712) (-540.028) [-540.096] (-541.989) * (-538.355) (-544.509) [-538.659] (-539.117) -- 0:00:15
246500 -- [-539.713] (-537.202) (-541.719) (-539.012) * [-544.458] (-538.307) (-537.234) (-539.033) -- 0:00:15
247000 -- (-539.592) [-538.124] (-537.959) (-542.311) * [-541.064] (-541.388) (-537.486) (-540.288) -- 0:00:15
247500 -- (-539.269) [-537.823] (-542.541) (-537.911) * (-536.887) (-543.268) [-538.822] (-537.330) -- 0:00:15
248000 -- (-537.839) (-542.635) (-542.338) [-538.408] * (-536.870) (-539.307) [-537.993] (-539.016) -- 0:00:15
248500 -- (-538.618) [-540.336] (-538.673) (-538.592) * (-537.827) [-539.223] (-539.786) (-542.321) -- 0:00:15
249000 -- (-541.834) (-539.112) [-537.770] (-540.840) * [-538.546] (-541.513) (-539.269) (-542.322) -- 0:00:15
249500 -- (-544.156) (-539.923) (-539.913) [-539.826] * (-538.045) [-537.723] (-540.059) (-541.070) -- 0:00:15
250000 -- (-538.764) (-542.184) [-539.229] (-538.049) * (-537.001) (-543.265) [-540.743] (-539.506) -- 0:00:15
Average standard deviation of split frequencies: 0.012611
250500 -- (-542.356) (-542.451) [-540.978] (-537.094) * (-540.585) (-539.861) (-540.816) [-540.480] -- 0:00:14
251000 -- [-538.346] (-540.695) (-537.837) (-537.869) * (-537.970) (-538.490) (-538.293) [-537.895] -- 0:00:14
251500 -- (-540.026) (-540.188) (-538.554) [-538.572] * (-540.879) (-540.772) (-537.623) [-540.594] -- 0:00:14
252000 -- (-543.577) (-537.844) [-537.819] (-538.883) * [-539.834] (-541.235) (-538.961) (-541.339) -- 0:00:14
252500 -- (-537.728) [-537.767] (-538.288) (-541.610) * [-537.856] (-538.288) (-539.952) (-542.038) -- 0:00:14
253000 -- [-539.120] (-539.281) (-537.343) (-541.021) * (-538.902) (-538.403) [-538.941] (-538.443) -- 0:00:14
253500 -- (-538.755) [-538.825] (-538.959) (-537.574) * (-538.943) (-539.681) [-538.442] (-539.153) -- 0:00:14
254000 -- (-537.842) [-536.746] (-539.455) (-537.271) * (-537.909) (-537.940) (-540.526) [-539.622] -- 0:00:14
254500 -- (-538.491) [-539.495] (-538.809) (-539.482) * (-540.744) (-538.596) [-538.841] (-540.855) -- 0:00:14
255000 -- [-542.744] (-540.218) (-538.006) (-537.232) * [-538.130] (-538.591) (-538.335) (-539.918) -- 0:00:14
Average standard deviation of split frequencies: 0.012023
255500 -- (-542.749) (-537.458) (-541.616) [-537.040] * [-539.442] (-537.455) (-541.121) (-542.085) -- 0:00:14
256000 -- [-539.142] (-539.244) (-540.178) (-537.198) * (-542.518) (-537.093) [-539.064] (-539.401) -- 0:00:14
256500 -- [-537.753] (-540.807) (-546.070) (-539.563) * (-539.515) [-538.381] (-539.335) (-538.537) -- 0:00:14
257000 -- [-539.834] (-538.935) (-538.421) (-539.964) * (-538.181) (-538.851) [-537.229] (-538.590) -- 0:00:14
257500 -- (-536.747) (-538.018) (-540.364) [-540.433] * (-541.277) (-541.210) (-540.773) [-537.567] -- 0:00:15
258000 -- (-537.052) (-538.663) [-537.381] (-536.678) * [-540.296] (-538.753) (-542.756) (-538.260) -- 0:00:15
258500 -- [-537.419] (-539.638) (-537.770) (-544.482) * (-543.122) (-539.382) [-539.560] (-539.694) -- 0:00:14
259000 -- (-537.284) [-537.642] (-542.056) (-541.590) * (-544.221) (-537.809) (-540.623) [-537.054] -- 0:00:14
259500 -- (-539.674) (-539.094) [-537.617] (-539.966) * (-538.461) [-536.911] (-542.257) (-541.774) -- 0:00:14
260000 -- (-540.768) (-544.083) [-537.749] (-537.335) * [-537.477] (-537.833) (-538.577) (-539.930) -- 0:00:14
Average standard deviation of split frequencies: 0.011702
260500 -- (-539.883) (-543.315) [-537.862] (-539.020) * [-537.441] (-537.997) (-536.870) (-537.138) -- 0:00:14
261000 -- (-541.528) (-538.143) (-545.485) [-541.832] * [-537.955] (-537.466) (-538.408) (-537.696) -- 0:00:14
261500 -- (-538.610) (-544.540) [-543.981] (-543.412) * (-538.133) (-539.060) [-542.634] (-537.468) -- 0:00:14
262000 -- (-537.998) (-537.420) (-542.771) [-542.203] * (-539.436) (-539.005) [-539.677] (-541.869) -- 0:00:14
262500 -- [-537.862] (-537.132) (-538.034) (-541.085) * (-539.558) (-540.394) [-538.881] (-539.892) -- 0:00:14
263000 -- (-539.781) [-537.707] (-538.213) (-537.948) * [-537.482] (-536.944) (-537.847) (-540.777) -- 0:00:14
263500 -- (-538.538) (-539.014) [-537.916] (-538.879) * (-537.424) (-543.410) (-538.836) [-538.706] -- 0:00:14
264000 -- (-538.610) (-538.032) [-536.710] (-537.312) * (-538.469) [-537.445] (-538.772) (-537.849) -- 0:00:14
264500 -- (-539.731) (-540.590) [-538.094] (-538.277) * (-538.366) [-537.999] (-538.311) (-538.125) -- 0:00:14
265000 -- (-541.662) (-537.204) (-538.986) [-541.078] * [-538.345] (-537.329) (-538.146) (-540.077) -- 0:00:14
Average standard deviation of split frequencies: 0.011676
265500 -- (-537.271) (-542.334) [-541.898] (-541.030) * [-538.551] (-541.851) (-537.341) (-544.756) -- 0:00:14
266000 -- (-540.591) (-536.918) (-538.638) [-537.479] * (-538.076) [-538.182] (-538.640) (-541.833) -- 0:00:14
266500 -- (-540.769) [-538.123] (-541.026) (-537.830) * [-536.811] (-537.541) (-538.413) (-539.518) -- 0:00:14
267000 -- (-540.165) [-538.547] (-538.203) (-538.201) * (-539.338) (-538.051) [-538.972] (-540.411) -- 0:00:13
267500 -- (-544.561) (-538.876) [-541.803] (-539.349) * [-539.081] (-541.746) (-540.975) (-538.026) -- 0:00:13
268000 -- (-542.103) [-537.454] (-541.523) (-537.585) * (-540.874) [-539.829] (-538.347) (-537.807) -- 0:00:13
268500 -- (-538.410) (-537.247) [-539.526] (-538.243) * [-537.688] (-540.174) (-538.944) (-539.810) -- 0:00:13
269000 -- (-539.250) (-545.821) (-538.917) [-538.135] * (-538.325) (-540.170) [-539.531] (-537.481) -- 0:00:13
269500 -- (-540.604) (-543.350) (-537.165) [-537.008] * (-539.585) [-539.001] (-541.235) (-538.192) -- 0:00:13
270000 -- (-538.367) [-536.938] (-542.983) (-538.147) * (-539.988) (-541.018) (-540.137) [-538.972] -- 0:00:13
Average standard deviation of split frequencies: 0.012869
270500 -- (-541.724) [-537.036] (-537.953) (-536.974) * [-537.654] (-541.040) (-537.893) (-538.194) -- 0:00:13
271000 -- (-546.265) (-538.030) (-539.258) [-538.264] * (-540.235) [-537.415] (-540.200) (-537.706) -- 0:00:13
271500 -- [-540.007] (-539.035) (-540.378) (-540.060) * (-538.910) [-536.709] (-539.405) (-543.363) -- 0:00:13
272000 -- (-538.449) (-537.195) [-537.654] (-543.986) * (-538.496) (-537.906) [-538.717] (-544.073) -- 0:00:13
272500 -- [-538.614] (-538.628) (-538.410) (-541.609) * (-536.537) [-536.916] (-538.869) (-546.175) -- 0:00:13
273000 -- (-540.105) (-538.857) (-539.062) [-539.116] * (-536.778) (-536.805) (-539.728) [-540.390] -- 0:00:13
273500 -- (-541.195) [-537.461] (-539.260) (-540.308) * (-536.889) (-536.954) (-541.900) [-540.284] -- 0:00:13
274000 -- [-544.175] (-538.704) (-540.451) (-539.863) * (-539.450) [-537.812] (-538.056) (-537.225) -- 0:00:13
274500 -- (-539.481) [-537.580] (-539.088) (-539.867) * (-537.564) (-540.779) [-537.469] (-538.556) -- 0:00:13
275000 -- (-539.135) (-538.174) (-538.075) [-537.332] * (-539.593) (-539.278) [-537.616] (-541.442) -- 0:00:13
Average standard deviation of split frequencies: 0.012715
275500 -- (-538.486) (-540.346) [-538.128] (-539.075) * (-539.453) [-539.369] (-540.661) (-539.147) -- 0:00:13
276000 -- (-537.077) [-539.174] (-541.513) (-537.012) * [-539.410] (-543.414) (-538.136) (-537.597) -- 0:00:13
276500 -- (-537.834) (-538.984) [-539.542] (-540.062) * (-540.812) (-539.467) [-542.028] (-538.912) -- 0:00:13
277000 -- (-538.154) (-539.735) (-538.292) [-539.008] * [-536.987] (-538.302) (-541.161) (-537.953) -- 0:00:13
277500 -- (-537.340) [-540.675] (-543.792) (-537.006) * (-536.842) (-538.633) [-536.658] (-537.460) -- 0:00:13
278000 -- (-537.533) (-538.738) [-538.437] (-537.335) * [-538.796] (-539.694) (-539.335) (-538.788) -- 0:00:13
278500 -- (-539.944) [-542.045] (-545.500) (-537.590) * [-537.384] (-540.609) (-537.695) (-537.969) -- 0:00:13
279000 -- (-538.964) [-540.821] (-541.583) (-539.415) * (-538.803) (-541.600) (-539.227) [-536.952] -- 0:00:13
279500 -- [-538.894] (-538.494) (-539.915) (-538.085) * (-538.818) [-538.176] (-537.905) (-538.499) -- 0:00:13
280000 -- [-536.917] (-540.077) (-536.542) (-537.619) * (-537.584) (-541.594) [-540.857] (-540.732) -- 0:00:13
Average standard deviation of split frequencies: 0.012548
280500 -- [-538.674] (-541.383) (-539.411) (-538.329) * (-537.286) [-539.944] (-537.191) (-541.981) -- 0:00:13
281000 -- (-538.793) (-538.316) [-538.574] (-540.496) * (-537.287) (-540.865) [-539.119] (-539.101) -- 0:00:13
281500 -- (-539.102) [-540.157] (-538.334) (-537.351) * [-539.134] (-539.650) (-545.164) (-542.107) -- 0:00:13
282000 -- (-542.516) [-538.478] (-537.414) (-541.080) * (-537.898) [-538.579] (-539.890) (-537.501) -- 0:00:13
282500 -- (-537.975) [-540.478] (-538.244) (-538.843) * (-538.904) [-538.215] (-542.002) (-538.757) -- 0:00:13
283000 -- [-539.731] (-537.849) (-537.571) (-540.988) * (-537.853) (-540.945) (-538.369) [-539.282] -- 0:00:13
283500 -- (-539.151) [-538.800] (-537.767) (-540.323) * (-542.191) (-538.088) (-540.168) [-541.293] -- 0:00:12
284000 -- (-540.356) [-538.674] (-537.208) (-542.703) * [-542.191] (-537.689) (-540.423) (-538.189) -- 0:00:12
284500 -- (-540.461) (-538.380) (-540.441) [-541.576] * (-541.155) [-538.067] (-542.306) (-539.027) -- 0:00:12
285000 -- [-536.523] (-537.209) (-541.174) (-543.238) * (-537.389) [-538.161] (-537.671) (-539.565) -- 0:00:12
Average standard deviation of split frequencies: 0.011996
285500 -- (-537.758) (-538.005) (-538.292) [-539.492] * [-537.162] (-538.532) (-537.907) (-549.241) -- 0:00:12
286000 -- (-539.319) (-538.193) (-539.173) [-538.947] * (-537.118) (-538.720) (-538.922) [-538.674] -- 0:00:12
286500 -- (-547.339) (-538.432) (-541.549) [-538.915] * [-537.498] (-537.856) (-538.135) (-539.519) -- 0:00:12
287000 -- [-538.165] (-539.760) (-542.589) (-537.740) * (-538.591) (-537.375) [-537.041] (-539.089) -- 0:00:12
287500 -- [-538.414] (-540.660) (-539.063) (-538.272) * [-539.974] (-538.046) (-539.894) (-537.192) -- 0:00:12
288000 -- [-541.150] (-539.930) (-538.598) (-537.838) * (-541.334) (-537.444) [-538.347] (-538.605) -- 0:00:12
288500 -- (-540.096) (-537.645) (-537.467) [-537.523] * (-539.304) (-540.855) [-539.137] (-537.675) -- 0:00:12
289000 -- (-541.048) (-544.240) (-540.738) [-539.395] * [-541.107] (-539.129) (-539.085) (-540.043) -- 0:00:12
289500 -- (-537.574) (-542.489) [-538.740] (-540.525) * (-538.913) (-537.778) [-539.933] (-540.090) -- 0:00:12
290000 -- (-539.278) (-538.918) [-536.841] (-537.304) * (-538.275) [-540.066] (-538.602) (-542.042) -- 0:00:12
Average standard deviation of split frequencies: 0.011713
290500 -- (-538.429) (-537.622) (-539.786) [-537.881] * (-538.998) [-540.188] (-541.120) (-540.568) -- 0:00:12
291000 -- (-538.021) [-537.560] (-540.136) (-538.105) * (-537.974) (-538.745) [-538.329] (-541.067) -- 0:00:12
291500 -- [-539.907] (-538.437) (-538.567) (-540.436) * (-537.670) (-539.231) [-537.876] (-538.203) -- 0:00:12
292000 -- (-539.120) (-543.232) [-540.697] (-537.845) * (-538.731) (-540.924) [-537.719] (-542.258) -- 0:00:12
292500 -- (-543.772) [-538.842] (-538.495) (-539.112) * (-538.713) [-538.539] (-537.402) (-540.539) -- 0:00:12
293000 -- (-537.783) (-538.160) (-539.380) [-540.444] * (-537.502) (-538.108) (-539.315) [-537.174] -- 0:00:12
293500 -- (-537.879) [-541.719] (-539.264) (-538.136) * (-543.550) (-536.667) [-539.939] (-539.649) -- 0:00:12
294000 -- (-538.662) (-539.151) (-538.172) [-537.787] * (-538.962) (-536.706) (-539.902) [-538.059] -- 0:00:12
294500 -- (-539.147) (-537.354) (-538.468) [-537.509] * (-540.360) (-536.975) [-540.254] (-537.823) -- 0:00:12
295000 -- (-546.078) (-536.967) [-538.942] (-537.300) * (-538.218) [-540.385] (-538.324) (-539.874) -- 0:00:12
Average standard deviation of split frequencies: 0.012121
295500 -- [-537.591] (-537.636) (-539.065) (-538.407) * (-538.213) (-540.023) [-537.231] (-538.914) -- 0:00:12
296000 -- (-542.040) [-537.918] (-538.586) (-539.582) * [-545.479] (-543.135) (-541.759) (-542.494) -- 0:00:12
296500 -- (-541.032) [-538.540] (-540.323) (-538.137) * (-541.041) (-539.939) (-540.142) [-539.628] -- 0:00:12
297000 -- (-540.207) (-538.890) (-540.800) [-537.847] * (-539.528) (-540.421) (-538.421) [-537.744] -- 0:00:12
297500 -- (-541.096) [-537.769] (-542.047) (-537.518) * [-538.568] (-542.387) (-540.537) (-537.572) -- 0:00:12
298000 -- (-541.791) (-537.973) [-541.849] (-539.107) * (-538.393) [-536.734] (-537.406) (-541.358) -- 0:00:12
298500 -- (-540.377) (-538.192) (-537.992) [-537.224] * (-537.102) (-537.722) [-537.589] (-537.365) -- 0:00:12
299000 -- (-537.695) (-540.831) [-539.684] (-539.809) * (-538.658) (-538.124) [-538.756] (-538.028) -- 0:00:12
299500 -- (-538.662) (-544.355) (-537.124) [-542.286] * (-538.405) (-539.864) (-538.882) [-538.872] -- 0:00:12
300000 -- (-537.121) (-540.786) [-537.445] (-540.654) * (-543.452) (-538.856) (-538.769) [-538.196] -- 0:00:12
Average standard deviation of split frequencies: 0.012451
300500 -- (-537.674) (-537.461) (-538.499) [-543.570] * (-539.076) (-536.928) (-539.462) [-539.653] -- 0:00:11
301000 -- (-540.690) [-537.763] (-537.745) (-541.597) * (-538.475) [-536.751] (-542.924) (-539.109) -- 0:00:11
301500 -- (-540.686) (-537.400) (-537.752) [-538.202] * (-539.041) (-538.011) (-539.391) [-540.043] -- 0:00:11
302000 -- (-540.019) [-537.291] (-538.718) (-540.871) * (-537.905) (-539.347) (-541.580) [-542.460] -- 0:00:11
302500 -- (-538.324) [-540.217] (-538.567) (-540.860) * (-538.803) (-539.401) (-540.082) [-537.703] -- 0:00:11
303000 -- (-537.939) [-538.182] (-542.183) (-538.028) * (-540.860) [-537.199] (-538.268) (-538.636) -- 0:00:11
303500 -- (-538.414) (-539.832) [-536.688] (-541.533) * (-538.786) [-536.933] (-538.586) (-540.605) -- 0:00:11
304000 -- (-538.489) [-540.647] (-540.517) (-538.022) * (-539.770) [-541.183] (-537.623) (-538.453) -- 0:00:11
304500 -- (-537.232) (-543.712) [-537.257] (-539.343) * (-538.957) (-538.048) (-536.837) [-539.547] -- 0:00:11
305000 -- (-538.929) (-548.463) [-536.684] (-538.515) * [-539.311] (-538.140) (-537.820) (-541.522) -- 0:00:11
Average standard deviation of split frequencies: 0.011270
305500 -- (-539.006) (-544.406) [-538.028] (-537.828) * (-538.607) [-537.655] (-538.051) (-537.913) -- 0:00:11
306000 -- [-538.279] (-543.377) (-537.482) (-538.915) * (-538.437) (-537.321) [-536.679] (-538.601) -- 0:00:11
306500 -- (-538.980) (-538.230) (-537.760) [-538.289] * [-537.764] (-540.401) (-539.433) (-538.355) -- 0:00:11
307000 -- (-537.952) [-538.281] (-536.840) (-537.445) * (-539.660) [-538.316] (-538.426) (-537.597) -- 0:00:11
307500 -- (-537.742) [-537.023] (-538.343) (-538.465) * (-539.265) (-539.194) [-541.146] (-540.866) -- 0:00:11
308000 -- (-543.577) [-537.667] (-539.228) (-539.110) * (-538.910) [-539.657] (-540.742) (-538.909) -- 0:00:11
308500 -- [-538.684] (-536.463) (-539.360) (-537.417) * (-538.710) (-540.643) (-541.647) [-537.290] -- 0:00:11
309000 -- (-538.105) (-545.919) (-539.554) [-539.242] * (-539.144) (-538.145) [-538.757] (-542.898) -- 0:00:11
309500 -- (-537.941) (-540.237) (-537.547) [-537.774] * [-540.073] (-538.248) (-547.582) (-541.791) -- 0:00:11
310000 -- (-538.527) (-540.788) [-537.234] (-537.757) * [-538.149] (-539.869) (-538.742) (-538.210) -- 0:00:11
Average standard deviation of split frequencies: 0.012675
310500 -- (-538.854) [-537.365] (-538.296) (-543.701) * (-536.881) (-540.677) [-537.846] (-537.595) -- 0:00:11
311000 -- (-540.065) [-539.080] (-540.093) (-538.611) * (-541.368) (-538.441) (-539.835) [-537.865] -- 0:00:11
311500 -- (-538.669) [-542.729] (-539.303) (-539.657) * (-539.710) [-540.569] (-538.437) (-538.047) -- 0:00:11
312000 -- (-543.088) (-538.082) [-540.098] (-538.428) * (-537.434) (-542.245) (-537.448) [-537.419] -- 0:00:11
312500 -- (-539.485) [-537.090] (-541.810) (-539.386) * [-539.174] (-540.714) (-537.756) (-539.010) -- 0:00:11
313000 -- (-537.292) (-537.475) [-537.312] (-541.609) * [-538.763] (-539.655) (-540.647) (-542.586) -- 0:00:11
313500 -- (-538.068) [-537.448] (-537.783) (-540.813) * [-538.331] (-540.697) (-542.377) (-541.797) -- 0:00:11
314000 -- [-538.692] (-539.381) (-538.854) (-538.127) * (-537.933) (-539.219) (-541.674) [-538.827] -- 0:00:11
314500 -- (-539.060) (-539.322) [-536.853] (-543.434) * (-538.533) (-539.274) (-537.575) [-539.243] -- 0:00:11
315000 -- [-540.526] (-537.616) (-538.331) (-541.771) * [-538.288] (-543.630) (-539.207) (-541.416) -- 0:00:11
Average standard deviation of split frequencies: 0.013426
315500 -- [-540.140] (-539.665) (-536.941) (-542.990) * [-538.490] (-538.671) (-537.375) (-539.400) -- 0:00:11
316000 -- (-545.614) (-538.563) [-538.412] (-541.545) * (-538.027) (-544.252) (-539.097) [-539.123] -- 0:00:11
316500 -- (-537.446) (-538.691) [-539.869] (-536.995) * (-539.047) [-538.482] (-537.951) (-540.166) -- 0:00:11
317000 -- [-537.521] (-542.092) (-540.180) (-538.276) * (-538.911) (-538.856) [-538.175] (-540.704) -- 0:00:10
317500 -- (-539.610) [-540.267] (-540.185) (-537.115) * (-537.045) (-538.692) (-536.957) [-538.842] -- 0:00:10
318000 -- (-539.184) [-536.833] (-542.471) (-538.485) * (-543.934) (-537.323) [-538.374] (-541.696) -- 0:00:10
318500 -- (-542.372) (-537.998) [-541.135] (-538.397) * (-538.875) [-536.919] (-538.720) (-538.002) -- 0:00:10
319000 -- (-542.045) [-539.425] (-540.461) (-539.959) * (-540.342) [-537.744] (-539.125) (-537.586) -- 0:00:10
319500 -- (-539.877) (-538.901) [-544.205] (-537.769) * (-540.135) (-539.778) (-538.862) [-538.000] -- 0:00:10
320000 -- (-542.639) (-540.504) (-541.849) [-538.203] * [-537.163] (-539.362) (-538.150) (-538.371) -- 0:00:10
Average standard deviation of split frequencies: 0.014182
320500 -- (-539.263) [-538.879] (-537.996) (-539.068) * (-537.845) (-537.199) (-538.839) [-537.018] -- 0:00:10
321000 -- (-537.393) (-541.252) (-538.941) [-540.138] * (-540.787) (-538.718) (-538.082) [-538.586] -- 0:00:10
321500 -- (-540.598) (-545.565) (-538.334) [-538.836] * (-539.714) (-538.512) [-540.513] (-538.148) -- 0:00:10
322000 -- [-539.688] (-540.939) (-539.632) (-541.048) * (-537.940) (-541.842) (-537.484) [-538.443] -- 0:00:10
322500 -- (-538.168) (-540.206) [-539.346] (-537.692) * [-542.738] (-541.191) (-536.884) (-543.271) -- 0:00:10
323000 -- (-538.049) (-538.787) [-537.963] (-542.735) * (-540.075) (-539.051) (-538.225) [-541.235] -- 0:00:10
323500 -- (-540.537) (-542.571) [-537.309] (-539.465) * [-539.166] (-538.833) (-538.076) (-542.749) -- 0:00:10
324000 -- (-539.402) (-539.844) (-540.086) [-541.374] * [-539.320] (-540.726) (-539.307) (-539.580) -- 0:00:10
324500 -- (-536.909) [-539.413] (-541.129) (-539.771) * (-538.419) (-539.251) [-537.250] (-540.531) -- 0:00:10
325000 -- (-538.756) (-538.121) [-538.516] (-540.018) * (-540.461) (-538.321) (-539.303) [-536.718] -- 0:00:10
Average standard deviation of split frequencies: 0.014971
325500 -- (-541.207) (-537.940) [-538.677] (-538.493) * (-540.149) (-542.632) [-538.502] (-537.183) -- 0:00:10
326000 -- (-540.152) (-537.723) (-537.887) [-539.909] * (-537.954) (-539.937) [-538.023] (-538.164) -- 0:00:10
326500 -- (-542.075) (-537.796) (-541.207) [-538.493] * (-538.195) [-540.667] (-537.734) (-538.985) -- 0:00:10
327000 -- (-538.215) (-545.423) [-542.500] (-537.877) * (-538.574) (-542.911) (-538.685) [-538.064] -- 0:00:10
327500 -- (-540.066) (-541.397) (-537.349) [-539.859] * [-537.752] (-540.406) (-538.048) (-539.632) -- 0:00:10
328000 -- (-539.776) (-539.955) [-538.312] (-539.819) * (-537.308) (-539.109) (-537.911) [-537.557] -- 0:00:10
328500 -- (-539.499) [-538.510] (-540.198) (-537.015) * (-545.014) (-538.206) [-540.910] (-536.915) -- 0:00:10
329000 -- (-537.773) (-542.003) (-540.227) [-539.677] * (-536.797) (-538.917) [-539.727] (-537.014) -- 0:00:10
329500 -- [-537.184] (-538.610) (-538.413) (-539.652) * (-540.562) [-537.291] (-538.890) (-540.447) -- 0:00:10
330000 -- (-538.116) (-537.293) (-538.551) [-538.955] * (-540.117) (-537.393) (-540.873) [-539.011] -- 0:00:10
Average standard deviation of split frequencies: 0.014927
330500 -- (-540.844) [-536.894] (-541.279) (-538.584) * (-537.186) [-539.765] (-543.244) (-537.609) -- 0:00:10
331000 -- (-540.874) [-538.868] (-538.421) (-539.274) * (-537.176) (-541.584) [-539.526] (-536.766) -- 0:00:10
331500 -- (-539.813) (-536.873) [-541.026] (-537.259) * (-537.238) (-541.952) (-538.033) [-539.223] -- 0:00:10
332000 -- (-537.978) (-537.928) (-540.375) [-540.892] * (-538.735) (-544.612) [-536.527] (-543.054) -- 0:00:10
332500 -- (-538.793) [-538.093] (-537.870) (-538.442) * (-538.232) [-539.907] (-538.784) (-538.938) -- 0:00:10
333000 -- (-540.475) [-542.499] (-541.810) (-539.282) * (-536.596) (-539.944) [-537.935] (-539.418) -- 0:00:10
333500 -- (-542.370) [-537.526] (-538.655) (-538.121) * (-538.038) (-538.653) [-537.791] (-543.826) -- 0:00:09
334000 -- (-538.073) [-536.984] (-537.929) (-540.505) * (-538.614) (-537.373) (-538.083) [-537.627] -- 0:00:09
334500 -- (-537.407) [-536.998] (-542.396) (-537.432) * [-538.311] (-538.002) (-538.634) (-541.709) -- 0:00:09
335000 -- (-540.059) (-539.180) (-538.634) [-538.643] * [-539.860] (-541.252) (-537.644) (-541.393) -- 0:00:09
Average standard deviation of split frequencies: 0.014195
335500 -- (-538.878) [-537.187] (-542.345) (-537.311) * (-538.919) [-537.891] (-540.378) (-538.130) -- 0:00:09
336000 -- (-537.168) (-538.360) [-541.271] (-541.674) * (-539.424) (-537.905) (-539.821) [-536.838] -- 0:00:09
336500 -- (-537.842) (-537.750) [-542.810] (-541.021) * (-539.833) [-539.537] (-537.154) (-539.841) -- 0:00:09
337000 -- (-537.078) (-540.264) (-538.264) [-540.864] * (-542.950) [-540.651] (-542.507) (-537.453) -- 0:00:09
337500 -- (-537.859) (-538.149) [-537.567] (-538.386) * (-542.226) (-542.733) [-539.632] (-537.765) -- 0:00:09
338000 -- (-536.515) (-540.863) [-537.882] (-538.159) * (-540.569) [-539.571] (-537.925) (-539.728) -- 0:00:09
338500 -- (-539.295) (-541.754) [-537.618] (-539.083) * (-537.960) (-537.975) (-542.545) [-537.048] -- 0:00:09
339000 -- (-539.096) [-538.061] (-539.346) (-540.131) * (-544.216) [-537.862] (-539.770) (-541.617) -- 0:00:09
339500 -- [-540.600] (-538.473) (-539.112) (-538.089) * (-541.062) [-538.404] (-538.323) (-539.789) -- 0:00:09
340000 -- (-537.693) [-538.694] (-538.801) (-538.215) * [-537.017] (-540.117) (-538.019) (-536.901) -- 0:00:09
Average standard deviation of split frequencies: 0.014299
340500 -- [-537.748] (-538.244) (-537.595) (-539.828) * (-539.168) (-540.985) (-538.188) [-537.494] -- 0:00:09
341000 -- [-542.093] (-537.703) (-543.281) (-538.463) * (-544.796) (-540.522) (-538.268) [-539.811] -- 0:00:09
341500 -- (-538.691) (-541.071) [-538.784] (-537.581) * (-541.295) [-537.902] (-539.793) (-539.637) -- 0:00:09
342000 -- [-537.199] (-539.962) (-540.281) (-541.974) * (-538.530) [-538.699] (-536.871) (-543.020) -- 0:00:09
342500 -- [-538.957] (-536.994) (-541.243) (-539.995) * (-538.485) [-538.196] (-537.149) (-545.243) -- 0:00:09
343000 -- (-545.792) [-539.317] (-538.999) (-537.239) * [-538.418] (-539.179) (-539.183) (-538.429) -- 0:00:09
343500 -- (-539.703) [-538.693] (-537.745) (-539.280) * [-537.119] (-536.924) (-538.376) (-537.163) -- 0:00:09
344000 -- (-538.925) (-539.889) [-539.637] (-538.507) * [-537.874] (-539.271) (-538.837) (-541.729) -- 0:00:09
344500 -- [-537.615] (-538.860) (-538.618) (-540.647) * [-538.197] (-541.793) (-539.107) (-543.412) -- 0:00:09
345000 -- (-537.101) (-538.221) [-539.994] (-541.079) * [-542.849] (-538.891) (-537.614) (-539.439) -- 0:00:09
Average standard deviation of split frequencies: 0.014381
345500 -- (-537.042) (-539.214) [-538.763] (-540.402) * (-539.908) (-537.399) [-539.355] (-539.115) -- 0:00:09
346000 -- (-540.660) (-544.862) [-540.050] (-537.685) * (-538.685) (-539.901) (-539.344) [-539.522] -- 0:00:09
346500 -- (-538.073) [-539.352] (-542.587) (-538.811) * (-544.528) [-539.121] (-539.178) (-537.492) -- 0:00:09
347000 -- [-538.525] (-537.757) (-538.489) (-540.391) * (-542.132) (-538.618) [-539.131] (-537.754) -- 0:00:09
347500 -- (-537.058) (-537.925) [-539.854] (-539.201) * (-542.763) (-538.704) (-541.138) [-538.473] -- 0:00:09
348000 -- [-538.801] (-537.729) (-537.878) (-538.859) * (-539.081) (-537.330) [-538.559] (-538.564) -- 0:00:09
348500 -- (-537.206) [-538.183] (-537.408) (-540.011) * (-537.282) [-540.612] (-538.382) (-543.681) -- 0:00:09
349000 -- (-538.294) (-537.780) (-539.985) [-537.453] * (-537.473) [-539.041] (-539.504) (-538.284) -- 0:00:09
349500 -- [-538.072] (-538.815) (-537.213) (-539.789) * (-538.401) (-541.175) (-538.805) [-537.739] -- 0:00:09
350000 -- (-537.950) (-541.630) (-538.804) [-544.446] * (-541.502) [-539.291] (-540.283) (-537.187) -- 0:00:09
Average standard deviation of split frequencies: 0.013592
350500 -- [-537.896] (-540.867) (-538.455) (-539.322) * (-541.121) (-542.236) (-540.056) [-537.316] -- 0:00:08
351000 -- (-538.596) [-537.110] (-540.102) (-543.844) * [-538.461] (-539.434) (-537.297) (-537.339) -- 0:00:08
351500 -- (-537.717) [-540.330] (-537.522) (-541.072) * [-542.709] (-537.620) (-538.009) (-539.708) -- 0:00:08
352000 -- (-537.419) (-543.641) [-539.876] (-541.683) * (-541.090) (-537.372) [-537.201] (-540.059) -- 0:00:08
352500 -- [-540.190] (-542.325) (-541.208) (-541.485) * (-540.151) (-538.444) [-536.972] (-537.636) -- 0:00:08
353000 -- (-539.438) (-536.997) (-537.579) [-540.064] * (-542.361) [-539.768] (-538.747) (-537.816) -- 0:00:08
353500 -- (-538.013) (-537.112) (-538.857) [-539.296] * [-540.894] (-538.143) (-539.984) (-540.835) -- 0:00:08
354000 -- [-541.576] (-542.348) (-539.253) (-542.304) * (-539.457) (-542.498) (-539.570) [-538.599] -- 0:00:08
354500 -- (-538.075) (-540.997) (-538.359) [-538.037] * (-539.764) (-539.096) [-537.529] (-538.362) -- 0:00:08
355000 -- (-540.013) (-542.469) [-539.232] (-538.283) * (-538.338) (-540.160) [-538.650] (-547.219) -- 0:00:08
Average standard deviation of split frequencies: 0.014410
355500 -- (-540.204) (-540.147) (-538.344) [-540.118] * (-539.514) (-537.338) (-540.109) [-540.540] -- 0:00:08
356000 -- (-539.154) (-542.556) (-537.206) [-541.375] * (-540.567) (-539.543) [-539.720] (-538.304) -- 0:00:08
356500 -- (-538.110) (-540.001) (-538.936) [-538.820] * [-537.486] (-539.339) (-538.420) (-538.468) -- 0:00:08
357000 -- (-538.984) (-539.292) [-539.634] (-539.177) * (-538.392) (-539.352) (-537.234) [-539.069] -- 0:00:08
357500 -- (-538.731) [-538.007] (-542.037) (-538.025) * (-537.669) (-538.755) (-541.737) [-544.914] -- 0:00:08
358000 -- (-539.095) [-542.759] (-538.354) (-542.719) * [-537.746] (-538.966) (-541.636) (-538.199) -- 0:00:08
358500 -- (-537.756) [-540.648] (-547.812) (-550.117) * (-540.066) (-538.481) [-542.239] (-539.893) -- 0:00:08
359000 -- (-540.661) (-539.083) (-545.548) [-541.016] * [-543.888] (-543.554) (-537.610) (-537.219) -- 0:00:08
359500 -- (-539.142) (-539.369) (-542.036) [-540.821] * (-538.810) [-538.299] (-539.434) (-541.497) -- 0:00:08
360000 -- [-537.643] (-539.352) (-538.256) (-538.873) * (-538.630) (-538.330) (-539.011) [-538.336] -- 0:00:08
Average standard deviation of split frequencies: 0.013609
360500 -- (-539.588) [-540.951] (-538.899) (-540.496) * [-538.445] (-539.288) (-537.564) (-538.993) -- 0:00:08
361000 -- [-536.820] (-537.626) (-538.483) (-537.566) * (-540.870) (-538.211) (-536.726) [-538.108] -- 0:00:08
361500 -- (-536.601) [-538.678] (-537.593) (-538.474) * (-540.424) [-539.933] (-541.461) (-540.451) -- 0:00:08
362000 -- [-541.373] (-542.680) (-539.987) (-538.235) * (-538.114) (-540.278) [-540.555] (-539.224) -- 0:00:08
362500 -- (-537.272) (-540.552) [-536.638] (-538.328) * (-537.634) (-543.054) (-544.561) [-537.901] -- 0:00:08
363000 -- [-539.303] (-538.586) (-537.341) (-540.265) * (-538.668) (-537.655) (-538.723) [-537.215] -- 0:00:08
363500 -- [-538.650] (-537.158) (-539.045) (-538.342) * [-538.244] (-537.620) (-537.239) (-539.484) -- 0:00:08
364000 -- (-540.430) (-540.080) (-538.517) [-540.736] * (-538.656) (-537.680) [-542.871] (-538.190) -- 0:00:08
364500 -- (-538.615) (-538.461) [-539.482] (-545.180) * [-540.573] (-540.217) (-539.834) (-538.709) -- 0:00:08
365000 -- (-537.737) (-539.566) (-536.968) [-541.864] * (-537.519) (-539.823) [-538.142] (-541.007) -- 0:00:08
Average standard deviation of split frequencies: 0.014319
365500 -- (-537.067) [-538.656] (-538.482) (-540.272) * (-542.458) (-541.403) (-537.649) [-542.126] -- 0:00:08
366000 -- [-540.515] (-537.433) (-541.653) (-542.726) * (-537.349) (-541.638) (-538.590) [-542.844] -- 0:00:08
366500 -- [-537.253] (-539.571) (-538.910) (-537.488) * (-543.153) (-542.258) [-538.439] (-541.537) -- 0:00:08
367000 -- (-542.062) (-543.356) [-537.820] (-538.458) * (-540.968) (-539.987) (-539.289) [-539.503] -- 0:00:07
367500 -- (-541.486) (-537.622) [-537.237] (-540.394) * (-540.234) (-537.722) (-540.039) [-538.710] -- 0:00:07
368000 -- (-537.011) (-539.037) [-537.946] (-539.305) * [-538.718] (-537.765) (-543.108) (-538.020) -- 0:00:07
368500 -- (-538.080) (-539.943) [-538.151] (-538.116) * [-539.991] (-537.946) (-543.248) (-538.337) -- 0:00:07
369000 -- [-537.731] (-537.137) (-540.122) (-541.763) * (-538.340) [-540.150] (-540.286) (-542.601) -- 0:00:07
369500 -- (-537.378) (-538.248) [-537.833] (-539.275) * (-537.628) [-540.660] (-538.223) (-540.395) -- 0:00:07
370000 -- (-540.828) [-541.251] (-538.716) (-541.326) * [-538.371] (-542.678) (-544.192) (-540.154) -- 0:00:07
Average standard deviation of split frequencies: 0.015037
370500 -- (-538.982) (-539.795) [-538.563] (-542.165) * [-540.323] (-539.325) (-538.865) (-540.433) -- 0:00:07
371000 -- (-538.344) (-539.786) [-537.686] (-540.297) * (-540.240) (-541.192) (-539.013) [-538.078] -- 0:00:07
371500 -- (-539.735) [-539.528] (-540.715) (-539.733) * (-539.271) (-537.922) (-537.149) [-539.201] -- 0:00:07
372000 -- (-538.543) (-544.713) (-539.722) [-537.286] * (-544.559) (-536.548) (-538.595) [-540.182] -- 0:00:07
372500 -- [-537.941] (-537.744) (-542.993) (-541.406) * (-543.562) [-536.770] (-539.377) (-539.470) -- 0:00:07
373000 -- (-538.329) (-537.888) [-537.273] (-538.347) * (-547.077) (-537.068) (-539.691) [-538.067] -- 0:00:07
373500 -- (-537.692) (-536.959) (-538.537) [-537.911] * [-542.166] (-537.124) (-537.808) (-537.596) -- 0:00:07
374000 -- (-539.568) (-539.242) (-540.807) [-537.392] * [-537.780] (-539.187) (-538.308) (-540.304) -- 0:00:07
374500 -- (-539.110) [-537.556] (-543.312) (-538.971) * (-538.402) [-539.644] (-538.273) (-538.044) -- 0:00:07
375000 -- [-539.959] (-538.592) (-539.722) (-543.685) * (-538.840) [-538.042] (-544.744) (-538.186) -- 0:00:07
Average standard deviation of split frequencies: 0.015782
375500 -- [-536.910] (-540.714) (-538.424) (-540.766) * (-539.371) (-538.423) (-539.133) [-537.717] -- 0:00:07
376000 -- (-538.834) [-538.676] (-537.520) (-537.721) * (-540.617) [-538.545] (-541.836) (-540.216) -- 0:00:07
376500 -- (-541.844) [-538.711] (-537.102) (-536.931) * (-539.930) [-540.644] (-539.778) (-539.435) -- 0:00:07
377000 -- (-540.130) [-538.631] (-539.226) (-540.319) * (-539.148) [-539.053] (-539.363) (-540.179) -- 0:00:07
377500 -- (-543.459) (-537.131) (-539.756) [-537.551] * (-539.340) (-539.449) [-541.282] (-539.355) -- 0:00:07
378000 -- (-538.705) [-538.440] (-537.901) (-539.422) * (-541.252) (-538.330) [-539.828] (-540.713) -- 0:00:07
378500 -- [-538.547] (-537.067) (-544.525) (-537.505) * (-538.794) [-537.444] (-537.450) (-539.190) -- 0:00:07
379000 -- (-539.281) [-537.497] (-542.292) (-541.611) * (-540.226) (-538.230) [-539.091] (-539.273) -- 0:00:07
379500 -- (-537.995) (-537.640) (-538.433) [-539.294] * [-541.633] (-537.658) (-543.304) (-545.799) -- 0:00:07
380000 -- (-542.450) (-540.552) (-539.154) [-537.250] * (-538.852) (-542.131) [-540.011] (-546.256) -- 0:00:07
Average standard deviation of split frequencies: 0.015589
380500 -- [-537.795] (-540.466) (-537.319) (-539.475) * (-538.364) (-541.953) [-540.473] (-538.811) -- 0:00:07
381000 -- (-538.326) [-538.082] (-537.691) (-537.570) * (-544.489) [-542.045] (-538.093) (-539.083) -- 0:00:07
381500 -- [-539.478] (-537.048) (-539.179) (-536.898) * (-539.198) (-541.127) [-539.292] (-539.479) -- 0:00:07
382000 -- (-537.822) (-540.876) [-537.975] (-541.185) * (-537.979) (-539.123) [-536.849] (-538.384) -- 0:00:07
382500 -- (-538.761) [-538.695] (-539.152) (-542.865) * (-538.482) (-537.817) [-537.178] (-537.010) -- 0:00:07
383000 -- (-540.534) (-538.741) (-537.590) [-538.423] * [-538.129] (-538.874) (-537.751) (-538.264) -- 0:00:07
383500 -- [-539.618] (-539.236) (-540.022) (-541.716) * (-540.625) [-538.406] (-539.264) (-539.150) -- 0:00:06
384000 -- (-537.786) [-539.496] (-537.656) (-537.428) * (-536.810) [-538.470] (-541.825) (-539.310) -- 0:00:06
384500 -- (-537.843) [-536.684] (-539.105) (-538.191) * (-540.888) [-539.224] (-538.735) (-539.071) -- 0:00:06
385000 -- (-544.014) (-542.988) (-542.945) [-537.366] * [-537.255] (-539.273) (-539.926) (-538.881) -- 0:00:06
Average standard deviation of split frequencies: 0.014871
385500 -- (-538.496) [-538.556] (-540.642) (-539.312) * (-539.446) (-542.162) (-542.290) [-541.129] -- 0:00:06
386000 -- (-537.875) (-540.043) (-538.520) [-540.602] * [-538.080] (-542.684) (-538.783) (-539.668) -- 0:00:06
386500 -- (-537.700) (-539.061) [-540.808] (-538.850) * [-537.563] (-539.067) (-538.470) (-537.914) -- 0:00:06
387000 -- (-541.375) [-537.739] (-541.958) (-538.569) * (-539.149) [-538.479] (-538.237) (-537.314) -- 0:00:06
387500 -- (-540.484) (-539.879) (-538.161) [-538.548] * (-539.395) (-538.488) (-542.911) [-537.559] -- 0:00:06
388000 -- (-540.435) (-537.502) (-537.272) [-537.127] * (-537.700) (-543.311) (-538.109) [-542.889] -- 0:00:06
388500 -- (-542.814) (-538.794) [-538.433] (-539.144) * (-537.868) (-541.635) [-538.223] (-538.291) -- 0:00:06
389000 -- [-538.783] (-537.370) (-538.213) (-542.343) * (-538.710) (-540.401) (-537.377) [-537.058] -- 0:00:06
389500 -- [-541.509] (-539.190) (-538.364) (-548.736) * [-539.801] (-538.512) (-537.402) (-539.773) -- 0:00:06
390000 -- (-537.507) (-537.853) [-538.438] (-540.928) * (-537.984) (-538.722) (-536.908) [-537.125] -- 0:00:06
Average standard deviation of split frequencies: 0.015190
390500 -- (-539.761) (-538.366) (-537.371) [-538.136] * [-538.600] (-539.926) (-538.776) (-539.160) -- 0:00:06
391000 -- (-538.371) (-539.645) [-537.588] (-538.860) * (-538.884) (-538.753) (-538.876) [-538.331] -- 0:00:06
391500 -- [-536.767] (-537.415) (-541.198) (-537.367) * (-543.497) (-539.754) [-539.112] (-541.070) -- 0:00:06
392000 -- (-539.816) (-538.415) (-539.895) [-537.306] * (-538.796) (-537.799) (-538.733) [-538.245] -- 0:00:06
392500 -- (-541.924) (-537.087) (-545.110) [-539.509] * (-537.725) (-537.494) [-538.047] (-540.503) -- 0:00:06
393000 -- (-539.584) (-540.011) (-544.705) [-538.774] * (-537.430) (-539.322) [-540.983] (-540.138) -- 0:00:06
393500 -- (-538.099) (-539.113) (-545.021) [-538.134] * (-538.262) (-539.804) (-539.626) [-537.277] -- 0:00:06
394000 -- (-537.955) (-538.429) (-539.556) [-540.102] * (-537.745) [-537.209] (-542.525) (-538.501) -- 0:00:06
394500 -- (-538.743) [-537.661] (-537.900) (-536.847) * (-538.184) (-541.524) (-539.571) [-537.602] -- 0:00:06
395000 -- (-538.107) (-541.759) (-539.234) [-537.766] * (-539.169) (-540.434) [-536.987] (-540.642) -- 0:00:06
Average standard deviation of split frequencies: 0.015896
395500 -- (-541.942) (-546.231) [-536.653] (-540.030) * (-538.837) (-537.260) [-539.592] (-538.956) -- 0:00:06
396000 -- (-539.732) (-541.913) [-541.430] (-537.676) * (-540.008) [-536.977] (-537.905) (-540.455) -- 0:00:06
396500 -- (-542.036) (-538.930) (-538.851) [-538.451] * (-538.979) (-543.752) (-537.965) [-538.654] -- 0:00:06
397000 -- (-538.756) (-536.783) (-539.089) [-538.213] * [-539.677] (-540.180) (-540.689) (-536.893) -- 0:00:06
397500 -- (-537.511) (-536.996) [-539.951] (-539.851) * [-537.218] (-538.321) (-540.351) (-540.449) -- 0:00:06
398000 -- (-538.548) [-539.007] (-540.070) (-541.042) * (-538.310) [-537.035] (-538.534) (-543.901) -- 0:00:06
398500 -- [-539.950] (-537.270) (-539.206) (-539.242) * [-542.671] (-540.301) (-538.498) (-539.867) -- 0:00:06
399000 -- (-538.455) (-539.594) (-536.780) [-538.333] * (-540.557) (-539.493) [-541.228] (-542.159) -- 0:00:06
399500 -- [-540.794] (-540.886) (-539.463) (-539.798) * [-537.735] (-539.505) (-538.897) (-538.520) -- 0:00:06
400000 -- (-543.465) (-539.158) [-539.229] (-538.942) * (-540.268) [-538.987] (-540.292) (-538.837) -- 0:00:06
Average standard deviation of split frequencies: 0.016264
400500 -- (-539.282) (-538.089) [-538.494] (-541.590) * (-538.217) [-538.316] (-539.025) (-538.816) -- 0:00:05
401000 -- (-539.778) (-542.334) [-542.274] (-542.174) * (-541.354) (-538.835) (-538.503) [-540.215] -- 0:00:05
401500 -- (-538.376) [-538.263] (-540.670) (-537.104) * [-538.792] (-539.731) (-539.872) (-541.949) -- 0:00:05
402000 -- (-539.724) (-538.735) (-539.137) [-537.966] * [-539.906] (-539.579) (-538.017) (-538.215) -- 0:00:05
402500 -- (-544.455) (-538.396) [-540.971] (-537.571) * (-538.156) (-538.969) (-538.058) [-537.668] -- 0:00:05
403000 -- (-538.765) [-538.406] (-540.731) (-538.206) * (-538.157) (-537.020) (-536.843) [-538.320] -- 0:00:05
403500 -- (-538.084) (-541.331) (-541.495) [-539.328] * [-539.619] (-539.188) (-538.602) (-538.039) -- 0:00:05
404000 -- (-538.102) (-541.548) [-538.524] (-538.667) * (-540.656) (-538.402) (-537.676) [-540.518] -- 0:00:05
404500 -- (-539.155) [-539.081] (-538.733) (-536.688) * (-538.062) (-537.918) (-539.322) [-537.881] -- 0:00:05
405000 -- (-540.301) (-537.741) [-537.209] (-536.576) * (-539.247) (-538.259) (-540.468) [-537.975] -- 0:00:05
Average standard deviation of split frequencies: 0.016187
405500 -- (-537.551) (-538.601) (-538.209) [-536.574] * [-538.191] (-538.986) (-541.033) (-544.006) -- 0:00:05
406000 -- (-538.925) (-537.757) [-539.975] (-536.577) * (-539.896) (-538.305) (-538.410) [-539.405] -- 0:00:05
406500 -- [-539.816] (-538.118) (-538.921) (-538.354) * [-540.373] (-536.855) (-539.467) (-540.314) -- 0:00:05
407000 -- (-541.365) (-539.610) (-539.003) [-539.171] * [-538.219] (-538.810) (-538.446) (-539.854) -- 0:00:05
407500 -- (-538.304) [-541.023] (-541.434) (-538.183) * (-539.790) (-539.605) [-537.297] (-540.222) -- 0:00:05
408000 -- (-541.254) (-543.881) (-538.751) [-540.211] * (-539.900) [-539.996] (-537.650) (-538.918) -- 0:00:05
408500 -- [-542.426] (-539.998) (-538.761) (-537.817) * (-541.357) [-538.839] (-539.945) (-539.458) -- 0:00:05
409000 -- (-537.288) (-541.920) (-538.269) [-538.013] * (-538.972) (-538.608) [-539.253] (-537.580) -- 0:00:05
409500 -- (-540.627) (-540.892) (-538.744) [-537.714] * (-537.462) [-540.892] (-541.169) (-539.420) -- 0:00:05
410000 -- (-542.252) [-538.034] (-538.119) (-537.066) * (-543.645) (-537.503) [-539.378] (-537.094) -- 0:00:05
Average standard deviation of split frequencies: 0.016678
410500 -- (-539.371) (-537.454) [-537.341] (-539.735) * (-542.494) [-539.792] (-538.861) (-539.416) -- 0:00:05
411000 -- (-538.032) (-537.550) (-539.733) [-538.323] * (-539.426) (-541.205) (-537.461) [-539.508] -- 0:00:05
411500 -- (-539.461) (-544.501) [-540.169] (-540.600) * (-538.818) (-536.791) [-538.500] (-537.738) -- 0:00:05
412000 -- (-538.596) (-539.789) (-541.595) [-539.260] * [-541.138] (-538.712) (-538.956) (-537.777) -- 0:00:05
412500 -- (-538.419) [-537.709] (-538.941) (-540.710) * (-538.218) (-537.941) [-537.421] (-538.384) -- 0:00:05
413000 -- (-538.732) (-537.290) [-537.225] (-540.452) * (-539.917) [-539.044] (-541.596) (-537.924) -- 0:00:05
413500 -- (-539.776) (-537.263) (-537.741) [-537.685] * (-539.031) (-538.676) (-537.767) [-539.533] -- 0:00:05
414000 -- (-540.663) (-540.452) [-540.021] (-537.131) * (-540.019) (-540.423) [-536.641] (-537.670) -- 0:00:05
414500 -- [-541.668] (-537.660) (-542.360) (-540.724) * [-539.811] (-539.197) (-536.571) (-538.599) -- 0:00:05
415000 -- (-538.372) (-539.934) (-539.878) [-541.285] * (-538.200) (-539.851) [-538.375] (-537.902) -- 0:00:05
Average standard deviation of split frequencies: 0.016131
415500 -- (-537.283) (-542.237) [-537.864] (-539.321) * [-541.456] (-537.456) (-537.415) (-538.913) -- 0:00:05
416000 -- (-539.319) (-537.424) (-536.796) [-542.430] * [-543.180] (-538.564) (-538.660) (-541.731) -- 0:00:05
416500 -- (-542.368) (-538.371) (-541.339) [-541.349] * (-538.104) (-539.853) (-536.642) [-540.333] -- 0:00:05
417000 -- [-540.379] (-537.907) (-537.935) (-541.871) * (-537.576) (-537.133) (-540.731) [-543.657] -- 0:00:04
417500 -- [-537.047] (-539.844) (-541.523) (-537.366) * [-537.574] (-539.624) (-537.765) (-539.885) -- 0:00:04
418000 -- (-537.466) (-537.273) (-538.864) [-541.472] * (-538.580) (-539.049) (-537.944) [-536.502] -- 0:00:04
418500 -- (-537.300) (-538.636) [-541.261] (-540.479) * [-538.467] (-539.938) (-538.799) (-538.687) -- 0:00:04
419000 -- (-539.110) (-538.599) [-537.535] (-537.929) * (-538.379) (-539.261) [-539.435] (-538.538) -- 0:00:04
419500 -- [-539.427] (-542.186) (-536.809) (-538.230) * (-539.511) [-541.677] (-540.296) (-540.701) -- 0:00:04
420000 -- (-536.745) [-542.302] (-538.816) (-537.317) * (-538.335) [-539.592] (-538.284) (-538.419) -- 0:00:04
Average standard deviation of split frequencies: 0.015029
420500 -- (-536.639) (-538.768) (-539.552) [-539.894] * (-540.792) [-537.702] (-540.067) (-539.838) -- 0:00:04
421000 -- (-544.321) (-539.673) (-540.174) [-539.460] * (-539.590) (-537.832) [-538.286] (-540.221) -- 0:00:04
421500 -- (-542.842) (-537.711) (-539.046) [-539.201] * (-537.639) (-538.822) [-538.872] (-537.745) -- 0:00:04
422000 -- [-539.128] (-537.683) (-538.047) (-537.234) * (-537.975) (-543.002) (-538.126) [-538.310] -- 0:00:04
422500 -- [-540.660] (-537.965) (-539.981) (-537.410) * (-538.476) [-538.641] (-539.266) (-540.743) -- 0:00:04
423000 -- (-542.097) (-540.365) [-537.264] (-539.464) * (-538.994) [-537.880] (-539.326) (-536.813) -- 0:00:04
423500 -- [-538.229] (-537.878) (-537.444) (-536.779) * (-537.694) (-539.532) [-540.105] (-539.232) -- 0:00:04
424000 -- (-537.391) (-541.941) (-537.651) [-538.022] * [-537.412] (-540.049) (-539.789) (-539.056) -- 0:00:04
424500 -- [-538.116] (-539.515) (-538.729) (-536.919) * (-537.712) [-545.631] (-539.108) (-539.213) -- 0:00:04
425000 -- (-539.476) [-537.431] (-540.635) (-538.715) * (-538.068) (-540.853) [-541.122] (-538.546) -- 0:00:04
Average standard deviation of split frequencies: 0.014841
425500 -- [-540.540] (-540.090) (-537.754) (-539.272) * [-537.741] (-538.136) (-537.980) (-544.988) -- 0:00:04
426000 -- (-537.722) [-541.440] (-539.888) (-541.966) * (-543.370) (-538.813) [-538.039] (-541.564) -- 0:00:04
426500 -- [-539.511] (-539.469) (-540.483) (-542.080) * [-539.630] (-537.691) (-538.151) (-538.970) -- 0:00:04
427000 -- [-537.263] (-537.920) (-540.137) (-539.013) * (-545.825) (-536.791) (-536.962) [-543.523] -- 0:00:04
427500 -- (-539.901) (-536.850) [-539.084] (-537.816) * (-539.231) [-538.862] (-537.650) (-542.123) -- 0:00:04
428000 -- [-537.812] (-538.858) (-538.482) (-538.995) * (-536.935) (-538.402) (-537.004) [-542.263] -- 0:00:04
428500 -- [-537.252] (-538.926) (-537.449) (-540.073) * (-540.476) (-538.356) (-537.316) [-541.019] -- 0:00:04
429000 -- (-538.599) [-538.182] (-538.519) (-542.659) * (-537.673) [-537.944] (-540.003) (-543.070) -- 0:00:04
429500 -- (-539.557) [-543.309] (-540.017) (-539.051) * (-538.667) [-537.383] (-539.918) (-539.619) -- 0:00:04
430000 -- (-538.223) [-538.581] (-538.009) (-538.038) * [-538.440] (-539.375) (-537.879) (-540.816) -- 0:00:04
Average standard deviation of split frequencies: 0.015002
430500 -- [-538.653] (-542.266) (-539.393) (-539.424) * (-536.801) (-539.726) [-539.158] (-543.025) -- 0:00:04
431000 -- (-539.163) (-540.079) (-540.319) [-537.101] * [-537.345] (-539.252) (-538.611) (-537.987) -- 0:00:04
431500 -- (-538.002) (-537.789) [-539.603] (-537.497) * (-536.765) (-542.293) [-540.622] (-540.766) -- 0:00:04
432000 -- (-539.903) (-540.373) [-538.648] (-536.734) * [-537.396] (-539.883) (-539.036) (-540.215) -- 0:00:04
432500 -- [-538.930] (-539.757) (-538.011) (-543.062) * (-540.408) [-538.437] (-537.589) (-539.715) -- 0:00:04
433000 -- (-543.825) (-537.665) [-538.922] (-540.428) * (-539.283) (-543.117) (-537.403) [-539.003] -- 0:00:04
433500 -- (-541.919) (-542.152) (-540.623) [-538.616] * [-538.316] (-537.741) (-537.404) (-544.930) -- 0:00:03
434000 -- (-541.014) (-538.194) [-536.981] (-541.165) * (-543.092) (-536.919) [-538.767] (-541.139) -- 0:00:03
434500 -- [-540.323] (-539.494) (-538.506) (-537.571) * (-538.099) (-537.085) [-537.556] (-537.199) -- 0:00:03
435000 -- (-539.237) [-538.493] (-539.739) (-544.533) * (-540.103) [-537.070] (-539.719) (-537.469) -- 0:00:03
Average standard deviation of split frequencies: 0.014501
435500 -- (-536.905) (-538.400) [-539.125] (-542.368) * (-537.262) [-538.235] (-540.402) (-537.489) -- 0:00:03
436000 -- [-539.596] (-542.307) (-538.270) (-542.898) * [-539.352] (-539.977) (-538.283) (-538.034) -- 0:00:03
436500 -- (-537.904) [-540.528] (-541.013) (-537.393) * (-538.173) (-538.495) (-538.172) [-539.456] -- 0:00:03
437000 -- (-540.137) [-536.722] (-540.174) (-539.594) * [-539.845] (-537.605) (-540.625) (-537.401) -- 0:00:03
437500 -- [-537.933] (-540.668) (-538.553) (-540.950) * (-538.023) (-541.084) [-538.147] (-537.416) -- 0:00:03
438000 -- (-538.453) (-542.450) [-539.372] (-540.985) * (-538.345) (-539.221) (-538.961) [-537.989] -- 0:00:03
438500 -- (-540.686) [-536.571] (-537.500) (-542.398) * [-537.129] (-542.803) (-539.280) (-537.150) -- 0:00:03
439000 -- (-537.810) (-537.746) [-538.280] (-539.763) * (-543.774) (-538.058) [-539.194] (-538.005) -- 0:00:03
439500 -- (-541.905) [-537.117] (-539.575) (-540.917) * (-537.935) [-537.218] (-539.938) (-537.443) -- 0:00:03
440000 -- (-539.623) (-538.152) [-542.557] (-537.070) * (-540.238) (-538.877) (-538.322) [-537.072] -- 0:00:03
Average standard deviation of split frequencies: 0.013907
440500 -- (-538.805) (-540.913) [-537.434] (-537.541) * (-540.324) (-537.520) [-539.667] (-537.008) -- 0:00:03
441000 -- (-537.795) (-540.291) (-546.708) [-542.280] * (-538.604) (-539.453) (-538.016) [-538.979] -- 0:00:03
441500 -- (-539.888) (-538.681) [-538.759] (-549.813) * [-538.014] (-540.786) (-539.955) (-541.543) -- 0:00:03
442000 -- (-537.366) (-537.961) [-537.836] (-538.269) * (-541.107) (-538.121) [-538.587] (-539.137) -- 0:00:03
442500 -- (-538.311) (-539.045) (-540.857) [-538.625] * (-540.952) (-538.008) (-537.489) [-538.607] -- 0:00:03
443000 -- (-538.312) (-537.610) (-537.389) [-538.759] * (-542.998) [-539.728] (-536.976) (-541.383) -- 0:00:03
443500 -- (-538.102) [-537.206] (-542.218) (-543.058) * (-539.998) (-538.728) (-541.552) [-541.558] -- 0:00:03
444000 -- [-538.448] (-537.476) (-542.529) (-542.166) * (-539.638) (-537.980) [-537.888] (-538.002) -- 0:00:03
444500 -- (-543.416) (-546.998) (-539.226) [-538.311] * (-537.811) [-537.987] (-542.583) (-536.721) -- 0:00:03
445000 -- (-540.314) (-544.241) (-542.694) [-537.173] * (-536.599) [-538.740] (-538.638) (-541.169) -- 0:00:03
Average standard deviation of split frequencies: 0.013740
445500 -- [-542.619] (-540.983) (-537.556) (-542.711) * (-540.138) (-545.151) [-537.559] (-537.853) -- 0:00:03
446000 -- [-538.198] (-536.901) (-539.813) (-537.857) * (-539.337) (-540.308) (-539.319) [-536.775] -- 0:00:03
446500 -- (-540.148) [-538.541] (-540.218) (-537.952) * (-540.593) (-539.448) [-539.825] (-537.130) -- 0:00:03
447000 -- (-544.549) (-538.541) [-541.855] (-538.028) * (-536.982) (-536.908) (-537.560) [-537.695] -- 0:00:03
447500 -- (-537.006) (-536.838) (-539.152) [-536.806] * (-541.248) (-539.083) [-536.799] (-537.590) -- 0:00:03
448000 -- (-537.034) (-537.798) [-538.963] (-537.754) * [-538.842] (-537.853) (-537.757) (-538.069) -- 0:00:03
448500 -- (-537.455) (-538.632) [-538.369] (-538.297) * (-538.304) [-538.978] (-541.255) (-537.627) -- 0:00:03
449000 -- [-536.655] (-542.277) (-537.712) (-540.696) * [-536.893] (-538.175) (-536.707) (-538.429) -- 0:00:03
449500 -- (-537.964) (-542.994) [-539.452] (-539.956) * [-537.262] (-539.162) (-541.045) (-539.869) -- 0:00:03
450000 -- (-539.256) (-541.633) (-538.395) [-537.166] * (-540.193) [-541.567] (-541.117) (-540.462) -- 0:00:03
Average standard deviation of split frequencies: 0.013598
450500 -- (-537.092) (-538.818) [-539.305] (-537.591) * [-537.832] (-539.085) (-540.393) (-541.651) -- 0:00:02
451000 -- (-540.027) [-539.306] (-538.129) (-537.277) * (-537.440) (-537.801) (-538.158) [-538.054] -- 0:00:02
451500 -- (-538.986) [-538.882] (-539.455) (-539.241) * (-540.174) (-537.987) [-539.547] (-537.160) -- 0:00:02
452000 -- [-538.560] (-541.663) (-539.331) (-539.402) * [-540.483] (-539.257) (-543.495) (-539.145) -- 0:00:02
452500 -- (-537.858) (-542.494) [-538.182] (-538.184) * [-539.389] (-541.717) (-539.967) (-536.814) -- 0:00:02
453000 -- (-540.164) (-541.721) (-538.383) [-537.625] * (-537.989) (-543.523) (-540.576) [-537.819] -- 0:00:02
453500 -- [-538.250] (-538.382) (-538.048) (-537.810) * (-537.390) (-538.357) (-540.172) [-537.514] -- 0:00:02
454000 -- (-540.739) (-537.476) [-537.605] (-537.730) * [-536.789] (-540.842) (-541.566) (-539.315) -- 0:00:02
454500 -- (-541.539) [-540.078] (-538.847) (-540.486) * (-540.107) [-542.302] (-546.942) (-537.992) -- 0:00:02
455000 -- (-537.747) (-541.659) [-540.054] (-538.381) * (-539.282) (-537.785) (-544.880) [-539.137] -- 0:00:02
Average standard deviation of split frequencies: 0.013318
455500 -- (-537.436) [-539.932] (-540.047) (-538.209) * [-537.896] (-539.532) (-537.171) (-538.922) -- 0:00:02
456000 -- (-538.238) [-537.126] (-540.451) (-538.508) * (-537.900) [-539.671] (-539.220) (-541.074) -- 0:00:02
456500 -- [-539.069] (-538.320) (-539.471) (-538.120) * (-537.552) (-539.775) (-537.247) [-537.756] -- 0:00:02
457000 -- (-539.020) (-536.894) [-539.256] (-541.635) * (-541.732) (-539.736) [-537.583] (-541.237) -- 0:00:02
457500 -- [-538.430] (-539.051) (-538.238) (-539.698) * (-537.996) (-542.099) [-539.546] (-540.056) -- 0:00:02
458000 -- (-539.642) [-538.220] (-546.355) (-539.618) * [-537.061] (-537.905) (-542.026) (-542.807) -- 0:00:02
458500 -- (-538.655) (-542.092) [-539.134] (-538.664) * (-537.786) [-538.059] (-538.462) (-540.403) -- 0:00:02
459000 -- (-540.419) (-540.936) [-538.067] (-539.111) * (-541.409) [-540.398] (-539.214) (-540.919) -- 0:00:02
459500 -- (-538.574) (-538.658) (-538.362) [-537.920] * [-537.119] (-540.034) (-538.663) (-537.940) -- 0:00:02
460000 -- (-539.781) [-538.557] (-540.597) (-540.612) * [-539.376] (-537.491) (-538.478) (-537.773) -- 0:00:02
Average standard deviation of split frequencies: 0.013484
460500 -- (-538.760) [-539.766] (-542.699) (-540.293) * (-537.987) (-538.595) [-538.393] (-539.074) -- 0:00:02
461000 -- [-537.327] (-537.459) (-540.769) (-537.730) * (-542.979) (-538.653) (-542.061) [-538.039] -- 0:00:02
461500 -- (-540.250) [-538.508] (-543.031) (-538.965) * (-539.829) (-537.533) [-537.659] (-538.847) -- 0:00:02
462000 -- (-542.674) (-537.718) (-542.438) [-538.658] * (-539.226) [-538.855] (-539.796) (-538.656) -- 0:00:02
462500 -- (-543.207) [-539.884] (-540.638) (-541.132) * [-539.264] (-538.153) (-538.088) (-537.417) -- 0:00:02
463000 -- (-543.173) [-536.978] (-540.345) (-539.965) * [-537.361] (-539.169) (-539.105) (-537.855) -- 0:00:02
463500 -- (-540.791) (-536.984) [-537.762] (-539.626) * [-540.469] (-537.660) (-538.837) (-541.226) -- 0:00:02
464000 -- (-539.789) [-539.606] (-540.216) (-541.158) * (-538.133) (-537.900) (-539.747) [-537.776] -- 0:00:02
464500 -- (-537.485) (-540.163) [-542.960] (-537.865) * (-539.148) (-541.430) [-538.442] (-539.004) -- 0:00:02
465000 -- (-538.600) [-539.219] (-538.105) (-538.373) * [-538.522] (-537.815) (-537.147) (-537.728) -- 0:00:02
Average standard deviation of split frequencies: 0.012794
465500 -- (-540.371) (-540.132) [-541.031] (-538.133) * [-538.939] (-538.194) (-538.246) (-537.008) -- 0:00:02
466000 -- (-538.487) [-537.365] (-538.120) (-537.886) * (-538.187) (-541.322) (-538.618) [-538.074] -- 0:00:02
466500 -- [-538.228] (-542.672) (-539.902) (-538.848) * (-536.834) (-536.931) (-537.662) [-537.520] -- 0:00:02
467000 -- (-540.214) [-538.192] (-537.613) (-541.981) * [-541.186] (-537.237) (-539.879) (-539.135) -- 0:00:01
467500 -- [-538.873] (-537.990) (-537.576) (-540.076) * (-541.734) (-538.150) (-538.613) [-539.204] -- 0:00:01
468000 -- (-538.255) (-537.563) (-538.669) [-539.449] * (-539.686) (-539.332) (-537.588) [-541.081] -- 0:00:01
468500 -- [-538.430] (-537.465) (-539.700) (-537.258) * (-539.344) (-537.966) [-538.908] (-539.976) -- 0:00:01
469000 -- [-541.504] (-541.285) (-539.394) (-539.398) * (-538.546) [-538.227] (-538.282) (-545.581) -- 0:00:01
469500 -- (-537.064) (-539.290) (-540.832) [-539.782] * (-542.111) (-536.872) [-543.595] (-537.576) -- 0:00:01
470000 -- [-542.129] (-539.813) (-538.515) (-538.926) * [-539.402] (-536.914) (-537.843) (-537.817) -- 0:00:01
Average standard deviation of split frequencies: 0.012313
470500 -- (-538.265) [-538.730] (-537.420) (-541.460) * (-538.419) (-538.129) [-537.497] (-539.692) -- 0:00:01
471000 -- (-540.827) [-540.795] (-538.937) (-540.861) * (-541.683) (-539.959) [-537.145] (-536.761) -- 0:00:01
471500 -- [-541.548] (-541.345) (-537.071) (-540.847) * (-543.160) (-538.178) (-537.468) [-537.423] -- 0:00:01
472000 -- (-539.946) (-538.798) (-540.333) [-538.625] * (-540.024) [-542.440] (-545.483) (-543.747) -- 0:00:01
472500 -- (-540.267) (-540.308) [-540.038] (-543.633) * (-538.916) (-537.601) [-537.775] (-537.189) -- 0:00:01
473000 -- [-542.720] (-539.966) (-539.898) (-541.584) * (-539.199) (-538.689) (-538.647) [-537.633] -- 0:00:01
473500 -- [-538.298] (-542.506) (-537.013) (-540.639) * [-537.853] (-539.808) (-538.710) (-537.217) -- 0:00:01
474000 -- (-542.085) (-537.633) [-541.692] (-543.698) * (-541.470) [-537.498] (-537.226) (-539.300) -- 0:00:01
474500 -- (-538.761) (-536.948) [-539.117] (-537.877) * (-539.077) [-538.883] (-538.322) (-537.883) -- 0:00:01
475000 -- (-538.299) (-541.238) [-537.853] (-538.775) * (-538.913) [-540.369] (-537.054) (-538.898) -- 0:00:01
Average standard deviation of split frequencies: 0.013108
475500 -- (-538.473) [-537.445] (-536.904) (-540.171) * (-538.737) (-537.827) (-539.821) [-540.475] -- 0:00:01
476000 -- (-542.805) [-538.684] (-544.192) (-539.746) * (-538.573) (-538.073) (-537.406) [-538.178] -- 0:00:01
476500 -- (-538.686) [-537.397] (-540.262) (-537.950) * (-539.251) (-541.356) [-536.610] (-541.143) -- 0:00:01
477000 -- (-537.255) (-541.712) [-540.428] (-540.829) * [-539.015] (-542.397) (-540.449) (-541.674) -- 0:00:01
477500 -- (-537.509) (-537.737) (-542.454) [-538.252] * [-538.857] (-540.475) (-542.668) (-538.520) -- 0:00:01
478000 -- (-538.805) (-537.536) (-542.881) [-540.016] * [-537.913] (-541.863) (-540.610) (-537.971) -- 0:00:01
478500 -- (-537.311) [-538.454] (-538.572) (-539.568) * [-538.442] (-537.522) (-537.361) (-540.361) -- 0:00:01
479000 -- (-537.404) [-541.263] (-538.777) (-538.466) * (-539.898) (-537.228) (-538.542) [-539.433] -- 0:00:01
479500 -- (-541.316) [-537.281] (-540.604) (-538.407) * (-541.080) [-537.419] (-543.374) (-537.495) -- 0:00:01
480000 -- (-540.490) (-542.451) [-538.292] (-544.123) * (-539.479) (-540.899) [-539.225] (-538.402) -- 0:00:01
Average standard deviation of split frequencies: 0.012749
480500 -- (-536.841) (-539.938) (-539.149) [-541.571] * (-540.018) (-542.852) (-540.584) [-539.326] -- 0:00:01
481000 -- [-537.720] (-538.204) (-537.996) (-539.185) * (-539.138) (-540.923) (-540.769) [-540.045] -- 0:00:01
481500 -- (-540.355) (-540.233) [-540.425] (-537.759) * [-537.946] (-538.229) (-538.708) (-537.923) -- 0:00:01
482000 -- (-537.249) (-539.475) [-537.943] (-538.120) * [-538.074] (-538.006) (-537.376) (-538.146) -- 0:00:01
482500 -- [-537.005] (-537.262) (-538.169) (-538.616) * (-538.170) (-538.655) [-539.767] (-538.992) -- 0:00:01
483000 -- (-539.173) [-539.511] (-538.166) (-537.473) * (-537.816) (-539.407) [-538.981] (-539.700) -- 0:00:01
483500 -- (-537.508) (-540.603) [-537.736] (-541.003) * [-540.974] (-538.289) (-542.182) (-540.588) -- 0:00:00
484000 -- [-538.311] (-541.703) (-540.652) (-537.834) * [-538.760] (-541.136) (-537.784) (-543.274) -- 0:00:00
484500 -- [-538.745] (-540.400) (-537.870) (-543.170) * (-540.145) (-539.434) (-537.948) [-541.696] -- 0:00:00
485000 -- (-538.266) [-538.664] (-538.200) (-539.792) * (-538.249) [-540.789] (-543.227) (-538.938) -- 0:00:00
Average standard deviation of split frequencies: 0.012952
485500 -- (-541.501) [-537.708] (-541.002) (-538.560) * [-538.098] (-539.562) (-536.926) (-537.009) -- 0:00:00
486000 -- (-539.021) (-542.128) (-540.780) [-538.946] * [-536.707] (-544.369) (-537.010) (-538.463) -- 0:00:00
486500 -- (-539.536) [-538.783] (-539.413) (-537.589) * (-538.221) (-537.778) [-538.700] (-537.701) -- 0:00:00
487000 -- (-545.895) (-538.408) [-536.928] (-539.817) * (-539.150) (-539.742) (-541.661) [-537.952] -- 0:00:00
487500 -- (-538.581) (-539.414) (-540.945) [-540.270] * (-541.132) (-540.460) (-537.620) [-537.764] -- 0:00:00
488000 -- (-539.655) (-539.811) [-537.955] (-537.335) * [-540.825] (-539.407) (-537.474) (-543.458) -- 0:00:00
488500 -- [-539.421] (-539.649) (-536.852) (-543.843) * (-537.599) (-537.473) (-537.767) [-537.247] -- 0:00:00
489000 -- (-538.171) (-538.519) (-538.622) [-540.242] * (-538.809) [-536.890] (-537.376) (-539.017) -- 0:00:00
489500 -- [-540.042] (-539.542) (-540.564) (-543.270) * (-539.095) [-537.650] (-537.543) (-540.735) -- 0:00:00
490000 -- (-538.995) [-542.342] (-538.242) (-541.822) * (-540.405) [-537.918] (-539.279) (-537.504) -- 0:00:00
Average standard deviation of split frequencies: 0.012207
490500 -- (-541.701) [-541.796] (-538.098) (-540.013) * [-539.570] (-537.517) (-539.116) (-538.613) -- 0:00:00
491000 -- (-543.159) (-540.631) [-537.512] (-537.681) * (-539.335) (-536.939) (-538.263) [-538.690] -- 0:00:00
491500 -- (-540.269) [-538.924] (-540.017) (-539.944) * (-537.330) (-538.971) (-539.938) [-538.577] -- 0:00:00
492000 -- (-538.321) (-538.918) (-537.813) [-538.875] * (-543.124) [-537.147] (-543.742) (-540.892) -- 0:00:00
492500 -- (-539.422) (-538.040) (-539.365) [-537.038] * (-539.091) (-537.380) [-537.404] (-537.317) -- 0:00:00
493000 -- (-538.704) (-539.629) (-538.675) [-542.581] * (-540.718) [-537.061] (-539.111) (-536.890) -- 0:00:00
493500 -- (-539.529) (-538.020) (-542.157) [-544.479] * (-539.763) (-536.703) [-539.184] (-537.146) -- 0:00:00
494000 -- (-538.893) (-538.402) (-538.392) [-542.563] * (-542.293) [-541.467] (-538.504) (-537.295) -- 0:00:00
494500 -- [-539.698] (-539.666) (-543.177) (-539.087) * (-539.721) (-544.446) (-536.810) [-541.312] -- 0:00:00
495000 -- (-539.532) (-541.003) [-538.395] (-539.560) * (-538.382) [-539.266] (-540.056) (-541.306) -- 0:00:00
Average standard deviation of split frequencies: 0.012579
495500 -- (-539.138) (-539.555) [-540.235] (-538.667) * (-542.040) [-537.415] (-537.070) (-537.867) -- 0:00:00
496000 -- (-539.466) (-538.578) [-537.378] (-538.259) * (-541.441) [-538.000] (-541.035) (-537.554) -- 0:00:00
496500 -- (-540.790) (-539.600) (-541.586) [-538.131] * (-537.198) (-538.405) (-541.288) [-537.497] -- 0:00:00
497000 -- [-539.059] (-537.641) (-542.868) (-538.544) * (-538.626) (-537.123) (-538.060) [-537.853] -- 0:00:00
497500 -- (-539.543) (-537.813) [-537.028] (-538.722) * (-538.141) (-543.264) [-540.292] (-539.343) -- 0:00:00
498000 -- (-539.013) [-540.863] (-537.663) (-537.029) * (-539.908) [-537.830] (-536.773) (-542.927) -- 0:00:00
498500 -- (-541.087) (-537.133) (-537.347) [-539.587] * (-542.501) [-538.474] (-537.128) (-537.030) -- 0:00:00
499000 -- [-541.203] (-537.948) (-537.912) (-538.512) * (-545.614) (-537.112) [-542.791] (-538.398) -- 0:00:00
499500 -- (-539.083) (-540.422) [-541.322] (-538.488) * (-542.212) (-537.277) (-538.102) [-539.792] -- 0:00:00
500000 -- (-540.180) [-536.988] (-538.923) (-539.217) * [-538.007] (-537.834) (-538.397) (-538.627) -- 0:00:00
Average standard deviation of split frequencies: 0.013126
Analysis completed in 30 seconds
Analysis used 28.82 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -536.45
Likelihood of best state for "cold" chain of run 2 was -536.45
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
77.7 % ( 67 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
40.1 % ( 35 %) Dirichlet(Pi{all})
41.3 % ( 23 %) Slider(Pi{all})
88.5 % ( 82 %) Multiplier(Alpha{1,2})
88.3 % ( 87 %) Multiplier(Alpha{3})
24.1 % ( 30 %) Slider(Pinvar{all})
98.5 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 91 %) ParsSPR(Tau{all},V{all})
30.6 % ( 18 %) Multiplier(V{all})
97.5 % ( 92 %) Nodeslider(V{all})
35.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
77.7 % ( 81 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.6 % ( 36 %) Dirichlet(Pi{all})
41.2 % ( 33 %) Slider(Pi{all})
87.9 % ( 82 %) Multiplier(Alpha{1,2})
88.4 % ( 86 %) Multiplier(Alpha{3})
24.4 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
69.9 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
30.7 % ( 19 %) Multiplier(V{all})
97.5 % ( 94 %) Nodeslider(V{all})
35.1 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83630 0.82 0.67
3 | 83472 83374 0.84
4 | 82806 83358 83360
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83468 0.82 0.67
3 | 83373 83098 0.84
4 | 83113 83404 83544
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -537.89
| 2 2 |
| 21 1 2 |
| 1 1 2 2 121 2 1 |
| 1 1 2 * 1 2 2 2 |
| 1 2 1 2 211 2 1 2 2* 11 |
| 1 1 1 1 2 1 2 1 1 1 1 1 2* |
|12 2 111212 2121 21 2 1* 1 2 2 |
|2 2 2 22 1 2 11*2 2 1 2 1 2|
| 1 2 12 2 2 1 2 12 |
| 1 1 2 22 1|
| 2 2 2 |
| 1 1 |
| 12 |
| 1 |
| 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -540.41
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -538.16 -540.90
2 -538.17 -541.46
--------------------------------------
TOTAL -538.17 -541.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893935 0.095081 0.331705 1.467940 0.860207 751.00 751.00 1.000
r(A<->C){all} 0.160759 0.018709 0.000119 0.432348 0.120785 71.85 98.54 1.003
r(A<->G){all} 0.169853 0.019723 0.000064 0.432678 0.135733 161.18 214.39 1.019
r(A<->T){all} 0.150896 0.018328 0.000124 0.420930 0.106545 33.27 37.20 0.999
r(C<->G){all} 0.163618 0.020111 0.000176 0.450734 0.124190 44.58 73.22 0.999
r(C<->T){all} 0.165516 0.019754 0.000082 0.450066 0.129666 94.57 127.72 1.005
r(G<->T){all} 0.189358 0.020488 0.000677 0.470551 0.164683 59.46 72.65 1.009
pi(A){all} 0.218545 0.000417 0.181468 0.261247 0.218279 687.01 719.01 0.999
pi(C){all} 0.272755 0.000507 0.232903 0.321633 0.272868 721.50 736.25 1.000
pi(G){all} 0.297283 0.000510 0.254960 0.340267 0.297225 619.37 641.37 0.999
pi(T){all} 0.211417 0.000388 0.175473 0.251312 0.210857 751.00 751.00 1.000
alpha{1,2} 0.413045 0.223420 0.000428 1.456631 0.228278 437.91 510.21 1.001
alpha{3} 0.431150 0.236407 0.000526 1.425635 0.269571 567.56 593.42 0.999
pinvar{all} 0.995526 0.000030 0.985626 0.999996 0.997351 416.11 537.91 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .**.**
9 -- .***.*
10 -- ....**
11 -- .*...*
12 -- ...*.*
13 -- .*.***
14 -- ..*..*
15 -- ...**.
16 -- .*.*..
17 -- ..**..
18 -- ..****
19 -- .*..*.
20 -- ..*.*.
21 -- .****.
22 -- .*..**
23 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 235 0.156458 0.000942 0.155792 0.157124 2
8 232 0.154461 0.003766 0.151798 0.157124 2
9 225 0.149800 0.012240 0.141145 0.158455 2
10 222 0.147803 0.005649 0.143808 0.151798 2
11 222 0.147803 0.032013 0.125166 0.170439 2
12 217 0.144474 0.031071 0.122503 0.166445 2
13 214 0.142477 0.003766 0.139814 0.145140 2
14 212 0.141145 0.009416 0.134487 0.147803 2
15 211 0.140479 0.004708 0.137150 0.143808 2
16 210 0.139814 0.016948 0.127830 0.151798 2
17 209 0.139148 0.006591 0.134487 0.143808 2
18 209 0.139148 0.006591 0.134487 0.143808 2
19 207 0.137816 0.012240 0.129161 0.146471 2
20 207 0.137816 0.021656 0.122503 0.153129 2
21 196 0.130493 0.001883 0.129161 0.131824 2
22 159 0.105859 0.029188 0.085220 0.126498 2
23 152 0.101198 0.024480 0.083888 0.118509 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099420 0.010141 0.000061 0.301141 0.068491 0.999 2
length{all}[2] 0.096001 0.008806 0.000102 0.285237 0.066617 1.000 2
length{all}[3] 0.101862 0.009803 0.000106 0.306934 0.072094 0.999 2
length{all}[4] 0.098779 0.010074 0.000155 0.304792 0.068826 0.999 2
length{all}[5] 0.103715 0.010232 0.000095 0.307128 0.074072 0.999 2
length{all}[6] 0.099332 0.009722 0.000037 0.296865 0.068022 1.001 2
length{all}[7] 0.109111 0.012977 0.001388 0.336016 0.073264 0.996 2
length{all}[8] 0.091968 0.009073 0.000030 0.240771 0.066535 1.000 2
length{all}[9] 0.110412 0.011845 0.001139 0.337959 0.076565 0.996 2
length{all}[10] 0.092489 0.007341 0.000065 0.252787 0.065404 0.996 2
length{all}[11] 0.098962 0.010054 0.000257 0.278246 0.066062 0.996 2
length{all}[12] 0.109002 0.010714 0.000465 0.318409 0.076783 0.998 2
length{all}[13] 0.094250 0.007677 0.000427 0.258491 0.063195 0.996 2
length{all}[14] 0.095935 0.009390 0.000206 0.281070 0.072099 1.008 2
length{all}[15] 0.094784 0.010286 0.000049 0.295249 0.062240 0.999 2
length{all}[16] 0.114578 0.012504 0.000711 0.360517 0.077566 0.995 2
length{all}[17] 0.088943 0.006715 0.000451 0.251450 0.067866 1.000 2
length{all}[18] 0.098634 0.007552 0.000029 0.269661 0.073710 0.995 2
length{all}[19] 0.088692 0.007150 0.001366 0.243966 0.063824 0.997 2
length{all}[20] 0.098762 0.009971 0.000801 0.285897 0.063641 1.005 2
length{all}[21] 0.084312 0.007173 0.000176 0.240037 0.057917 0.997 2
length{all}[22] 0.101883 0.011052 0.000895 0.329852 0.068388 1.001 2
length{all}[23] 0.103277 0.011894 0.000225 0.316726 0.065478 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.013126
Maximum standard deviation of split frequencies = 0.032013
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 42 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 390
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 130 / 130 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 130 / 130 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038522 0.010070 0.020248 0.017410 0.038475 0.018938 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -541.498962
Iterating by ming2
Initial: fx= 541.498962
x= 0.03852 0.01007 0.02025 0.01741 0.03847 0.01894 0.30000 1.30000
1 h-m-p 0.0000 0.0001 315.0268 ++ 533.743250 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0169 33.5789 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 287.9290 ++ 529.013583 m 0.0001 44 | 2/8
4 h-m-p 0.0005 0.0238 27.5067 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 257.7473 ++ 528.225003 m 0.0000 75 | 3/8
6 h-m-p 0.0001 0.0317 22.1453 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 223.1467 ++ 527.718160 m 0.0000 105 | 4/8
8 h-m-p 0.0001 0.0398 17.0557 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 182.0525 ++ 523.002377 m 0.0001 135 | 5/8
10 h-m-p 0.0016 0.0669 11.3992 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 129.1236 ++ 522.996185 m 0.0000 166 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
13 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996185 m 8.0000 204 | 6/8
14 h-m-p 0.0160 8.0000 0.6532 ------------Y 522.996185 0 0.0000 229 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996185 m 8.0000 245 | 6/8
16 h-m-p 0.0108 5.3758 0.6883 ---------Y 522.996185 0 0.0000 267 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 ----N 522.996185 0 0.0000 284 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996185 m 8.0000 300 | 6/8
19 h-m-p 0.0160 8.0000 0.5466 ----------Y 522.996185 0 0.0000 323 | 6/8
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
21 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996185 m 8.0000 363 | 6/8
22 h-m-p 0.0160 8.0000 0.7981 ---------C 522.996185 0 0.0000 385 | 6/8
23 h-m-p 0.0160 8.0000 0.0003 +++++ 522.996185 m 8.0000 401 | 6/8
24 h-m-p 0.0094 4.6912 0.7493 ---------N 522.996185 0 0.0000 423 | 6/8
25 h-m-p 0.0160 8.0000 0.0001 ---------Y 522.996185 0 0.0000 445 | 6/8
26 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
27 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996185 m 8.0000 485 | 6/8
28 h-m-p 0.0160 8.0000 0.4659 ---------Y 522.996185 0 0.0000 507 | 6/8
29 h-m-p 0.0160 8.0000 0.0006 +++++ 522.996185 m 8.0000 523 | 6/8
30 h-m-p 0.0160 8.0000 0.7827 -----------C 522.996185 0 0.0000 547 | 6/8
31 h-m-p 0.0160 8.0000 0.0000 ----------Y 522.996185 0 0.0000 570 | 6/8
32 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996185 m 8.0000 586 | 6/8
33 h-m-p 0.0160 8.0000 0.0860 ------------Y 522.996185 0 0.0000 611 | 6/8
34 h-m-p 0.0160 8.0000 0.0000 ------C 522.996185 0 0.0000 630 | 6/8
35 h-m-p 0.0160 8.0000 0.0000 -------C 522.996185 0 0.0000 650
Out..
lnL = -522.996185
651 lfun, 651 eigenQcodon, 3906 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055106 0.066848 0.076663 0.043685 0.088705 0.079331 0.297920 0.575024 0.374996
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.371132
np = 9
lnL0 = -573.980590
Iterating by ming2
Initial: fx= 573.980590
x= 0.05511 0.06685 0.07666 0.04368 0.08870 0.07933 0.29792 0.57502 0.37500
1 h-m-p 0.0000 0.0004 295.1870 +++ 541.928558 m 0.0004 15 | 1/9
2 h-m-p 0.0001 0.0004 162.5383 ++ 534.646733 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0000 5025.5246 ++ 528.538881 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 1720.0408 ++ 524.780112 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 3833.4896 ++ 524.112553 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 17863.2237 ++ 522.996149 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 522.996149 m 8.0000 87 | 6/9
8 h-m-p 0.0048 2.4077 0.3981 ---------Y 522.996149 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0009 +++++ 522.996148 m 8.0000 129 | 6/9
10 h-m-p 0.0158 1.9783 0.4657 ----------C 522.996148 0 0.0000 154 | 6/9
11 h-m-p 0.0041 2.0372 0.0427 +++++ 522.996142 m 2.0372 172 | 7/9
12 h-m-p 0.2214 8.0000 0.0422 -------------C 522.996142 0 0.0000 200 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996142 m 8.0000 217 | 7/9
14 h-m-p 0.0040 1.9809 0.3398 ------------.. | 7/9
15 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996142 m 8.0000 258 | 7/9
16 h-m-p 0.0040 1.9890 0.3270 ---------C 522.996142 0 0.0000 281 | 7/9
17 h-m-p 0.0160 8.0000 0.0033 +++++ 522.996139 m 8.0000 298 | 7/9
18 h-m-p 0.0786 2.0013 0.3321 -----------Y 522.996139 0 0.0000 323 | 7/9
19 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996139 m 8.0000 340 | 7/9
20 h-m-p 0.0043 2.1397 0.3140 ---------N 522.996139 0 0.0000 363 | 7/9
21 h-m-p 0.0160 8.0000 0.0004 +++++ 522.996138 m 8.0000 380 | 7/9
22 h-m-p 0.0108 2.1660 0.3148 -----------C 522.996138 0 0.0000 405 | 7/9
23 h-m-p 0.0160 8.0000 0.0000 ----Y 522.996138 0 0.0000 423 | 7/9
24 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996138 m 8.0000 440 | 7/9
25 h-m-p 0.0053 2.6575 0.5344 ----------Y 522.996138 0 0.0000 464 | 7/9
26 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996138 m 8.0000 481 | 7/9
27 h-m-p 0.0045 2.2672 0.3375 ----------Y 522.996138 0 0.0000 505 | 7/9
28 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996138 m 8.0000 522 | 7/9
29 h-m-p 0.0050 2.4895 0.4587 ---------Y 522.996138 0 0.0000 545 | 7/9
30 h-m-p 0.0160 8.0000 0.0001 ------Y 522.996138 0 0.0000 565 | 7/9
31 h-m-p 0.0160 8.0000 0.0000 -----------Y 522.996138 0 0.0000 590
Out..
lnL = -522.996138
591 lfun, 1773 eigenQcodon, 7092 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044480 0.085442 0.035738 0.095989 0.055222 0.041212 0.264397 0.813962 0.254323 0.453009 1.524697
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.476254
np = 11
lnL0 = -567.482778
Iterating by ming2
Initial: fx= 567.482778
x= 0.04448 0.08544 0.03574 0.09599 0.05522 0.04121 0.26440 0.81396 0.25432 0.45301 1.52470
1 h-m-p 0.0000 0.0003 294.6535 +++ 541.304354 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0004 99.9764 ++ 537.748014 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 8744.7731 ++ 536.098676 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 795546.0264 ++ 532.021391 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 14074.8248 ++ 524.360114 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 2402.1795 ++ 522.996165 m 0.0000 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 522.996165 m 8.0000 101 | 6/11
8 h-m-p 0.0295 8.0000 0.0262 --------Y 522.996165 0 0.0000 128 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996165 m 8.0000 150 | 6/11
10 h-m-p 0.0160 8.0000 1.1785 -----------C 522.996165 0 0.0000 180 | 6/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996165 m 8.0000 197 | 6/11
12 h-m-p 0.0006 0.2867 3.3945 +++++ 522.996154 m 0.2867 219 | 7/11
13 h-m-p 1.6000 8.0000 0.1858 Y 522.996154 0 1.2615 233 | 7/11
14 h-m-p 1.6000 8.0000 0.0102 -Y 522.996154 0 0.1868 252 | 7/11
15 h-m-p 1.6000 8.0000 0.0001 -----C 522.996154 0 0.0003 275
Out..
lnL = -522.996154
276 lfun, 1104 eigenQcodon, 4968 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -523.003973 S = -522.994344 -0.003683
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:04
did 20 / 54 patterns 0:04
did 30 / 54 patterns 0:04
did 40 / 54 patterns 0:04
did 50 / 54 patterns 0:04
did 54 / 54 patterns 0:04
Time used: 0:04
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037605 0.026186 0.080107 0.108309 0.039585 0.103100 0.173185 0.404227 0.548726 0.646235 1.625116 2.643263
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 6.185401
np = 12
lnL0 = -571.697002
Iterating by ming2
Initial: fx= 571.697002
x= 0.03760 0.02619 0.08011 0.10831 0.03958 0.10310 0.17318 0.40423 0.54873 0.64624 1.62512 2.64326
1 h-m-p 0.0000 0.0002 289.3127 +++ 552.969891 m 0.0002 18 | 1/12
2 h-m-p 0.0004 0.0022 65.4512 ++ 544.889009 m 0.0022 33 | 2/12
3 h-m-p 0.0000 0.0000 623.2407 ++ 543.915676 m 0.0000 48 | 3/12
4 h-m-p 0.0000 0.0004 875.4321 +++ 528.734515 m 0.0004 64 | 4/12
5 h-m-p 0.0000 0.0000 41773.0930 ++ 523.550751 m 0.0000 79 | 5/12
6 h-m-p 0.0000 0.0000 706.5380 ++ 523.424325 m 0.0000 94 | 6/12
7 h-m-p 0.0007 0.2638 17.1362 -----------.. | 6/12
8 h-m-p 0.0000 0.0000 128.5435 ++ 522.996181 m 0.0000 133 | 7/12
9 h-m-p 0.0306 8.0000 0.0000 +++++ 522.996181 m 8.0000 151 | 7/12
10 h-m-p 0.0705 8.0000 0.0003 ++++ 522.996181 m 8.0000 173 | 7/12
11 h-m-p 0.0021 1.0038 1.0431 --------C 522.996181 0 0.0000 201 | 7/12
12 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996181 m 8.0000 219 | 7/12
13 h-m-p 0.0003 0.1441 9.7308 +++++ 522.996174 m 0.1441 242 | 8/12
14 h-m-p 0.7595 8.0000 1.8421 -------------Y 522.996174 0 0.0000 270 | 8/12
15 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996174 m 8.0000 288 | 8/12
16 h-m-p 0.0160 8.0000 0.0139 -------C 522.996174 0 0.0000 314 | 8/12
17 h-m-p 0.0160 8.0000 0.0041 +++++ 522.996174 m 8.0000 336 | 8/12
18 h-m-p 0.0509 8.0000 0.6491 ----------C 522.996174 0 0.0000 365 | 8/12
19 h-m-p 0.0160 8.0000 0.0000 ----Y 522.996174 0 0.0000 388 | 8/12
20 h-m-p 0.0160 8.0000 0.0000 +++++ 522.996174 m 8.0000 410 | 8/12
21 h-m-p 0.0160 8.0000 0.2926 -----------Y 522.996174 0 0.0000 440 | 8/12
22 h-m-p 0.0160 8.0000 0.0000 ---N 522.996174 0 0.0001 462 | 8/12
23 h-m-p 0.0160 8.0000 0.0000 --Y 522.996174 0 0.0003 483
Out..
lnL = -522.996174
484 lfun, 1936 eigenQcodon, 8712 P(t)
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048273 0.012428 0.032143 0.070702 0.104713 0.016316 0.000100 0.273575 1.779531
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 29.768422
np = 9
lnL0 = -556.866715
Iterating by ming2
Initial: fx= 556.866715
x= 0.04827 0.01243 0.03214 0.07070 0.10471 0.01632 0.00011 0.27358 1.77953
1 h-m-p 0.0000 0.0000 281.1722 ++ 556.637767 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0223 14.4081 ---------.. | 1/9
3 h-m-p 0.0000 0.0001 281.3287 ++ 548.391281 m 0.0001 45 | 2/9
4 h-m-p 0.0018 0.0117 14.4976 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 261.1388 ++ 546.148128 m 0.0000 79 | 3/9
6 h-m-p 0.0005 0.0174 16.0211 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 233.6707 ++ 538.737341 m 0.0001 112 | 4/9
8 h-m-p 0.0016 0.0158 17.1112 ++ 538.038153 m 0.0158 124 | 5/9
9 h-m-p 0.0001 0.0007 306.9069 ++ 535.831826 m 0.0007 136 | 6/9
10 h-m-p 0.0004 0.0025 606.5777 ++ 534.153379 m 0.0025 148 | 6/9
11 h-m-p 0.0697 4.5649 21.7029 --YCY 533.837603 2 0.0013 166 | 6/9
12 h-m-p 0.0043 0.0213 2.4904 ------------.. | 6/9
13 h-m-p 0.0000 0.0003 160.8655 +++ 526.544250 m 0.0003 201 | 7/9
14 h-m-p 0.0000 0.0001 272.1306 ++ 522.996080 m 0.0001 213 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 ++ 522.996080 m 8.0000 225 | 8/9
16 h-m-p 0.0160 8.0000 0.0006 +++++ 522.996080 m 8.0000 241 | 8/9
17 h-m-p 0.7567 8.0000 0.0060 ---------Y 522.996080 0 0.0000 263 | 8/9
18 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996080 m 8.0000 279 | 8/9
19 h-m-p 0.2587 8.0000 0.0043 ---------C 522.996080 0 0.0000 301 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 -----N 522.996080 0 0.0000 319 | 8/9
21 h-m-p 0.0160 8.0000 1.5892 +++
QuantileBeta(0.15, 0.00500, 6.57405) = 3.387706e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
+ 522.996031 m 8.0000 335
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.736238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77823) = 1.677670e-161 2000 rounds
| 8/9
22 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
Y 522.996031 0 1.6000 347
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.736238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77854) = 1.677627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77790) = 1.677715e-161 2000 rounds
| 8/9
23 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
Y 522.996031 0 0.0160 360
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
Out..
lnL = -522.996031
361 lfun, 3971 eigenQcodon, 21660 P(t)
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.77822) = 1.677671e-161 2000 rounds
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053456 0.097411 0.086791 0.085409 0.047034 0.029056 0.000100 0.900000 0.836158 1.765928 1.292471
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.409442
np = 11
lnL0 = -570.293387
Iterating by ming2
Initial: fx= 570.293387
x= 0.05346 0.09741 0.08679 0.08541 0.04703 0.02906 0.00011 0.90000 0.83616 1.76593 1.29247
1 h-m-p 0.0000 0.0000 271.7966 ++ 570.050070 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0018 116.8997 ++++ 549.953988 m 0.0018 32 | 2/11
3 h-m-p 0.0000 0.0002 468.9768 ++ 539.241168 m 0.0002 46 | 3/11
4 h-m-p 0.0006 0.0031 34.5558 ++ 536.978994 m 0.0031 60 | 4/11
5 h-m-p 0.0001 0.0007 205.8621 ++ 525.814470 m 0.0007 74 | 5/11
6 h-m-p 0.0001 0.0006 85.7930 ++ 525.328927 m 0.0006 88 | 6/11
7 h-m-p 0.0000 0.0000 24721.1630 ++ 522.996146 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0004 ++ 522.996146 m 8.0000 116 | 7/11
9 h-m-p 0.0059 2.7288 0.5707 ----------Y 522.996146 0 0.0000 144 | 7/11
10 h-m-p 0.0160 8.0000 0.0008 +++++ 522.996146 m 8.0000 165 | 7/11
11 h-m-p 0.0225 5.2161 0.2874 -----------Y 522.996146 0 0.0000 194 | 7/11
12 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996145 m 8.0000 215 | 7/11
13 h-m-p 0.0042 0.8358 0.4030 ----------N 522.996145 0 0.0000 243 | 7/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996145 m 8.0000 264 | 7/11
15 h-m-p 0.0083 4.1458 0.2300 ----------Y 522.996145 0 0.0000 292 | 7/11
16 h-m-p 0.0160 8.0000 0.0003 +++++ 522.996145 m 8.0000 313 | 7/11
17 h-m-p 0.0116 4.7800 0.2191 -------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996145 m 8.0000 363 | 7/11
19 h-m-p 0.0079 3.9722 0.2019 -----------Y 522.996145 0 0.0000 392 | 7/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996145 m 8.0000 413 | 7/11
21 h-m-p 0.0024 1.2213 0.5316 ----------C 522.996145 0 0.0000 441 | 7/11
22 h-m-p 0.0160 8.0000 0.0011 +++++ 522.996144 m 8.0000 462 | 7/11
23 h-m-p 0.0162 3.5562 0.5189 -------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996143 m 8.0000 512 | 7/11
25 h-m-p 0.0081 4.0556 0.1992 ----------Y 522.996143 0 0.0000 540 | 7/11
26 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996143 m 8.0000 561 | 7/11
27 h-m-p 0.0048 0.5925 0.3962 ---------Y 522.996143 0 0.0000 588 | 7/11
28 h-m-p 0.0160 8.0000 0.0042 +++++ 522.996140 m 8.0000 609 | 7/11
29 h-m-p 0.0833 0.6082 0.4079 --------------.. | 7/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996139 m 8.0000 660 | 7/11
31 h-m-p 0.0088 4.3983 0.1896 -----------C 522.996139 0 0.0000 689 | 7/11
32 h-m-p 0.0160 8.0000 0.0008 +++++ 522.996138 m 8.0000 710 | 7/11
33 h-m-p 0.0269 2.6583 0.2358 ------------Y 522.996138 0 0.0000 740 | 7/11
34 h-m-p 0.0160 8.0000 0.0001 +++++ 522.996138 m 8.0000 761 | 7/11
35 h-m-p 0.0051 2.5524 0.8373 ------------.. | 7/11
36 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996138 m 8.0000 810 | 7/11
37 h-m-p 0.0090 4.5234 0.1861 -----------N 522.996138 0 0.0000 839 | 7/11
38 h-m-p 0.0160 8.0000 0.0155 +++++ 522.996099 m 8.0000 860 | 7/11
39 h-m-p 0.5578 4.4811 0.2220 --------------N 522.996099 0 0.0000 892 | 7/11
40 h-m-p 0.0160 8.0000 0.0019 +++++ 522.996092 m 8.0000 913 | 7/11
41 h-m-p 0.1137 8.0000 0.1306 ---------------.. | 7/11
42 h-m-p 0.0160 8.0000 0.0005 +++++ 522.996090 m 8.0000 965 | 7/11
43 h-m-p 0.0370 8.0000 0.1148 --------------.. | 7/11
44 h-m-p 0.0160 8.0000 0.0006 +++++ 522.996088 m 8.0000 1016 | 7/11
45 h-m-p 0.0391 8.0000 0.1127 --------------.. | 7/11
46 h-m-p 0.0160 8.0000 0.0006 +++++ 522.996085 m 8.0000 1067 | 7/11
47 h-m-p 0.0415 8.0000 0.1105 -----------C 522.996085 0 0.0000 1096 | 7/11
48 h-m-p 0.0001 0.0399 0.9916 +++++ 522.996056 m 0.0399 1117 | 8/11
49 h-m-p 0.3583 8.0000 0.0251 ------------Y 522.996056 0 0.0000 1147 | 8/11
50 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996056 m 8.0000 1167 | 8/11
51 h-m-p 0.0160 8.0000 0.4973 ------------C 522.996056 0 0.0000 1196 | 8/11
52 h-m-p 0.0160 8.0000 0.0002 +++++ 522.996055 m 8.0000 1216 | 8/11
53 h-m-p 0.0027 1.3325 1.6044 ----------Y 522.996055 0 0.0000 1243 | 8/11
54 h-m-p 0.0160 8.0000 0.0000 --N 522.996055 0 0.0003 1259 | 8/11
55 h-m-p 0.0160 8.0000 0.0000 -------N 522.996055 0 0.0000 1283
Out..
lnL = -522.996055
1284 lfun, 15408 eigenQcodon, 84744 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -523.027327 S = -522.996125 -0.013762
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:32
did 20 / 54 patterns 0:32
did 30 / 54 patterns 0:32
did 40 / 54 patterns 0:33
did 50 / 54 patterns 0:33
did 54 / 54 patterns 0:33
Time used: 0:33
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
NC_011896_1_WP_010908741_1_2298_MLBR_RS10890 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
NC_002677_1_NP_302421_1_1293_ML2158 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT
**************************************************
NC_011896_1_WP_010908741_1_2298_MLBR_RS10890 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
NC_002677_1_NP_302421_1_1293_ML2158 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120 EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS
**************************************************
NC_011896_1_WP_010908741_1_2298_MLBR_RS10890 CRTSVPAPEVIQMDETVLCADGEQEKLASW
NC_002677_1_NP_302421_1_1293_ML2158 CRTSVPAPEVIQMDETVLCADGEQEKLASW
NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410 CRTSVPAPEVIQMDETVLCADGEQEKLASW
NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800 CRTSVPAPEVIQMDETVLCADGEQEKLASW
NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795 CRTSVPAPEVIQMDETVLCADGEQEKLASW
NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120 CRTSVPAPEVIQMDETVLCADGEQEKLASW
******************************
>NC_011896_1_WP_010908741_1_2298_MLBR_RS10890 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG >NC_002677_1_NP_302421_1_1293_ML2158 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG >NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG >NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG >NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG >NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120 ATGTGTTCCGTCGCAAGCCGATTCTTAAGGACGAGATCCTTAACGCAATG CATGTTCTGTGCGCTCAATAAGGGTGCCTTCGCCGTGATCGTGTGCCTTG GCGATATCGCGCACAAGTTCACCGACAAAACGGTGCATGTGCATGTTACC GAGATCCGCACCCGGCGTTATGGCGCCTACGAGGTGCATGCCACTTTTGC CCCGTTAGTCGAAGACGCTTCGCCTAAGAGGTGTACGATTGCTAAGGCTG TCTACCGGGGACGGCAGGCATCGGACCTGAGGACATCGACTTCGCCCAGT TGCAGGACATCAGTGCCGGCGCCCGAGGTCATTCAAATGGACGAGACGGT CCTGTGCGCCGACGGCGAGCAAGAAAAACTAGCGAGCTGG
>NC_011896_1_WP_010908741_1_2298_MLBR_RS10890 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS CRTSVPAPEVIQMDETVLCADGEQEKLASW >NC_002677_1_NP_302421_1_1293_ML2158 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS CRTSVPAPEVIQMDETVLCADGEQEKLASW >NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS CRTSVPAPEVIQMDETVLCADGEQEKLASW >NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS CRTSVPAPEVIQMDETVLCADGEQEKLASW >NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS CRTSVPAPEVIQMDETVLCADGEQEKLASW >NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120 MCSVASRFLRTRSLTQCMFCALNKGAFAVIVCLGDIAHKFTDKTVHVHVT EIRTRRYGAYEVHATFAPLVEDASPKRCTIAKAVYRGRQASDLRTSTSPS CRTSVPAPEVIQMDETVLCADGEQEKLASW
#NEXUS
[ID: 5166904393]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908741_1_2298_MLBR_RS10890
NC_002677_1_NP_302421_1_1293_ML2158
NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410
NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800
NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795
NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908741_1_2298_MLBR_RS10890,
2 NC_002677_1_NP_302421_1_1293_ML2158,
3 NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410,
4 NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800,
5 NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795,
6 NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0684911,2:0.06661737,3:0.0720935,4:0.06882581,5:0.07407152,6:0.0680221);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0684911,2:0.06661737,3:0.0720935,4:0.06882581,5:0.07407152,6:0.0680221);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -538.16 -540.90
2 -538.17 -541.46
--------------------------------------
TOTAL -538.17 -541.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2158/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893935 0.095081 0.331705 1.467940 0.860207 751.00 751.00 1.000
r(A<->C){all} 0.160759 0.018709 0.000119 0.432348 0.120785 71.85 98.54 1.003
r(A<->G){all} 0.169853 0.019723 0.000064 0.432678 0.135733 161.18 214.39 1.019
r(A<->T){all} 0.150896 0.018328 0.000124 0.420930 0.106545 33.27 37.20 0.999
r(C<->G){all} 0.163618 0.020111 0.000176 0.450734 0.124190 44.58 73.22 0.999
r(C<->T){all} 0.165516 0.019754 0.000082 0.450066 0.129666 94.57 127.72 1.005
r(G<->T){all} 0.189358 0.020488 0.000677 0.470551 0.164683 59.46 72.65 1.009
pi(A){all} 0.218545 0.000417 0.181468 0.261247 0.218279 687.01 719.01 0.999
pi(C){all} 0.272755 0.000507 0.232903 0.321633 0.272868 721.50 736.25 1.000
pi(G){all} 0.297283 0.000510 0.254960 0.340267 0.297225 619.37 641.37 0.999
pi(T){all} 0.211417 0.000388 0.175473 0.251312 0.210857 751.00 751.00 1.000
alpha{1,2} 0.413045 0.223420 0.000428 1.456631 0.228278 437.91 510.21 1.001
alpha{3} 0.431150 0.236407 0.000526 1.425635 0.269571 567.56 593.42 0.999
pinvar{all} 0.995526 0.000030 0.985626 0.999996 0.997351 416.11 537.91 0.999
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2158/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 130
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 3 3 3 3 3 3
TTC 4 4 4 4 4 4 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 4 4 4 4 4 4
Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 3 3 3 3 3 3 | AAC 0 0 0 0 0 0 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 5 5 5 5 5 5 | AAG 4 4 4 4 4 4 | AGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 3 3 3 3 3 3 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 5 5 5 5 5 5 | GCC 6 6 6 6 6 6 | GAC 5 5 5 5 5 5 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 4 4 4 4 4 4 | GAG 5 5 5 5 5 5 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908741_1_2298_MLBR_RS10890
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
#2: NC_002677_1_NP_302421_1_1293_ML2158
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
#3: NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
#4: NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
#5: NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
#6: NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 18
TTC 24 | TCC 12 | TAC 12 | TGC 24
Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 6
CTC 6 | CCC 12 | CAC 6 | CGC 6
CTA 6 | CCA 0 | Gln Q CAA 18 | CGA 6
CTG 12 | CCG 12 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 18 | ACC 18 | AAC 0 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 30 | AAG 24 | AGG 24
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 18 | Asp D GAT 6 | Gly G GGT 6
GTC 30 | GCC 36 | GAC 30 | GGC 18
GTA 0 | GCA 12 | Glu E GAA 12 | GGA 6
GTG 36 | GCG 24 | GAG 30 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20000 C:0.18462 A:0.26923 G:0.34615
position 2: T:0.25385 C:0.30000 A:0.23846 G:0.20769
position 3: T:0.17692 C:0.33846 A:0.14615 G:0.33846
Average T:0.21026 C:0.27436 A:0.21795 G:0.29744
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -522.996185 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.297920 1.292471
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908741_1_2298_MLBR_RS10890: 0.000004, NC_002677_1_NP_302421_1_1293_ML2158: 0.000004, NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410: 0.000004, NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800: 0.000004, NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795: 0.000004, NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29792
omega (dN/dS) = 1.29247
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 302.1 87.9 1.2925 0.0000 0.0000 0.0 0.0
7..2 0.000 302.1 87.9 1.2925 0.0000 0.0000 0.0 0.0
7..3 0.000 302.1 87.9 1.2925 0.0000 0.0000 0.0 0.0
7..4 0.000 302.1 87.9 1.2925 0.0000 0.0000 0.0 0.0
7..5 0.000 302.1 87.9 1.2925 0.0000 0.0000 0.0 0.0
7..6 0.000 302.1 87.9 1.2925 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -522.996138 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.264397 0.669908 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908741_1_2298_MLBR_RS10890: 0.000004, NC_002677_1_NP_302421_1_1293_ML2158: 0.000004, NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410: 0.000004, NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800: 0.000004, NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795: 0.000004, NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.26440
MLEs of dN/dS (w) for site classes (K=2)
p: 0.66991 0.33009
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 302.5 87.5 0.3301 0.0000 0.0000 0.0 0.0
7..2 0.000 302.5 87.5 0.3301 0.0000 0.0000 0.0 0.0
7..3 0.000 302.5 87.5 0.3301 0.0000 0.0000 0.0 0.0
7..4 0.000 302.5 87.5 0.3301 0.0000 0.0000 0.0 0.0
7..5 0.000 302.5 87.5 0.3301 0.0000 0.0000 0.0 0.0
7..6 0.000 302.5 87.5 0.3301 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -522.996154 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.173185 0.687355 0.193129 0.286094 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908741_1_2298_MLBR_RS10890: 0.000004, NC_002677_1_NP_302421_1_1293_ML2158: 0.000004, NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410: 0.000004, NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800: 0.000004, NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795: 0.000004, NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.17318
MLEs of dN/dS (w) for site classes (K=3)
p: 0.68735 0.19313 0.11952
w: 0.28609 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 303.5 86.5 0.5093 0.0000 0.0000 0.0 0.0
7..2 0.000 303.5 86.5 0.5093 0.0000 0.0000 0.0 0.0
7..3 0.000 303.5 86.5 0.5093 0.0000 0.0000 0.0 0.0
7..4 0.000 303.5 86.5 0.5093 0.0000 0.0000 0.0 0.0
7..5 0.000 303.5 86.5 0.5093 0.0000 0.0000 0.0 0.0
7..6 0.000 303.5 86.5 0.5093 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908741_1_2298_MLBR_RS10890)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -522.996174 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.236152 0.560926 0.000001 1.084176 1.779845
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908741_1_2298_MLBR_RS10890: 0.000004, NC_002677_1_NP_302421_1_1293_ML2158: 0.000004, NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410: 0.000004, NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800: 0.000004, NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795: 0.000004, NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.23615 0.56093 0.20292
w: 0.00000 1.08418 1.77985
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 305.8 84.2 0.9693 0.0000 0.0000 0.0 0.0
7..2 0.000 305.8 84.2 0.9693 0.0000 0.0000 0.0 0.0
7..3 0.000 305.8 84.2 0.9693 0.0000 0.0000 0.0 0.0
7..4 0.000 305.8 84.2 0.9693 0.0000 0.0000 0.0 0.0
7..5 0.000 305.8 84.2 0.9693 0.0000 0.0000 0.0 0.0
7..6 0.000 305.8 84.2 0.9693 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908741_1_2298_MLBR_RS10890)
Pr(w>1) post mean +- SE for w
1 M 0.764 0.969
2 C 0.764 0.969
3 S 0.764 0.969
4 V 0.764 0.969
5 A 0.764 0.969
6 S 0.764 0.969
7 R 0.764 0.969
8 F 0.764 0.969
9 L 0.764 0.969
10 R 0.764 0.969
11 T 0.764 0.969
12 R 0.764 0.969
13 S 0.764 0.969
14 L 0.764 0.969
15 T 0.764 0.969
16 Q 0.764 0.969
17 C 0.764 0.969
18 M 0.764 0.969
19 F 0.764 0.969
20 C 0.764 0.969
21 A 0.764 0.969
22 L 0.764 0.969
23 N 0.764 0.969
24 K 0.764 0.969
25 G 0.764 0.969
26 A 0.764 0.969
27 F 0.764 0.969
28 A 0.764 0.969
29 V 0.764 0.969
30 I 0.764 0.969
31 V 0.764 0.969
32 C 0.764 0.969
33 L 0.764 0.969
34 G 0.764 0.969
35 D 0.764 0.969
36 I 0.764 0.969
37 A 0.764 0.969
38 H 0.764 0.969
39 K 0.764 0.969
40 F 0.764 0.969
41 T 0.764 0.969
42 D 0.764 0.969
43 K 0.764 0.969
44 T 0.764 0.969
45 V 0.764 0.969
46 H 0.764 0.969
47 V 0.764 0.969
48 H 0.764 0.969
49 V 0.764 0.969
50 T 0.764 0.969
51 E 0.764 0.969
52 I 0.764 0.969
53 R 0.764 0.969
54 T 0.764 0.969
55 R 0.764 0.969
56 R 0.764 0.969
57 Y 0.764 0.969
58 G 0.764 0.969
59 A 0.764 0.969
60 Y 0.764 0.969
61 E 0.764 0.969
62 V 0.764 0.969
63 H 0.764 0.969
64 A 0.764 0.969
65 T 0.764 0.969
66 F 0.764 0.969
67 A 0.764 0.969
68 P 0.764 0.969
69 L 0.764 0.969
70 V 0.764 0.969
71 E 0.764 0.969
72 D 0.764 0.969
73 A 0.764 0.969
74 S 0.764 0.969
75 P 0.764 0.969
76 K 0.764 0.969
77 R 0.764 0.969
78 C 0.764 0.969
79 T 0.764 0.969
80 I 0.764 0.969
81 A 0.764 0.969
82 K 0.764 0.969
83 A 0.764 0.969
84 V 0.764 0.969
85 Y 0.764 0.969
86 R 0.764 0.969
87 G 0.764 0.969
88 R 0.764 0.969
89 Q 0.764 0.969
90 A 0.764 0.969
91 S 0.764 0.969
92 D 0.764 0.969
93 L 0.764 0.969
94 R 0.764 0.969
95 T 0.764 0.969
96 S 0.764 0.969
97 T 0.764 0.969
98 S 0.764 0.969
99 P 0.764 0.969
100 S 0.764 0.969
101 C 0.764 0.969
102 R 0.764 0.969
103 T 0.764 0.969
104 S 0.764 0.969
105 V 0.764 0.969
106 P 0.764 0.969
107 A 0.764 0.969
108 P 0.764 0.969
109 E 0.764 0.969
110 V 0.764 0.969
111 I 0.764 0.969
112 Q 0.764 0.969
113 M 0.764 0.969
114 D 0.764 0.969
115 E 0.764 0.969
116 T 0.764 0.969
117 V 0.764 0.969
118 L 0.764 0.969
119 C 0.764 0.969
120 A 0.764 0.969
121 D 0.764 0.969
122 G 0.764 0.969
123 E 0.764 0.969
124 Q 0.764 0.969
125 E 0.764 0.969
126 K 0.764 0.969
127 L 0.764 0.969
128 A 0.764 0.969
129 S 0.764 0.969
130 W 0.764 0.969
Note: more than one w>1. Check rst for details
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -522.996031 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 12.778221
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908741_1_2298_MLBR_RS10890: 0.000004, NC_002677_1_NP_302421_1_1293_ML2158: 0.000004, NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410: 0.000004, NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800: 0.000004, NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795: 0.000004, NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 12.77822
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 305.8 84.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 305.8 84.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 305.8 84.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 305.8 84.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 305.8 84.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 305.8 84.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -522.996055 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.102219 1.989681 1.791259
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908741_1_2298_MLBR_RS10890: 0.000004, NC_002677_1_NP_302421_1_1293_ML2158: 0.000004, NZ_LVXE01000011_1_WP_010908741_1_371_A3216_RS05410: 0.000004, NZ_LYPH01000017_1_WP_010908741_1_595_A8144_RS02800: 0.000004, NZ_CP029543_1_WP_010908741_1_2319_DIJ64_RS11795: 0.000004, NZ_AP014567_1_WP_010908741_1_2384_JK2ML_RS12120: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.10222 q = 1.98968
(p1 = 0.00001) w = 1.79126
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00001 0.00016 0.00112 0.00577 0.02379 0.08557 0.31279 1.79126
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 305.8 84.2 0.0429 0.0000 0.0000 0.0 0.0
7..2 0.000 305.8 84.2 0.0429 0.0000 0.0000 0.0 0.0
7..3 0.000 305.8 84.2 0.0429 0.0000 0.0000 0.0 0.0
7..4 0.000 305.8 84.2 0.0429 0.0000 0.0000 0.0 0.0
7..5 0.000 305.8 84.2 0.0429 0.0000 0.0000 0.0 0.0
7..6 0.000 305.8 84.2 0.0429 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908741_1_2298_MLBR_RS10890)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:33
Model 1: NearlyNeutral -522.996138 Model 2: PositiveSelection -522.996154 Model 0: one-ratio -522.996185 Model 3: discrete -522.996174 Model 7: beta -522.996031 Model 8: beta&w>1 -522.996055 Model 0 vs 1 9.399999999004649E-5 Model 2 vs 1 3.200000014658144E-5 Model 8 vs 7 4.799999987881165E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
